NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061001

Metagenome Family F061001

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061001
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 43 residues
Representative Sequence MSKKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Number of Associated Samples 100
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.91 %
% of genes near scaffold ends (potentially truncated) 43.94 %
% of genes from short scaffolds (< 2000 bps) 86.36 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.879 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(38.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.636 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF02472ExbD 6.06
PF02687FtsX 2.27
PF01988VIT1 2.27
PF13193AMP-binding_C 1.52
PF01425Amidase 1.52
PF12704MacB_PCD 1.52
PF07676PD40 1.52
PF00005ABC_tran 1.52
PF076945TM-5TMR_LYT 1.52
PF13847Methyltransf_31 1.52
PF00719Pyrophosphatase 1.52
PF03989DNA_gyraseA_C 0.76
PF06956RtcR 0.76
PF13535ATP-grasp_4 0.76
PF07589PEP-CTERM 0.76
PF00593TonB_dep_Rec 0.76
PF07638Sigma70_ECF 0.76
PF00069Pkinase 0.76
PF02518HATPase_c 0.76
PF08241Methyltransf_11 0.76
PF13340DUF4096 0.76
PF07677A2M_recep 0.76
PF00326Peptidase_S9 0.76
PF01464SLT 0.76
PF064393keto-disac_hyd 0.76
PF00561Abhydrolase_1 0.76
PF00313CSD 0.76
PF12543DUF3738 0.76
PF00248Aldo_ket_red 0.76
PF00664ABC_membrane 0.76
PF13517FG-GAP_3 0.76
PF01435Peptidase_M48 0.76
PF04069OpuAC 0.76
PF04070DUF378 0.76
PF12695Abhydrolase_5 0.76
PF00034Cytochrom_C 0.76
PF03551PadR 0.76
PF14690zf-ISL3 0.76
PF00196GerE 0.76
PF04365BrnT_toxin 0.76
PF00756Esterase 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0848Biopolymer transport protein ExbDIntracellular trafficking, secretion, and vesicular transport [U] 6.06
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.03
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 2.27
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 2.27
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.52
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 1.52
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 1.52
COG4650Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domainTranscription [K] 1.52
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.76
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.76
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.76
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.76
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.76
COG2155Uncharacterized membrane protein YuzA, DUF378 familyFunction unknown [S] 0.76
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.88 %
UnclassifiedrootN/A37.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459004|F62QY1Z02JUAY2Not Available508Open in IMG/M
3300000956|JGI10216J12902_100538283All Organisms → cellular organisms → Bacteria → Proteobacteria4874Open in IMG/M
3300000956|JGI10216J12902_102463938Not Available974Open in IMG/M
3300001431|F14TB_100136310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium928Open in IMG/M
3300001686|C688J18823_10307463Not Available1039Open in IMG/M
3300004114|Ga0062593_101989020Not Available645Open in IMG/M
3300004153|Ga0063455_100442224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300004153|Ga0063455_101151345All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300004156|Ga0062589_101178944All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300004156|Ga0062589_101200775All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300004157|Ga0062590_102751882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium525Open in IMG/M
3300004463|Ga0063356_100313024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1956Open in IMG/M
3300004463|Ga0063356_103293228Not Available696Open in IMG/M
3300004463|Ga0063356_104091844All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium628Open in IMG/M
3300004463|Ga0063356_105538396Not Available542Open in IMG/M
3300004479|Ga0062595_100046039All Organisms → cellular organisms → Bacteria → Proteobacteria1953Open in IMG/M
3300004480|Ga0062592_101654122Not Available621Open in IMG/M
3300004643|Ga0062591_101310196All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300005093|Ga0062594_103328576Not Available505Open in IMG/M
3300005179|Ga0066684_10362990All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300005289|Ga0065704_10339764Not Available825Open in IMG/M
3300005290|Ga0065712_10068292All Organisms → cellular organisms → Bacteria → Proteobacteria12137Open in IMG/M
3300005328|Ga0070676_11269307Not Available562Open in IMG/M
3300005331|Ga0070670_100306731All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300005331|Ga0070670_101458292All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005332|Ga0066388_101770965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cajani1097Open in IMG/M
3300005332|Ga0066388_104529543Not Available708Open in IMG/M
3300005332|Ga0066388_107613725Not Available543Open in IMG/M
3300005335|Ga0070666_10586134All Organisms → cellular organisms → Bacteria → Proteobacteria813Open in IMG/M
3300005336|Ga0070680_101342492All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005354|Ga0070675_100084648All Organisms → cellular organisms → Bacteria → Proteobacteria2648Open in IMG/M
3300005364|Ga0070673_100488609All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales1112Open in IMG/M
3300005364|Ga0070673_102324009All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005438|Ga0070701_10202990All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300005457|Ga0070662_100411101All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300005526|Ga0073909_10269706All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005536|Ga0070697_100989841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300005543|Ga0070672_101599560Not Available585Open in IMG/M
3300005577|Ga0068857_102380285All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla520Open in IMG/M
3300005617|Ga0068859_100253858All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300005617|Ga0068859_101274328Not Available810Open in IMG/M
3300005719|Ga0068861_100068063All Organisms → cellular organisms → Bacteria2750Open in IMG/M
3300005719|Ga0068861_101823654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium604Open in IMG/M
3300005764|Ga0066903_100106738All Organisms → cellular organisms → Bacteria3815Open in IMG/M
3300005764|Ga0066903_100817183Not Available1670Open in IMG/M
3300005764|Ga0066903_101652462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1217Open in IMG/M
3300005764|Ga0066903_105187582All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium689Open in IMG/M
3300005764|Ga0066903_108662816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium517Open in IMG/M
3300005841|Ga0068863_100488074All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300005843|Ga0068860_101647834All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300006046|Ga0066652_100791748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300006237|Ga0097621_100241336All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300006847|Ga0075431_100903725Not Available852Open in IMG/M
3300006852|Ga0075433_11166772Not Available669Open in IMG/M
3300006854|Ga0075425_101036165All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300006871|Ga0075434_100431742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1338Open in IMG/M
3300006881|Ga0068865_100776710All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300009092|Ga0105250_10380004All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium623Open in IMG/M
3300009100|Ga0075418_10443752All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300009100|Ga0075418_10792217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300009100|Ga0075418_11456007Not Available743Open in IMG/M
3300009148|Ga0105243_11818141Not Available641Open in IMG/M
3300009148|Ga0105243_12316649All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla575Open in IMG/M
3300009148|Ga0105243_12796294All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009156|Ga0111538_10479936All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300009162|Ga0075423_10353983All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300009162|Ga0075423_12618657Not Available551Open in IMG/M
3300009176|Ga0105242_12123801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300009177|Ga0105248_10328937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis1721Open in IMG/M
3300009177|Ga0105248_11696945Not Available716Open in IMG/M
3300010362|Ga0126377_10002299All Organisms → cellular organisms → Bacteria13091Open in IMG/M
3300010373|Ga0134128_10446424Not Available1443Open in IMG/M
3300010397|Ga0134124_11569765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300010401|Ga0134121_10083908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2652Open in IMG/M
3300010403|Ga0134123_11412088Not Available737Open in IMG/M
3300011271|Ga0137393_10116084All Organisms → cellular organisms → Bacteria → Acidobacteria2203Open in IMG/M
3300012212|Ga0150985_119629086All Organisms → cellular organisms → Bacteria → Acidobacteria2330Open in IMG/M
3300012354|Ga0137366_10016925All Organisms → cellular organisms → Bacteria5712Open in IMG/M
3300012360|Ga0137375_10648993Not Available870Open in IMG/M
3300012469|Ga0150984_102988420Not Available905Open in IMG/M
3300012469|Ga0150984_122434477All Organisms → cellular organisms → Bacteria → Acidobacteria1369Open in IMG/M
3300012510|Ga0157316_1082361Not Available506Open in IMG/M
3300012685|Ga0137397_10395722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300012901|Ga0157288_10322423Not Available549Open in IMG/M
3300012958|Ga0164299_10393352Not Available888Open in IMG/M
3300012971|Ga0126369_12451745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300013306|Ga0163162_12373275All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300013308|Ga0157375_10873448All Organisms → cellular organisms → Bacteria → Acidobacteria1045Open in IMG/M
3300015245|Ga0137409_10221923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1692Open in IMG/M
3300015371|Ga0132258_10031141All Organisms → cellular organisms → Bacteria11922Open in IMG/M
3300015371|Ga0132258_10124286All Organisms → cellular organisms → Bacteria6138Open in IMG/M
3300015371|Ga0132258_11328498All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300015372|Ga0132256_101334141Not Available830Open in IMG/M
3300015373|Ga0132257_100003631All Organisms → cellular organisms → Bacteria14380Open in IMG/M
3300015373|Ga0132257_101592209Not Available835Open in IMG/M
3300015373|Ga0132257_101822503Not Available782Open in IMG/M
3300015374|Ga0132255_100485143Not Available1813Open in IMG/M
3300015374|Ga0132255_100692319Not Available1513Open in IMG/M
3300018476|Ga0190274_12015733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14673Open in IMG/M
3300018476|Ga0190274_12711647Not Available592Open in IMG/M
3300018482|Ga0066669_12160242Not Available527Open in IMG/M
3300022756|Ga0222622_10004020Not Available6446Open in IMG/M
3300025315|Ga0207697_10071521All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300025321|Ga0207656_10670828All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025893|Ga0207682_10054183All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales1666Open in IMG/M
3300025901|Ga0207688_10436271All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300025908|Ga0207643_10750393Not Available632Open in IMG/M
3300025923|Ga0207681_10314963All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales1242Open in IMG/M
3300025925|Ga0207650_10052606All Organisms → cellular organisms → Bacteria → Acidobacteria3017Open in IMG/M
3300025926|Ga0207659_10473047All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300025926|Ga0207659_11646223Not Available547Open in IMG/M
3300025934|Ga0207686_11219779Not Available616Open in IMG/M
3300025936|Ga0207670_10235123Not Available1409Open in IMG/M
3300025961|Ga0207712_10750240All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300025961|Ga0207712_12146115Not Available500Open in IMG/M
3300026075|Ga0207708_10935788Not Available751Open in IMG/M
3300027903|Ga0209488_11029329Not Available568Open in IMG/M
3300027907|Ga0207428_10414031Not Available986Open in IMG/M
3300028379|Ga0268266_11350253Not Available688Open in IMG/M
3300028380|Ga0268265_11795787All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300031538|Ga0310888_10003907All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis5006Open in IMG/M
3300031740|Ga0307468_100421571All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300031740|Ga0307468_101109417Not Available706Open in IMG/M
3300031890|Ga0306925_11779495Not Available591Open in IMG/M
3300031944|Ga0310884_10042463All Organisms → cellular organisms → Bacteria → Acidobacteria1995Open in IMG/M
3300031995|Ga0307409_101924753Not Available621Open in IMG/M
3300032013|Ga0310906_10589706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300032179|Ga0310889_10331633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300032261|Ga0306920_100418997Not Available1991Open in IMG/M
3300032397|Ga0315287_10012802All Organisms → cellular organisms → Bacteria8643Open in IMG/M
3300033412|Ga0310810_11493225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium502Open in IMG/M
3300033475|Ga0310811_10125743All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis3274Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.06%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere6.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.06%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.03%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.52%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.52%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459004Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4B_065683402170459004Grass SoilEAMSKRSKRIALILVGIAMAILAVAQHFGWIAGPPPLLAPGIQ
JGI10216J12902_10053828333300000956SoilMSKRSKRIALILVGIAMALLAVAQHFGWIAGPPPLLAPGIQ*
JGI10216J12902_10246393833300000956SoilMGKKSTRIAMILLLLVMAFLAVAQHFGWIAGPPPLLAPGVR*
F14TB_10013631023300001431SoilMGEKSKRIAMILILVVMALLAVAQHFGWIAGPPPLLAPGVR
C688J18823_1030746343300001686SoilMSNRSKRILLILVGAAIVLLAVAQHFGWIAGPPPLLAPGIQPNS*
Ga0062593_10198902023300004114SoilMSKTSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGVK*
Ga0063455_10044222423300004153SoilMSKRSKRIAMISVGVAIALLAVAQYFGWIAGPPPLLAPGI
Ga0063455_10115134513300004153SoilMSNRSKRILLILVGAAIVLLAVAQHFGWIAGPPPLLAPGIQPNF*
Ga0062589_10117894413300004156SoilMSKRSKRIALILVGVAIALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0062589_10120077513300004156SoilGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0062590_10275188213300004157SoilEAMSKRSKRIALILVGVGMAFLAVARHFGWIAGPPPLLAPGFQ*
Ga0063356_10031302423300004463Arabidopsis Thaliana RhizosphereVGNRQGRKVMSKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGIQ*
Ga0063356_10329322823300004463Arabidopsis Thaliana RhizosphereMSKRSKRIAALILVGGAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0063356_10409184413300004463Arabidopsis Thaliana RhizosphereAMSQRSKRIALILVGIAMALLAVAQYAGWIAGPPPILAPGIQ*
Ga0063356_10553839623300004463Arabidopsis Thaliana RhizosphereMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH*
Ga0062595_10004603923300004479SoilVAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0062592_10165412223300004480SoilMSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0062591_10131019613300004643SoilMSKKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0062594_10332857623300005093SoilMSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066684_1036299023300005179SoilMSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGI
Ga0065704_1033976423300005289Switchgrass RhizosphereMSKKAKRMALIFVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0065712_1006829243300005290Miscanthus RhizosphereMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070676_1126930713300005328Miscanthus RhizosphereMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070670_10030673123300005331Switchgrass RhizosphereMSKKSRRIAMILVGIVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0070670_10145829223300005331Switchgrass RhizosphereMSKRSKRIALILVGVAMVLLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066388_10177096513300005332Tropical Forest SoilVSKECRRIAIILVGVTMAFLAVAQQFGWIAGPPPFLATGIH*
Ga0066388_10452954313300005332Tropical Forest SoilMSRRSKRIALILLGITMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066388_10761372523300005332Tropical Forest SoilMSKKSKRIAMILVGVVMAFLAVAQHFGWIAGPPPLLAPGIH*
Ga0070666_1058613423300005335Switchgrass RhizosphereVAEGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070680_10134249223300005336Corn RhizosphereMSKKSKRIAMILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0070675_10008464833300005354Miscanthus RhizosphereMSKKSKRIAMILVGVVIALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0070673_10048860913300005364Switchgrass RhizosphereMSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIR*
Ga0070673_10232400913300005364Switchgrass RhizosphereTERREAMSKRSARIALIMVGIAMALLAVAQHFGWIAGPPPLLAPGMQ*
Ga0070701_1020299023300005438Corn, Switchgrass And Miscanthus RhizosphereMSKKSKRIAMILVGVAMALLAVAQHFGWIAGPPPLLAPGIR*
Ga0070662_10041110123300005457Corn RhizosphereMSKKSKRIAMLLVGVVIAILAVAQHFGWIAGPPPLLAPGIQ*
Ga0073909_1026970633300005526Surface SoilMSKKSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070697_10098984123300005536Corn, Switchgrass And Miscanthus RhizosphereKREQKGGKVMSKKSKRIAMFLAGVVMALLTVAQHFGWIAGPPPLLAPGIQ*
Ga0070672_10159956023300005543Miscanthus RhizosphereMSKKSKRIAMILVVAVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0068857_10238028523300005577Corn RhizosphereMSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0068859_10025385843300005617Switchgrass RhizosphereSKRSKRIALILVGVAMVLLAVAQHFGWIAGPPPLLAPGIQ*
Ga0068859_10127432823300005617Switchgrass RhizosphereMSKRSKRIALILVGTAMALLAVAQHLGWIAGPPPLLAPG
Ga0068861_10006806323300005719Switchgrass RhizosphereMSKRSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0068861_10182365413300005719Switchgrass RhizosphereTERREMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0066903_10010673843300005764Tropical Forest SoilMSKKSKRIAMIVLGVVLVLLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066903_10081718313300005764Tropical Forest SoilMSKKSRRIALILVGVVMAVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066903_10165246213300005764Tropical Forest SoilMSKRSTRIALILVGVAMALLAVAQHFGWIAGPPPLLAP
Ga0066903_10518758223300005764Tropical Forest SoilERREVMSKKSKRIAFVLFGVAMAILAVAQHFGWIAGPPPLLAPGIQ*
Ga0066903_10866281613300005764Tropical Forest SoilTRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0068863_10048807413300005841Switchgrass RhizosphereSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0068860_10164783423300005843Switchgrass RhizosphereTERREAMSKRSKRVALVVVGVAMALLAVAQHFGWIAGPPPLLALGIQ*
Ga0066652_10079174813300006046SoilTERREAMSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0097621_10024133623300006237Miscanthus RhizosphereMSKKSKRIALILVGVAMTVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075431_10090372513300006847Populus RhizosphereMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0075433_1116677223300006852Populus RhizosphereMMSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075425_10103616513300006854Populus RhizosphereRREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075434_10043174213300006871Populus RhizosphereVSKREQKAGEAMSKKSKWIAMILIGVVLALMAVARHFGWIAGPAPLLAPGIR*
Ga0068865_10077671023300006881Miscanthus RhizosphereSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0105250_1038000423300009092Switchgrass RhizosphereETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0075418_1044375223300009100Populus RhizosphereMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPL
Ga0075418_1079221713300009100Populus RhizosphereERREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0075418_1145600713300009100Populus RhizosphereMSKKAKRMALIFVGVAMALLAVAQHFGWIAGPPPLLAP
Ga0105243_1181814113300009148Miscanthus RhizosphereAMSKKSTRIAMILVGVVMALVAVAQHFGWIAGPPPLLAPGIQ*
Ga0105243_1231664913300009148Miscanthus RhizosphereMMSKRSTRIAMILVVVVMAFLAVAQHFRWIAGPPPLLAPGIQ*
Ga0105243_1279629413300009148Miscanthus RhizosphereVAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPP
Ga0111538_1047993633300009156Populus RhizosphereMSKRSKRIAALILVGGAMALLAVAQHFGWIAGPPPLFAPGIQ*
Ga0075423_1035398313300009162Populus RhizosphereRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075423_1261865713300009162Populus RhizosphereEMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0105242_1212380123300009176Miscanthus RhizosphereMSRKSKRIAMILFGVVLALLAVAQHFGWIAGPPPVLAPGIR*
Ga0105248_1032893723300009177Switchgrass RhizosphereMSKKSKRIALILVGVGMAVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0105248_1169694513300009177Switchgrass RhizosphereMSKRSKRIAVFLVGLAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0126377_1000229953300010362Tropical Forest SoilMSKRSARIALILVGIVMALLAVVQHFGWIAGPPPLLAPGIQ*
Ga0134128_1044642423300010373Terrestrial SoilMSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIN*
Ga0134124_1156976533300010397Terrestrial SoilMSRKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIR
Ga0134121_1008390823300010401Terrestrial SoilMSKKSKRIAMIVLGVVMALLALAQHFGWIAGPPPVLAPGIH*
Ga0134123_1141208823300010403Terrestrial SoilMSNTSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0137393_1011608443300011271Vadose Zone SoilMSKRSKRIALILVGLAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0150985_11962908623300012212Avena Fatua RhizosphereMSKKSKQIVMALVLVMMALLAIAQHFGWIAAPPPLLAPGIQ*
Ga0137366_1001692543300012354Vadose Zone SoilMSKRSKRIALILVGIAMALLAVAQHFGWIAGPPPLLAPEIQ*
Ga0137375_1064899333300012360Vadose Zone SoilMSKKSKRIAVILVGVVMALLAVAQHFGWIAGVPPLLAPGLQ*
Ga0150984_10298842023300012469Avena Fatua RhizosphereARARGRCLRGNRRRAVRSDKSKRIAMIILVGMAFMAVAQHFGWIAGPPPLLAPGQ*
Ga0150984_12243447713300012469Avena Fatua RhizosphereDVMSKKSKQIVMALVQVMMALLAIAQHFGWIAAPPPLLAPGIQ*
Ga0157316_108236123300012510Arabidopsis RhizosphereRGDTRVMEAESREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH*
Ga0137397_1039572213300012685Vadose Zone SoilTERREAMSKRSKRIALILVGIAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0157288_1032242323300012901SoilMNKKSQRIALVALGVFIALAAAQHFGWIDGPPPLLAPGIH*
Ga0164299_1039335223300012958SoilLCLGISEGVDAETERRERMSKKSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0126369_1245174513300012971Tropical Forest SoilMSKRSTRIALILVGVAMALLAVAQHFGWIAGPPPLLA
Ga0163162_1237327513300013306Switchgrass RhizosphereMSKKSKRIAMIVVGVVMALLAVAQHFGWIAGPPPLLAPGIH*
Ga0157375_1087344823300013308Miscanthus RhizosphereAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0137409_1022192323300015245Vadose Zone SoilMSKESKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0132258_10031141143300015371Arabidopsis RhizosphereMSKNSKRIGMILFVLVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0132258_1012428623300015371Arabidopsis RhizosphereMSRPSRRVTLVVVGLLIALVAIARYLGWLADAPPLLAPGIR*
Ga0132258_1132849813300015371Arabidopsis RhizosphereRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0132256_10133414123300015372Arabidopsis RhizosphereMEAESREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0132257_100003631123300015373Arabidopsis RhizosphereIAMILIVVVMVFLALAQHFGWIAGPPPLLAPGVH*
Ga0132257_10159220923300015373Arabidopsis RhizosphereSKRIALIFVGVAMVVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0132257_10182250313300015373Arabidopsis RhizosphereREMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0132255_10048514353300015374Arabidopsis RhizosphereMSKNSKRIGMILFVLVMAFLAAAQHFGWIAGPPPLLAPGVQ*
Ga0132255_10069231913300015374Arabidopsis RhizosphereRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0190274_1201573313300018476SoilMSKKSKQIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVE
Ga0190274_1271164723300018476SoilMNKQSRRIALVALGLFVAFMAVAQHFGWIAGPPPLLAPGIH
Ga0066669_1216024223300018482Grasslands SoilVNKTQRVVLILVGIAMVLLAVAQYFGWIAGPPPLLAPGVQ
Ga0222622_1000402083300022756Groundwater SedimentMMSNKSKRIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207697_1007152123300025315Corn, Switchgrass And Miscanthus RhizosphereMSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGMQ
Ga0207656_1067082813300025321Corn RhizosphereMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207682_1005418333300025893Miscanthus RhizosphereMSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207688_1043627123300025901Corn, Switchgrass And Miscanthus RhizosphereVAEGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207643_1075039323300025908Miscanthus RhizosphereREVMSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207681_1031496323300025923Switchgrass RhizosphereMSTKSKRIAMILVGVVMALLAVARHFGWIAGPPPLLAPGIQ
Ga0207650_1005260643300025925Switchgrass RhizosphereMSKKSRRIAMILVGIVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207659_1047304723300025926Miscanthus RhizosphereVAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207659_1164622313300025926Miscanthus RhizosphereMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLL
Ga0207686_1121977923300025934Miscanthus RhizosphereAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207670_1023512333300025936Switchgrass RhizosphereKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGTQ
Ga0207712_1075024023300025961Switchgrass RhizosphereKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207712_1214611523300025961Switchgrass RhizosphereKRSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ
Ga0207708_1093578813300026075Corn, Switchgrass And Miscanthus RhizosphereEGLDVMSKKSKRIAMILVGVAMALLAIAQHFGWIAGPPPLLAPGIQ
Ga0209488_1102932913300027903Vadose Zone SoilMSKRSKRIALILVGVAIALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207428_1041403123300027907Populus RhizosphereMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0268266_1135025313300028379Switchgrass RhizosphereGFRPETERWEVMSKKSKRIALILVGVAIALLAIGQRFGWIAGPPPLLAPGIQ
Ga0268265_1179578713300028380Switchgrass RhizosphereMSKKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0310888_1000390713300031538SoilMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGV
Ga0307468_10042157133300031740Hardwood Forest SoilMSKRSKRIALILVGIAMALLAVAQLVGWIAGPPPLLAPGIQ
Ga0307468_10110941723300031740Hardwood Forest SoilMSKKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0306925_1177949523300031890SoilMSKRSKRIALILVGVVMALLAVAHHFGWIAGPPPLLAP
Ga0310884_1004246313300031944SoilMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH
Ga0307409_10192475313300031995RhizosphereSGNRRREMMSKNSKRIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0310906_1058970613300032013SoilMGKKSTRIAMILILVVMALLAVAQHFGWIAGPPPLLAP
Ga0310889_1033163313300032179SoilGVQVGNRQGRKVMSKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGTQ
Ga0306920_10041899713300032261SoilMSKRSKRIALILVGVVMALLAVAHHFGWIAGPPPLLAPGIR
Ga0315287_10012802123300032397SedimentMSRPSWRVALVVVGVMMALVAIAQHLGWLAGPPPLLAPGIR
Ga0310810_1149322523300033412SoilKAREMSKKSKRIAMILVVVVMAVLAVAQHFGWIAGPPPLLAPGVQ
Ga0310811_1012574373300033475SoilMSKKSKRIAMILVVVVMAVLAVAQHFGWIAGPPPLLAPGVQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.