Metagenome / Metatranscriptome Family F060998

Basic Information
Family ID	F060998
Family Type	Metagenome / Metatranscriptome
Number of Sequences	132
Average Sequence Length	41 residues
Representative Sequence	RGYEADDKCAWSPTPFIGTGGFGYQYEWSNANSGCVKTR
Number of Associated Samples	115
Number of Associated Scaffolds	132

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	89.39 %
Associated GOLD sequencing projects	108
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Bacteria (90.909 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.909 % of family members)
Environment Ontology (ENVO)	Unclassified (33.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (46.212 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 7.46% β-sheet: 11.94% Coil/Unstructured: 80.60%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 132 Family Scaffolds
PF04952	AstE_AspA	4.55
PF01588	tRNA_bind	4.55
PF14235	DUF4337	3.79
PF03193	RsgA_GTPase	3.79
PF00206	Lyase_1	2.27
PF13354	Beta-lactamase2	2.27
PF07690	MFS_1	1.52
PF00557	Peptidase_M24	1.52
PF00496	SBP_bac_5	1.52
PF00106	adh_short	1.52
PF13650	Asp_protease_2	0.76
PF00278	Orn_DAP_Arg_deC	0.76
PF02675	AdoMet_dc	0.76
PF09365	DUF2461	0.76
PF08402	TOBE_2	0.76
PF07676	PD40	0.76
PF14534	DUF4440	0.76
PF12840	HTH_20	0.76
PF00069	Pkinase	0.76
PF02687	FtsX	0.76
PF04321	RmlD_sub_bind	0.76
PF02416	TatA_B_E	0.76
PF05960	DUF885	0.76
PF05691	Raffinose_syn	0.76
PF00370	FGGY_N	0.76
PF06262	Zincin_1	0.76
PF12833	HTH_18	0.76
PF08334	T2SSG	0.76
PF06267	DUF1028	0.76
PF00072	Response_reg	0.76
PF14332	DUF4388	0.76
PF00773	RNB	0.76
PF06314	ADC	0.76
PF04120	Iron_permease	0.76
PF13485	Peptidase_MA_2	0.76
PF00155	Aminotran_1_2	0.76
PF00696	AA_kinase	0.76
PF02782	FGGY_C	0.76
PF12327	FtsZ_C	0.76
PF13536	EmrE	0.76
PF08668	HDOD	0.76
PF02727	Cu_amine_oxidN2	0.76
PF00211	Guanylate_cyc	0.76
PF16927	HisKA_7TM	0.76
PF05940	NnrS	0.76
PF00144	Beta-lactamase	0.76

COG ID	Name	Functional Category	% Frequency in 132 Family Scaffolds
COG0073	tRNA-binding EMAP/Myf domain	Translation, ribosomal structure and biogenesis [J]	4.55
COG2517	Predicted RNA-binding protein, contains C-terminal EMAP domain	General function prediction only [R]	4.55
COG1162	Ribosome biogenesis GTPase RsgA	Translation, ribosomal structure and biogenesis [J]	3.79
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.03
COG0451	Nucleoside-diphosphate-sugar epimerase	Cell wall/membrane/envelope biogenesis [M]	1.52
COG0702	Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains	General function prediction only [R]	1.52
COG1086	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC	Cell wall/membrane/envelope biogenesis [M]	1.52
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.76
COG4805	Uncharacterized conserved protein, DUF885 family	Function unknown [S]	0.76
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.76
COG3213	Nitric oxide response protein NnrS	Signal transduction mechanisms [T]	0.76
COG3342	Uncharacterized conserved protein, Ntn-hydrolase superfamily	General function prediction only [R]	0.76
COG3733	Cu2+-containing amine oxidase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.76
COG3824	Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain	Posttranslational modification, protein turnover, chaperones [O]	0.76
COG4689	Acetoacetate decarboxylase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.76
COG4776	Exoribonuclease II	Transcription [K]	0.76
COG0019	Diaminopimelate decarboxylase	Amino acid transport and metabolism [E]	0.76
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.76
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.76
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.76
COG1586	S-adenosylmethionine decarboxylase	Amino acid transport and metabolism [E]	0.76
COG1166	Arginine decarboxylase (spermidine biosynthesis)	Amino acid transport and metabolism [E]	0.76
COG1091	dTDP-4-dehydrorhamnose reductase	Cell wall/membrane/envelope biogenesis [M]	0.76
COG1090	NAD dependent epimerase/dehydratase family enzyme	General function prediction only [R]	0.76
COG1089	GDP-D-mannose dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.76
COG1088	dTDP-D-glucose 4,6-dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.76
COG1087	UDP-glucose 4-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.76
COG0557	Exoribonuclease R	Transcription [K]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.91 %
Unclassified	root	N/A	9.09 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.91 %
Unclassified	root	N/A	9.09 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.91 %
Unclassified	root	N/A	9.09 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	34.09 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	18.18 %
Unclassified	root	N/A	9.09 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.27 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	25.00 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	17.42 %
Unclassified	root	N/A	9.09 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.52 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.52 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.52 %
Armatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes	0.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	25.00 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	17.42 %
Unclassified	root	N/A	9.09 %
Armatimonadia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia	0.76 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.76 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	0.76 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	21.97 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	17.42 %
Unclassified	root	N/A	9.09 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.52 %
Capsulimonadales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Betaproteobacteria bacterium ADurb.Bin341	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341	0.76 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.76 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	21.97 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	17.42 %
Unclassified	root	N/A	9.09 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.52 %
Capsulimonadaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae	0.76 %
Oleomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Betaproteobacteria bacterium ADurb.Bin341	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341	0.76 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	21.97 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	17.42 %
Unclassified	root	N/A	9.09 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.52 %
Oleomonas cavernae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae	0.76 %
Capsulimonas	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Betaproteobacteria bacterium ADurb.Bin341	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341	0.76 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	21.97 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	17.42 %
Unclassified	root	N/A	9.09 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1.52 %
Capsulimonas corticalis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis	0.76 %
Oleomonas cavernae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae	0.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.76 %
Betaproteobacteria bacterium ADurb.Bin341	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341	0.76 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001145\|JGI12682J13319_1006691	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300002568\|C688J35102_119695109	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	751	Open in IMG/M
3300003693\|Ga0032354_1037605	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1176	Open in IMG/M
3300003998\|Ga0055472_10037987	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300004000\|Ga0055458_10297214	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	509	Open in IMG/M
3300004643\|Ga0062591_102206956	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	573	Open in IMG/M
3300005288\|Ga0065714_10060358	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300005331\|Ga0070670_100507864	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1072	Open in IMG/M
3300005334\|Ga0068869_101290348	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	644	Open in IMG/M
3300005337\|Ga0070682_101586812	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300005339\|Ga0070660_101134559	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	662	Open in IMG/M
3300005364\|Ga0070673_102073022	All Organisms → cellular organisms → Bacteria	540	Open in IMG/M
3300005366\|Ga0070659_100478592	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Armatimonadia → Capsulimonadales → Capsulimonadaceae → Capsulimonas → Capsulimonas corticalis	1059	Open in IMG/M
3300005468\|Ga0070707_102089096	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300005468\|Ga0070707_102331668	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	502	Open in IMG/M
3300005518\|Ga0070699_100722009	All Organisms → cellular organisms → Bacteria	911	Open in IMG/M
3300005529\|Ga0070741_11010635	All Organisms → cellular organisms → Bacteria	712	Open in IMG/M
3300005534\|Ga0070735_10651588	All Organisms → cellular organisms → Bacteria	623	Open in IMG/M
3300005546\|Ga0070696_101785873	All Organisms → cellular organisms → Bacteria → Proteobacteria	531	Open in IMG/M
3300005561\|Ga0066699_10599749	All Organisms → cellular organisms → Bacteria	791	Open in IMG/M
3300005561\|Ga0066699_10774186	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	678	Open in IMG/M
3300005561\|Ga0066699_10951556	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	597	Open in IMG/M
3300005564\|Ga0070664_101022534	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	777	Open in IMG/M
3300005575\|Ga0066702_10097792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1671	Open in IMG/M
3300005576\|Ga0066708_10056369	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2215	Open in IMG/M
3300005577\|Ga0068857_102272776	Not Available	532	Open in IMG/M
3300005578\|Ga0068854_100088073	All Organisms → cellular organisms → Bacteria	2304	Open in IMG/M
3300005586\|Ga0066691_10114716	All Organisms → cellular organisms → Bacteria	1524	Open in IMG/M
3300005587\|Ga0066654_10072640	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1589	Open in IMG/M
3300005598\|Ga0066706_10466100	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1006	Open in IMG/M
3300005616\|Ga0068852_101996520	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	602	Open in IMG/M
3300005618\|Ga0068864_100730508	All Organisms → cellular organisms → Bacteria → Proteobacteria	969	Open in IMG/M
3300005764\|Ga0066903_102134303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1079	Open in IMG/M
3300005829\|Ga0074479_10566875	All Organisms → cellular organisms → Bacteria	534	Open in IMG/M
3300005891\|Ga0075283_1009230	Not Available	1454	Open in IMG/M
3300006028\|Ga0070717_10339492	All Organisms → cellular organisms → Bacteria	1341	Open in IMG/M
3300006028\|Ga0070717_11870810	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	542	Open in IMG/M
3300006031\|Ga0066651_10787390	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300006032\|Ga0066696_11087330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	508	Open in IMG/M
3300006034\|Ga0066656_10565236	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	738	Open in IMG/M
3300006046\|Ga0066652_100022895	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4333	Open in IMG/M
3300006237\|Ga0097621_100430822	All Organisms → cellular organisms → Bacteria	1185	Open in IMG/M
3300006237\|Ga0097621_100590768	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1014	Open in IMG/M
3300006237\|Ga0097621_101738808	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	594	Open in IMG/M
3300006358\|Ga0068871_100196052	All Organisms → cellular organisms → Bacteria → Proteobacteria	1742	Open in IMG/M
3300006358\|Ga0068871_102058561	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	543	Open in IMG/M
3300006797\|Ga0066659_10052688	All Organisms → cellular organisms → Bacteria	2576	Open in IMG/M
3300006797\|Ga0066659_11427141	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300006806\|Ga0079220_10919406	All Organisms → cellular organisms → Bacteria	682	Open in IMG/M
3300006854\|Ga0075425_100112487	All Organisms → cellular organisms → Bacteria	3104	Open in IMG/M
3300006871\|Ga0075434_100039639	All Organisms → cellular organisms → Bacteria	4667	Open in IMG/M
3300006871\|Ga0075434_101469639	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	691	Open in IMG/M
3300006871\|Ga0075434_102342442	Not Available	536	Open in IMG/M
3300006954\|Ga0079219_11643953	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300009089\|Ga0099828_10453271	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1157	Open in IMG/M
3300009137\|Ga0066709_100082836	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3838	Open in IMG/M
3300009143\|Ga0099792_10422605	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	820	Open in IMG/M
3300009143\|Ga0099792_11124150	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	530	Open in IMG/M
3300009148\|Ga0105243_12359038	Not Available	570	Open in IMG/M
3300009162\|Ga0075423_12614519	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	552	Open in IMG/M
3300009553\|Ga0105249_11780416	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	688	Open in IMG/M
3300009662\|Ga0105856_1303139	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	535	Open in IMG/M
3300010047\|Ga0126382_11372205	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	643	Open in IMG/M
3300010325\|Ga0134064_10499271	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300010360\|Ga0126372_10674392	Not Available	1005	Open in IMG/M
3300010366\|Ga0126379_12136170	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	661	Open in IMG/M
3300010397\|Ga0134124_10304279	All Organisms → cellular organisms → Bacteria	1487	Open in IMG/M
3300010397\|Ga0134124_12170057	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300010400\|Ga0134122_10494077	Not Available	1106	Open in IMG/M
3300010400\|Ga0134122_13229164	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300010401\|Ga0134121_10272873	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1487	Open in IMG/M
3300010880\|Ga0126350_11103376	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	703	Open in IMG/M
3300011120\|Ga0150983_15661704	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	533	Open in IMG/M
3300012004\|Ga0120134_1002869	All Organisms → cellular organisms → Bacteria	2296	Open in IMG/M
3300012019\|Ga0120139_1157602	Not Available	593	Open in IMG/M
3300012204\|Ga0137374_10338123	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1219	Open in IMG/M
3300012208\|Ga0137376_11521816	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	560	Open in IMG/M
3300012209\|Ga0137379_11664390	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	535	Open in IMG/M
3300012211\|Ga0137377_11196490	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	690	Open in IMG/M
3300012354\|Ga0137366_10805411	All Organisms → cellular organisms → Bacteria	667	Open in IMG/M
3300012362\|Ga0137361_10913426	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	796	Open in IMG/M
3300012363\|Ga0137390_10914998	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	831	Open in IMG/M
3300012469\|Ga0150984_109380521	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300012582\|Ga0137358_10200695	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1361	Open in IMG/M
3300012922\|Ga0137394_10286099	All Organisms → cellular organisms → Bacteria → Proteobacteria	1409	Open in IMG/M
3300012931\|Ga0153915_11885822	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300012957\|Ga0164303_10271117	Not Available	984	Open in IMG/M
3300012957\|Ga0164303_10456159	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300012961\|Ga0164302_11854540	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300012971\|Ga0126369_10935285	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	953	Open in IMG/M
3300013100\|Ga0157373_11079035	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	602	Open in IMG/M
3300013297\|Ga0157378_10189967	All Organisms → cellular organisms → Bacteria	1937	Open in IMG/M
3300014325\|Ga0163163_11105687	All Organisms → cellular organisms → Bacteria	855	Open in IMG/M
3300014968\|Ga0157379_12209159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Oleomonas → Oleomonas cavernae	547	Open in IMG/M
3300015358\|Ga0134089_10318121	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300016357\|Ga0182032_11274549	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	634	Open in IMG/M
3300017959\|Ga0187779_11286878	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300021171\|Ga0210405_11432913	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300021377\|Ga0213874_10421805	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	522	Open in IMG/M
3300021953\|Ga0213880_10014131	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1685	Open in IMG/M
3300024179\|Ga0247695_1041968	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	660	Open in IMG/M
3300024219\|Ga0247665_1059530	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300024279\|Ga0247692_1068547	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	555	Open in IMG/M
3300025792\|Ga0210143_1096603	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	543	Open in IMG/M
3300025885\|Ga0207653_10434868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	515	Open in IMG/M
3300025910\|Ga0207684_10580710	All Organisms → cellular organisms → Bacteria	958	Open in IMG/M
3300025910\|Ga0207684_10649077	All Organisms → cellular organisms → Bacteria	899	Open in IMG/M
3300025910\|Ga0207684_10995349	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	702	Open in IMG/M
3300025912\|Ga0207707_11108175	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300025916\|Ga0207663_11248304	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300025931\|Ga0207644_10488197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341	1015	Open in IMG/M
3300025940\|Ga0207691_10865020	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300025960\|Ga0207651_10080716	All Organisms → cellular organisms → Bacteria → Proteobacteria	2342	Open in IMG/M
3300025986\|Ga0207658_10382332	All Organisms → cellular organisms → Bacteria	1233	Open in IMG/M
3300026088\|Ga0207641_10089849	All Organisms → cellular organisms → Bacteria → Acidobacteria	2685	Open in IMG/M
3300026142\|Ga0207698_10189306	All Organisms → cellular organisms → Bacteria → Proteobacteria	1831	Open in IMG/M
3300026298\|Ga0209236_1314667	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	506	Open in IMG/M
3300026307\|Ga0209469_1013525	All Organisms → cellular organisms → Bacteria → Proteobacteria	2995	Open in IMG/M
3300026308\|Ga0209265_1065510	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1086	Open in IMG/M
3300026313\|Ga0209761_1088803	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	1577	Open in IMG/M
3300026329\|Ga0209375_1035307	All Organisms → cellular organisms → Bacteria	2650	Open in IMG/M
3300026332\|Ga0209803_1270203	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	583	Open in IMG/M
3300026527\|Ga0209059_1182150	Not Available	726	Open in IMG/M
3300026528\|Ga0209378_1041323	All Organisms → cellular organisms → Bacteria	2323	Open in IMG/M
3300026528\|Ga0209378_1226062	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	598	Open in IMG/M
3300027875\|Ga0209283_10797016	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	581	Open in IMG/M
3300028138\|Ga0247684_1037297	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	778	Open in IMG/M
3300028146\|Ga0247682_1000286	All Organisms → cellular organisms → Bacteria	15911	Open in IMG/M
3300031170\|Ga0307498_10304330	Not Available	597	Open in IMG/M
3300031946\|Ga0310910_10874287	Not Available	706	Open in IMG/M
3300033475\|Ga0310811_11343631	Not Available	561	Open in IMG/M
3300033480\|Ga0316620_10292144	All Organisms → cellular organisms → Bacteria	1421	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.73%
Host-Associated	Host-Associated	27.27%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	68.94%
Plants	Host-Associated → Plants	27.27%
Aquatic	Environmental → Aquatic	3.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	68.18%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.91%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.06%
Roots	Host-Associated → Plants → Roots	5.30%
Marine	Environmental → Aquatic → Marine	2.27%
Freshwater	Environmental → Aquatic → Freshwater	0.76%
Sediment	Environmental → Aquatic → Sediment	0.76%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	52.27%
Loam	Environmental → Terrestrial → Soil → Loam	12.88%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.30%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	4.55%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.03%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.27%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.76%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.24%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	18.18%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.58%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.30%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	4.55%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.27%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.27%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.27%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.27%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.52%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.76%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.76%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.76%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	15.91%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	3.79%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.79%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.03%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.03%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.27%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.27%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.27%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.52%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.52%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.52%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.52%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.52%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.52%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.76%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.76%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.76%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.76%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.76%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.76%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.76%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.76%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001145	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental	Open in IMG/M
3300004000	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1	Host-Associated	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005891	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009662	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012004	Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M	Environmental	Open in IMG/M
3300012019	Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated	Open in IMG/M
3300021953	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07	Environmental	Open in IMG/M
3300024179	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36	Environmental	Open in IMG/M
3300024219	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06	Environmental	Open in IMG/M
3300024279	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33	Environmental	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026307	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)	Environmental	Open in IMG/M
3300026308	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028138	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25	Environmental	Open in IMG/M
3300028146	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F060998

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12682J13319_10066911	3300001145	Forest Soil	EADDKCAWSPAPFIGTGGYGYQYEWSNAVSGCVKTR*
C688J35102_1196951091	3300002568	Soil	DALGNAWFDAAGNEADDKCAWSPAPFIGTNGYGYQYEWSNLNGGCIRTR*
Ga0032354_10376051	3300003693	Avena Fatua Rhizosphere	NAWYDFTGNEADDKCAWSPTPFIGTGGYSYQYEWSNATRSCVKTR*
Ga0055472_100379871	3300003998	Natural And Restored Wetlands	DLNAWYDRRGYEADDKCAWSPSPFIDQSTGFAYQYEWSNSAGGCVKQ*
Ga0055458_102972141	3300004000	Natural And Restored Wetlands	GNAWFDSNGYEADDKCAWSPSPFIGTGGYGYQYEWSNADKGCVQTK*
Ga0062591_1022069561	3300004643	Soil	EADDKCAWSPSPFLVNGYGYQYEWSNLTGGCVRTLTFAH*
Ga0065714_100603581	3300005288	Miscanthus Rhizosphere	GTGWWDSSGQEADDKCAWSPAPFIGTGGYAYQYEWSNTFNACRKTLP*
Ga0070670_1005078644	3300005331	Switchgrass Rhizosphere	DRRGYEADDKCAWSPAPFIGTGGFGYQYEWSNADSGCVKTK*
Ga0068869_1012903482	3300005334	Miscanthus Rhizosphere	GNEADDKCAWSPAPFLGTGGFGYQWEWSNAVSGCVKTGQ*
Ga0070682_1015868121	3300005337	Corn Rhizosphere	GVTGEEVADKCAWSPAPFIGTNGYAYQYIWSNADNACIK*
Ga0070660_1011345591	3300005339	Corn Rhizosphere	SGNEADDKCAWSPTPFIGTGGYGYQYEWSNANNACIRTR*
Ga0070673_1020730222	3300005364	Switchgrass Rhizosphere	RRGYEADDKCAWTPTPFIGTGGFGYQYEWSNADAGCVKTK*
Ga0070659_1004785922	3300005366	Corn Rhizosphere	YDSSGSEVATKCAWSPTPFIGTDGYAHQNVWSNLNNGCIKTR*
Ga0070707_1020890962	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	RRGNEADDKCAWSPAPFIGTGGFGYQYQWSNEVSGCVRTR*
Ga0070707_1023316682	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	AWFDRRGNEADDKCAWSPAPFFGTGGYGYQWEWSNAVSGCVKTAP*
Ga0070699_1007220093	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	TDPDGNAWFDRQGNEADDKCAWSPSPFLANGYGYQYEWSNLVQGCVQSR*
Ga0070741_110106351	3300005529	Surface Soil	GNEADDKCAWSPAPFVDGGYGYQYEWSNANGGCVKTR*
Ga0070735_106515882	3300005534	Surface Soil	ADDKCAWSPTPFIGTGGYSYQYEWSNASRACVKTR*
Ga0070696_1017858731	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	DLNAWYDRRGNEADDKCAWSPAPFIDGGFGYQYEWSNAAGACVK*
Ga0066699_105997493	3300005561	Soil	ADDKCAWSPSPFLANGYGYQYEWSNLVQGCVQSR*
Ga0066699_107741861	3300005561	Soil	EADDKCAWSPAPFIDGATGFAYQYEWSNTVSGCVKSQ*
Ga0066699_109515562	3300005561	Soil	EADDKCAWSPSPFLVNGYGYQYEWSNLDGGCVQGR*
Ga0070664_1010225341	3300005564	Corn Rhizosphere	ADDKCAWSPTPFIGTGGYAYQYEWSNANNACIKTR*
Ga0066702_100977923	3300005575	Soil	RQGNEADDKCAWSPTPFIDQATGFAYQYEWSNSAGGCVKQ*
Ga0066708_100563691	3300005576	Soil	AWYDRQGLEADDKCAWSPSPFLVNGYGYQYEWSNLDGGCVQGR*
Ga0068857_1022727761	3300005577	Corn Rhizosphere	ADDKCAWSPSPFIGTGGYGYQYEWSNQDRGCVKTK*
Ga0068854_1000880731	3300005578	Corn Rhizosphere	GYEADDKCAWSPAPFIGTGGFGYQYEWSNEVSGCVKTR*
Ga0066691_101147163	3300005586	Soil	ATDPDGNAWFDRQGNEADDKCAWSPSPFLVNGYGYQYEWSNLLQGCVQSR*
Ga0066654_100726401	3300005587	Soil	GAEADDKCAWSPAPFFGTGGYGYQWEWSNADGACVKTK*
Ga0066706_104661001	3300005598	Soil	EADDKCAWSPAPFLGTGGYGYQWEWSNAVSSCVKTAP*
Ga0068852_1019965202	3300005616	Corn Rhizosphere	GYEADDKCAWSPAPFLGTNGYGYQYEWSNANRGCVKTR*
Ga0068864_1007305081	3300005618	Switchgrass Rhizosphere	QGNEADDKCAWSPAPFIGTGGFGYQLEWSNADHGCVKTK*
Ga0066903_1021343031	3300005764	Tropical Forest Soil	EADDKCAWSPTPFIGAGGFGYQYEWSNANGKCVQTR*
Ga0074479_105668751	3300005829	Sediment (Intertidal)	GYEADDKCAWSPAPFLGTGGYGYQYEWSNLNNACVKTR*
Ga0075283_10092301	3300005891	Rice Paddy Soil	GYEADDKCAWSPAPFVDGGYGYQYEWSNANKGCVK*
Ga0070717_103394922	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	YNAQGLDGDSICLWSPPPFLDNGGAYPYEWSNLASGCVKWR*
Ga0070717_118708101	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	RRGNEADDKCAWSPTPFIDQTTGFAYQYEWSNQAGGCVKQ*
Ga0066651_107873902	3300006031	Soil	NAWYDRRGYEADDKCAWSPAPFIDPCTGYAYQYEWSNANSGCVKTR*
Ga0066696_110873302	3300006032	Soil	AWYDRQGNEADDKCAWSPSPFLVNGYAYQYEWSNLLQGCVQSR*
Ga0066656_105652362	3300006034	Soil	TGEEADDKCAWSPTPFIGTNGYAYQYEWSNANGGCIRTR*
Ga0066652_1000228955	3300006046	Soil	DLNAWYDRRGAEADDKCAWSPAPFIDSGFGYQYEWSNAAGGCVR*
Ga0097621_1004308222	3300006237	Miscanthus Rhizosphere	AVTDPVNAWWANSGAEADDKCAWSPAPFIDGGFGYQYEWSNAARGCVK*
Ga0097621_1005907682	3300006237	Miscanthus Rhizosphere	SGAEADDKCAWTPSPFIGTGGYGYQYEWSNLTGGCVKTR*
Ga0097621_1017388081	3300006237	Miscanthus Rhizosphere	DRRGYEADDKCAWSPAPFIDQSTGFGYQLEWSNSAGGCVKQ*
Ga0068871_1001960523	3300006358	Miscanthus Rhizosphere	DRQGNEADDKCAWSPAPFIGTGGFGYQLEWSNADHGCVKTK*
Ga0068871_1020585611	3300006358	Miscanthus Rhizosphere	DRRGYEADDKCAWSPAPFIGTGGFGYQYEWSNANSGCIKTR*
Ga0066659_100526881	3300006797	Soil	EADDKCAWSPAPFIDSNGYGYQYEWSNAVSGCVQTR*
Ga0066659_114271412	3300006797	Soil	AWFDRQGFEADDKCAWSPAPFLVNGYGYQYEWSNLDGGCVQGR*
Ga0079220_109194061	3300006806	Agricultural Soil	DPDGTAWFDRQGNEADDKCAWSPSPFLANGYGYQYEWSNVAGGCVQSR*
Ga0075425_1001124873	3300006854	Populus Rhizosphere	GTAWFDRRGNEADDKCAWSPAPFLGTGGYGYQWEWSNAVSGCIQTAP*
Ga0075434_1000396391	3300006871	Populus Rhizosphere	DNSGAEADDKCAWSPTPFIGTGGFSYQYEWSNAVRGCVKTL*
Ga0075434_1014696391	3300006871	Populus Rhizosphere	GNEADDKCAWSPAPFIGTGGYGYQWEWSNAVSGCIQTAP*
Ga0075434_1023424421	3300006871	Populus Rhizosphere	DNSGAEADDKCAWSPTPFIGTGGFSYQYEWSNAVRGCVKTM*
Ga0079219_116439531	3300006954	Agricultural Soil	DDKCAWSPAPFIDGSTGYAYQYEWSNASSTCVKTR*
Ga0099828_104532711	3300009089	Vadose Zone Soil	EADDKCAWSPSPFLANGYGYQYEWSNLVQGCVQSR*
Ga0066709_1000828361	3300009137	Grasslands Soil	EADDKCAWSPSPFVVSGYGYQDEWSNLNGGCVPTR*
Ga0099792_104226052	3300009143	Vadose Zone Soil	YDRRGNEADDKCAWTGLFIDAGFGYQPEWSNAVSGCVATTP*
Ga0099792_111241502	3300009143	Vadose Zone Soil	WWDRQGYEADDKCAWSPSPFVAGGYGYQYEWSNLNVGCVQTR*
Ga0105243_123590382	3300009148	Miscanthus Rhizosphere	WWDRRGAEADDKCAWSPSPFLGTGGFGYQYEWSNAAHGCIKTR*
Ga0075423_126145192	3300009162	Populus Rhizosphere	GNEADDKCAWSPAPFLVNGYGYQYEWSNLAQGCVQSR*
Ga0105249_117804162	3300009553	Switchgrass Rhizosphere	TDADLNAWYDRRGYEADDKCAWSPSPFIDNGYGYQYEWSNAAGGCVR*
Ga0105856_13031392	3300009662	Permafrost Soil	AWFDRRGAEADDKCAWTPSPFIGTGGFGYQYEWSNANSGCVKIR*
Ga0126382_113722052	3300010047	Tropical Forest Soil	AWFDRQGNEADDKCAWSPSPFLANGYGYQYEWSNVAGGCVQSR*
Ga0134064_104992711	3300010325	Grasslands Soil	ADDKCAWSPSPFLVNGYGYQYEWSNLVQGCVQSR*
Ga0126372_106743922	3300010360	Tropical Forest Soil	FDRRGNEADDKCAWSPAPFIGTGGYGYQWEWSNEKRGCVQTRP*
Ga0126379_121361701	3300010366	Tropical Forest Soil	GNAWFDRRGNEADDKCAWSPAPFIGTGGFGYQWEWSNANSGCVKTR*
Ga0134124_103042791	3300010397	Terrestrial Soil	ADDKCAWSPAPFIGTGGYGYQWEWSNAVSGCVKTK*
Ga0134124_121700572	3300010397	Terrestrial Soil	NAWWNGNTGAEADDQCAWSPAPFTDGGYGYQYEWSNAAKTCVQ*
Ga0134122_104940771	3300010400	Terrestrial Soil	TGTEADDKCAWSPSPFIGTGGFGYQYEWSNANGGCVRTR*
Ga0134122_132291642	3300010400	Terrestrial Soil	WYDRRGNEADDKCAWSPAPFIGTGGFGYQWEWSNAVSGCVKTR*
Ga0134121_102728732	3300010401	Terrestrial Soil	WFDSSGAEADDKCAWSPTPFLVSGSGYQYEWSNAAGGCVKTR*
Ga0126350_111033762	3300010880	Boreal Forest Soil	AWYDRRGNEADDKCAWSPAPFLDSGFGYQYEWSNSAGGCVK*
Ga0150983_156617042	3300011120	Forest Soil	GMDGDSICLWSPPPFLDNGGAYPYEWSNLASGCVKWR*
Ga0120134_10028691	3300012004	Permafrost	DRRGNEADDKCAWSPAPFIGTGGYGYQYEWSNANSGCVKIR*
Ga0120139_11576022	3300012019	Permafrost	AEADDKCAWSPAPFIDGGFGYQWEWSNSDHSCVKTK*
Ga0137374_103381231	3300012204	Vadose Zone Soil	DRRGYEADDKCAWSPAPFIGTGGYGYQWEWSNAVSGCVKTAP*
Ga0137376_115218162	3300012208	Vadose Zone Soil	RGYEADDKCAWSPTPFIGTNGYSYQYEWSNANSGCVKTR*
Ga0137379_116643901	3300012209	Vadose Zone Soil	NAWYDRQGNEADDKCAWSPSPFVVSGYGYQDEWSNLNGGCVPSR*
Ga0137377_111964901	3300012211	Vadose Zone Soil	NEADDKCAWSPSPFLVNGYGYQYEWSNVVQACVQSR*
Ga0137366_108054111	3300012354	Vadose Zone Soil	RGYEADYKCAWSPAPFIGTGGFGYQYEWSNEVGGCVKTR*
Ga0137361_109134261	3300012362	Vadose Zone Soil	GYEADDKCAWSPSPFVAGGYGYQYEWSNLNVGCVQTR*
Ga0137390_109149981	3300012363	Vadose Zone Soil	QGLDGDSICLWSPPPFLDNGGAYPYEWSNLASGCVKWR*
Ga0150984_1093805212	3300012469	Avena Fatua Rhizosphere	LNAWFDSSGAEADDKCAWSPTPFIGTGGFAYQYEWSNALRACVKTK*
Ga0137358_102006951	3300012582	Vadose Zone Soil	GNEADDKCAWTGLFIDAGFGYQPEWSNAVSGCVATTP*
Ga0137394_102860991	3300012922	Vadose Zone Soil	RGAEADDKCAWSPAPFIGTGGFGYQYEWSNADSGCVRTK*
Ga0153915_118858222	3300012931	Freshwater Wetlands	RRGYEADDKCAWSPAPFIGTGGFGYQWEWSNAVSGCVKTLP*
Ga0164303_102711171	3300012957	Soil	AVTDPTGSTWWDNTGAELDDKCAWSPAPFIGTGGFAYQWEWSNLAGACVKTR*
Ga0164303_104561591	3300012957	Soil	GNEADDKCAWSPAPFIGTGGFGYQYEWSNAVSGCVRTK*
Ga0164302_118545401	3300012961	Soil	ADDKCAWNPAPFIDQTTGFAYQYEWSNAASGCVQQ*
Ga0126369_109352851	3300012971	Tropical Forest Soil	RRGNEADDKCAWSPTPFIGTGGYGYQWEWSNAVSACVQTK*
Ga0157373_110790351	3300013100	Corn Rhizosphere	DDKCAWSPTPFIDNTTGFAYQYEWSNSASGCVKQ*
Ga0157378_101899676	3300013297	Miscanthus Rhizosphere	DAGGNAWYARRGYEADDKCAWTPTPFTDANGFAYQYEWSNAAGGCVQ*
Ga0163163_111056871	3300014325	Switchgrass Rhizosphere	RSGSEADDKCAWSPTPFLGTGGFGYQYEWSNAARGCVKTK*
Ga0157379_122091591	3300014968	Switchgrass Rhizosphere	DRQGNEADDKCAWSPSPFLVNGFGYQYEWSNLNSGCVKSR*
Ga0134089_103181211	3300015358	Grasslands Soil	NAWFDRQGNEADDKCAWSPSPFLVNGYAYQYEWSNLLQGCVQSR*
Ga0182032_112745491	3300016357	Soil	DPDGNAWFDSHLNEADDKCAWSPAPFLVNGFGYQYEWSNLVQGCVQTR
Ga0187779_112868782	3300017959	Tropical Peatland	WYDRSGNEADDKCAWSPAPFIDSGFGYQYEWSNAAGGCVK
Ga0210405_114329131	3300021171	Soil	NEADDKCAWSPTPFVGSGGFSYQYEWSNASRGCVKTR
Ga0213874_104218052	3300021377	Plant Roots	ADDKCAWTPAPFIGTGGFGYQYEWSNANGGCIKTR
Ga0213880_100141313	3300021953	Exposed Rock	RGNEADDKCAWTPAPFIGTGGFGYQYEWSNANGGCIKTR
Ga0247695_10419681	3300024179	Soil	QGNTGDDKCAWSPPPFIGTGGFGYQYEWSNLASGCVKTR
Ga0247665_10595301	3300024219	Soil	FDRRGNEADDKCAWTPAPFIGTGGFGYQYEWSNAASGCVATTP
Ga0247692_10685471	3300024279	Soil	LGNAWFDNSGNEADDKCAWSPTPFIGTNGYGYQYEWSNANGGCIRTR
Ga0210143_10966031	3300025792	Natural And Restored Wetlands	ADLNAWYDRRGYEADDKCAWSPSPFIDQSTGFAYQYEWSNSAGGCVKQ
Ga0207653_104348682	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	DRKGNEADDKCAWSPAPFIGTGGFGYQWEWSNAVSGCVKTAP
Ga0207684_105807102	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	RGYEADDKCAWSPTPFIGTGGFGYQYEWSNANSGCVKTR
Ga0207684_106490773	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	LNAWYDRRGFEADDKCAWSPAPFIDPGTGYAYQYEWSNANSGCVRTR
Ga0207684_109953492	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	EADDKCAWSPAPFIGTGGFGYQYEWSNSAGGCVKSQ
Ga0207707_111081752	3300025912	Corn Rhizosphere	RGNEADDKCAWSPAPFIDGGFGYQYEWSNAAGACVK
Ga0207663_112483042	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	RSGNEADDKCAWSPAPFIGTGGYAYQYEWSNASKACVKTR
Ga0207644_104881973	3300025931	Switchgrass Rhizosphere	FDRQGYEADDKCAWSPSPFIANGFGYQYEWSNLQGGCVASR
Ga0207691_108650201	3300025940	Miscanthus Rhizosphere	SGNEADDKCAWSPAPFIDQSTGFGYQLEWSNSAGGCVKQ
Ga0207651_100807161	3300025960	Switchgrass Rhizosphere	NEADDKCAWSPSPFIGTGGYGYQYEWSNQDRGCVKTK
Ga0207658_103823321	3300025986	Switchgrass Rhizosphere	NAWWANSGAEADDKCAWSPAPFIDGGFGYQYEWSNAARGCVK
Ga0207641_100898493	3300026088	Switchgrass Rhizosphere	EADDKCAWSPAPFLGTGGFGYQWEWSNAVSGCVKTGQ
Ga0207698_101893061	3300026142	Corn Rhizosphere	GEEADDKCAWSPSPFIGTGGYGYQYEWSNADGRCVATK
Ga0209236_13146672	3300026298	Grasslands Soil	RQGFEADDKCAWSPAPFLVNGYGYQYEWSNLDGGCVQGR
Ga0209469_10135251	3300026307	Soil	DPDGNAWFDRQGNEADDKCAWSPAPFLANGYGYQYEWSNLVQGCVQSR
Ga0209265_10655102	3300026308	Soil	RTGNEADDKCAWSPTPFIGTGGYSYQYEWSNANSGCIKTR
Ga0209761_10888031	3300026313	Grasslands Soil	RQGNEADDKCAWSPSPFLVNGYGYQYEWSNLLQGCVQSR
Ga0209375_10353071	3300026329	Soil	QGNEADDKCAWSPAPFLVNGVNGYGYQYEWSNVVQACVQTR
Ga0209803_12702032	3300026332	Soil	AWYDRQGLEADDKCAWSPSPFLVNGYGYQYEWSNLDGGCVQGR
Ga0209059_11821501	3300026527	Soil	EGQDKCAWSPPPFLDGGFGYPYDWSNAANGCVKTR
Ga0209378_10413233	3300026528	Soil	REAATDPDGNAWYDRQGNEADDKCAWSPSPFLVNGFGYQYEWSNVVQACVQSR
Ga0209378_12260622	3300026528	Soil	FDRQGFEADDKCAWSPAPFLVNGYGYQYEWSNLDGGCVQGR
Ga0209283_107970161	3300027875	Vadose Zone Soil	GTAWFDRQGNEADDKCAWSPAPFFGTGGYGYQYEWSNSARGCVKTQ
Ga0247684_10372972	3300028138	Soil	ADDKCAWSPTPFIGTNGYGYQYEWSNANGGCIRTR
Ga0247682_10002861	3300028146	Soil	INNAWFDPQGNTGDDKCAWSPPPFIGTGGFGYQYEWSNLASGCVKTR
Ga0307498_103043302	3300031170	Soil	GNAWFDRQGNEADDKCAWSPAPFIGSGGFGYQQEWSNADHGCVKTK
Ga0310910_108742871	3300031946	Soil	YDRQGNEADDKCAWSPSLFLVNGYGYQYEWSNLKSGCVQSR
Ga0310811_113436312	3300033475	Soil	NRGNEADDKCAWSPTPFKDANGYAYQYEWSNAASGCVQ
Ga0316620_102921442	3300033480	Soil	WWDNRGYEADDKCAWSPAPFVDGGFGYQYEWSNSAGACVK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign