Metagenome / Metatranscriptome Family F060959

Basic Information
Family ID	F060959
Family Type	Metagenome / Metatranscriptome
Number of Sequences	132
Average Sequence Length	40 residues
Representative Sequence	SIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG
Number of Associated Samples	117
Number of Associated Scaffolds	132

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.76 %
% of genes near scaffold ends (potentially truncated)	93.94 %
% of genes from short scaffolds (< 2000 bps)	89.39 %
Associated GOLD sequencing projects	107
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Bacteria (98.485 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.939 % of family members)
Environment Ontology (ENVO)	Unclassified (31.061 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (43.182 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 132 Family Scaffolds
PF13607	Succ_CoA_lig	40.91
PF13380	CoA_binding_2	37.12
PF04392	ABC_sub_bind	3.03
PF13416	SBP_bac_8	3.03
PF08402	TOBE_2	3.03
PF00005	ABC_tran	2.27
PF00378	ECH_1	1.52
PF03972	MmgE_PrpD	0.76
PF00027	cNMP_binding	0.76
PF13378	MR_MLE_C	0.76
PF00528	BPD_transp_1	0.76

COG ID	Name	Functional Category	% Frequency in 132 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	3.03
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.48 %
Unclassified	root	N/A	1.52 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.48 %
Unclassified	root	N/A	1.52 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.48 %
Unclassified	root	N/A	1.52 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	58.33 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	9.09 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	3.79 %
Unclassified	root	N/A	1.52 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	43.18 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	9.09 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	3.79 %
Unclassified	root	N/A	1.52 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	33.33 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	9.09 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	3.79 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3.79 %
Unclassified	root	N/A	1.52 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	33.33 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	9.09 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	3.79 %
Chelatococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae	1.52 %
Unclassified	root	N/A	1.52 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	33.33 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.09 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	3.79 %
Chelatococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus	1.52 %
Unclassified	root	N/A	1.52 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	33.33 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.09 %
Rubinisphaera	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera	3.79 %
Chelatococcus asaccharovorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus asaccharovorans	1.52 %
Unclassified	root	N/A	1.52 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	33.33 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.09 %
Rubinisphaera margarita	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita	3.79 %
Chelatococcus asaccharovorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus asaccharovorans	1.52 %
Unclassified	root	N/A	1.52 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.76 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000955\|JGI1027J12803_104383925	All Organisms → cellular organisms → Bacteria → Proteobacteria	738	Open in IMG/M
3300001431\|F14TB_102023822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	529	Open in IMG/M
3300005174\|Ga0066680_10080645	All Organisms → cellular organisms → Bacteria → Proteobacteria	1963	Open in IMG/M
3300005332\|Ga0066388_105746745	All Organisms → cellular organisms → Bacteria → Proteobacteria	627	Open in IMG/M
3300005344\|Ga0070661_100274725	All Organisms → cellular organisms → Bacteria → Proteobacteria	1306	Open in IMG/M
3300005406\|Ga0070703_10178077	All Organisms → cellular organisms → Bacteria → Proteobacteria	819	Open in IMG/M
3300005435\|Ga0070714_100725680	All Organisms → cellular organisms → Bacteria → Proteobacteria	960	Open in IMG/M
3300005438\|Ga0070701_10578599	All Organisms → cellular organisms → Bacteria → Proteobacteria	741	Open in IMG/M
3300005468\|Ga0070707_100015996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	7040	Open in IMG/M
3300005554\|Ga0066661_10017572	All Organisms → cellular organisms → Bacteria → Proteobacteria	3734	Open in IMG/M
3300005615\|Ga0070702_101289571	All Organisms → cellular organisms → Bacteria → Proteobacteria	593	Open in IMG/M
3300005841\|Ga0068863_101583197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	664	Open in IMG/M
3300006032\|Ga0066696_10195236	All Organisms → cellular organisms → Bacteria → Proteobacteria	1288	Open in IMG/M
3300006032\|Ga0066696_10971880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	540	Open in IMG/M
3300006038\|Ga0075365_10071222	All Organisms → cellular organisms → Bacteria → Proteobacteria	2340	Open in IMG/M
3300006058\|Ga0075432_10566514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	515	Open in IMG/M
3300006354\|Ga0075021_10794527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	611	Open in IMG/M
3300006581\|Ga0074048_10049755	All Organisms → cellular organisms → Bacteria → Proteobacteria	743	Open in IMG/M
3300006844\|Ga0075428_100097683	All Organisms → cellular organisms → Bacteria → Proteobacteria	3202	Open in IMG/M
3300006844\|Ga0075428_101097221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	841	Open in IMG/M
3300006852\|Ga0075433_11326552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	623	Open in IMG/M
3300006854\|Ga0075425_101772167	All Organisms → cellular organisms → Bacteria → Proteobacteria	694	Open in IMG/M
3300006904\|Ga0075424_100550940	All Organisms → cellular organisms → Bacteria → Proteobacteria	1232	Open in IMG/M
3300006914\|Ga0075436_100702508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	749	Open in IMG/M
3300006969\|Ga0075419_10753792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	694	Open in IMG/M
3300007076\|Ga0075435_100204383	All Organisms → cellular organisms → Bacteria	1674	Open in IMG/M
3300009012\|Ga0066710_104253760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	535	Open in IMG/M
3300009090\|Ga0099827_10442848	All Organisms → cellular organisms → Bacteria	1113	Open in IMG/M
3300009101\|Ga0105247_11299010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	584	Open in IMG/M
3300009137\|Ga0066709_102068498	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	788	Open in IMG/M
3300009143\|Ga0099792_10828500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	608	Open in IMG/M
3300009162\|Ga0075423_11154766	All Organisms → cellular organisms → Bacteria	826	Open in IMG/M
3300009162\|Ga0075423_11497478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	724	Open in IMG/M
3300010046\|Ga0126384_10390167	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300010047\|Ga0126382_10674592	All Organisms → cellular organisms → Bacteria	863	Open in IMG/M
3300010361\|Ga0126378_11514328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	761	Open in IMG/M
3300010366\|Ga0126379_11891217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	700	Open in IMG/M
3300010371\|Ga0134125_11970273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	635	Open in IMG/M
3300010376\|Ga0126381_104059378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	569	Open in IMG/M
3300010398\|Ga0126383_13086129	Not Available	544	Open in IMG/M
3300010398\|Ga0126383_13110423	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	542	Open in IMG/M
3300012205\|Ga0137362_11236395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	631	Open in IMG/M
3300012205\|Ga0137362_11353608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	597	Open in IMG/M
3300012357\|Ga0137384_10749565	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	791	Open in IMG/M
3300012893\|Ga0157284_10116225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	719	Open in IMG/M
3300012914\|Ga0157297_10357898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	570	Open in IMG/M
3300012944\|Ga0137410_10573361	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300012971\|Ga0126369_10559119	All Organisms → cellular organisms → Bacteria	1209	Open in IMG/M
3300012971\|Ga0126369_11049327	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300012971\|Ga0126369_11490068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	766	Open in IMG/M
3300012971\|Ga0126369_12193716	All Organisms → cellular organisms → Bacteria → Proteobacteria	639	Open in IMG/M
3300012984\|Ga0164309_10774043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	770	Open in IMG/M
3300012989\|Ga0164305_11915758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	538	Open in IMG/M
3300013297\|Ga0157378_10832474	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300015242\|Ga0137412_11028318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	588	Open in IMG/M
3300015372\|Ga0132256_101386998	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300015373\|Ga0132257_103159121	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	600	Open in IMG/M
3300016294\|Ga0182041_10377362	All Organisms → cellular organisms → Bacteria	1200	Open in IMG/M
3300016341\|Ga0182035_11791630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	556	Open in IMG/M
3300016341\|Ga0182035_11818688	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	552	Open in IMG/M
3300016387\|Ga0182040_10047751	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita	2642	Open in IMG/M
3300016387\|Ga0182040_10200988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1465	Open in IMG/M
3300016404\|Ga0182037_10325252	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1244	Open in IMG/M
3300016422\|Ga0182039_10175584	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita	1686	Open in IMG/M
3300016422\|Ga0182039_10866370	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300016445\|Ga0182038_11131208	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300017654\|Ga0134069_1157983	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	760	Open in IMG/M
3300017947\|Ga0187785_10190592	All Organisms → cellular organisms → Bacteria → Proteobacteria	887	Open in IMG/M
3300017974\|Ga0187777_10598291	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	777	Open in IMG/M
3300018055\|Ga0184616_10356645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	550	Open in IMG/M
3300018062\|Ga0187784_10937969	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300018476\|Ga0190274_13072373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	561	Open in IMG/M
3300018481\|Ga0190271_13197384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	549	Open in IMG/M
3300021510\|Ga0222621_1098407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	620	Open in IMG/M
3300021560\|Ga0126371_13757188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	512	Open in IMG/M
3300022756\|Ga0222622_10857014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	665	Open in IMG/M
3300023073\|Ga0247744_1067467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	606	Open in IMG/M
3300024181\|Ga0247693_1059205	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	562	Open in IMG/M
3300025899\|Ga0207642_10681988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	646	Open in IMG/M
3300025900\|Ga0207710_10708917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	528	Open in IMG/M
3300025917\|Ga0207660_10881138	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	730	Open in IMG/M
3300025929\|Ga0207664_11741011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	546	Open in IMG/M
3300026067\|Ga0207678_11244363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	659	Open in IMG/M
3300026298\|Ga0209236_1215935	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	682	Open in IMG/M
3300026309\|Ga0209055_1033905	All Organisms → cellular organisms → Bacteria	2309	Open in IMG/M
3300026528\|Ga0209378_1051761	All Organisms → cellular organisms → Bacteria	1987	Open in IMG/M
3300027471\|Ga0209995_1093263	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300027874\|Ga0209465_10343437	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	748	Open in IMG/M
3300027882\|Ga0209590_10454402	All Organisms → cellular organisms → Bacteria	828	Open in IMG/M
3300027894\|Ga0209068_10633050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	624	Open in IMG/M
3300027986\|Ga0209168_10029291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus asaccharovorans	3051	Open in IMG/M
3300028536\|Ga0137415_11036666	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300028796\|Ga0307287_10298271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	609	Open in IMG/M
3300028906\|Ga0308309_10306556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus asaccharovorans	1344	Open in IMG/M
3300031200\|Ga0307496_10018713	All Organisms → cellular organisms → Bacteria	981	Open in IMG/M
3300031546\|Ga0318538_10011876	All Organisms → cellular organisms → Bacteria	3650	Open in IMG/M
3300031546\|Ga0318538_10783599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	517	Open in IMG/M
3300031549\|Ga0318571_10345453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	569	Open in IMG/M
3300031564\|Ga0318573_10101417	All Organisms → cellular organisms → Bacteria	1477	Open in IMG/M
3300031572\|Ga0318515_10111910	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita	1438	Open in IMG/M
3300031640\|Ga0318555_10578207	All Organisms → cellular organisms → Bacteria	609	Open in IMG/M
3300031679\|Ga0318561_10846428	Not Available	503	Open in IMG/M
3300031720\|Ga0307469_11686554	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	610	Open in IMG/M
3300031736\|Ga0318501_10254164	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300031744\|Ga0306918_10404400	All Organisms → cellular organisms → Bacteria	1064	Open in IMG/M
3300031748\|Ga0318492_10396609	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	725	Open in IMG/M
3300031781\|Ga0318547_10006824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4965	Open in IMG/M
3300031782\|Ga0318552_10014044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3418	Open in IMG/M
3300031793\|Ga0318548_10522469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	579	Open in IMG/M
3300031798\|Ga0318523_10667740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	510	Open in IMG/M
3300031833\|Ga0310917_10508139	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300031845\|Ga0318511_10003527	All Organisms → cellular organisms → Bacteria → Proteobacteria	4615	Open in IMG/M
3300031860\|Ga0318495_10402132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	603	Open in IMG/M
3300031890\|Ga0306925_10158611	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita	2436	Open in IMG/M
3300031903\|Ga0307407_10886706	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300031910\|Ga0306923_11784064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	633	Open in IMG/M
3300031940\|Ga0310901_10455079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	566	Open in IMG/M
3300031946\|Ga0310910_10310543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1241	Open in IMG/M
3300031946\|Ga0310910_11134690	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300031959\|Ga0318530_10064641	All Organisms → cellular organisms → Bacteria	1405	Open in IMG/M
3300032001\|Ga0306922_10532994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1249	Open in IMG/M
3300032010\|Ga0318569_10045143	All Organisms → cellular organisms → Bacteria	1890	Open in IMG/M
3300032025\|Ga0318507_10394911	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	602	Open in IMG/M
3300032039\|Ga0318559_10328760	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300032044\|Ga0318558_10334329	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300032051\|Ga0318532_10208569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	693	Open in IMG/M
3300032076\|Ga0306924_10036061	All Organisms → cellular organisms → Bacteria → Proteobacteria	5403	Open in IMG/M
3300032076\|Ga0306924_10645698	All Organisms → cellular organisms → Bacteria	1193	Open in IMG/M
3300032180\|Ga0307471_100388897	All Organisms → cellular organisms → Bacteria	1518	Open in IMG/M
3300032261\|Ga0306920_100291707	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera margarita	2430	Open in IMG/M
3300032261\|Ga0306920_102497018	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300032805\|Ga0335078_11235237	All Organisms → cellular organisms → Bacteria	859	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.58%
Host-Associated	Host-Associated	17.42%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.79%
Plants	Host-Associated → Plants	17.42%
Aquatic	Environmental → Aquatic	3.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	13.64%
Sediment	Environmental → Aquatic → Sediment	3.79%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.03%
Roots	Host-Associated → Plants → Roots	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	67.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.36%
Loam	Environmental → Terrestrial → Soil → Loam	8.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.79%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.03%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.27%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.76%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.76%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	33.33%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.36%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.30%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.79%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.03%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.27%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.76%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.76%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	18.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	12.88%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.09%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.33%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.30%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.03%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.27%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.27%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.52%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.52%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.52%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.52%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.76%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.76%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.76%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.76%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.76%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300023073	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5	Environmental	Open in IMG/M
3300024181	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031200	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031782	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031798	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031860	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental	Open in IMG/M
3300032025	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032044	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20	Environmental	Open in IMG/M
3300032051	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F060959

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1027J12803_1043839252	3300000955	Soil	RLESDPVIAVVSTLLTGTVFLGVLVSVFIRRRPANAH*
F14TB_1020238222	3300001431	Soil	SDPVIAVVSTLLTGAVLLGVIVSLLFRQRPVQRLANEA*
Ga0066680_100806452	3300005174	Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLISLLFRQRPPKGERYAA*
Ga0066388_1057467451	3300005332	Tropical Forest Soil	MFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRPRPAQG*
Ga0070661_1002747252	3300005344	Corn Rhizosphere	IRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA*
Ga0070703_101780771	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	ESIRLESDPVIAVVSTLLVSAVVLGVLFAMFLRRRSPHVA*
Ga0070714_1007256801	3300005435	Agricultural Soil	SIRLESDPVIAVVSTLLTGAVLIGVLLSLLFRRSPTQRLTNEA*
Ga0070701_105785991	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	KKMFESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA*
Ga0070707_1000159968	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	PKKMYESIRLESDPVIAVVSTLLVSAVVLGVLLSVFARRRPSMRLDT*
Ga0066661_100175721	3300005554	Soil	LESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG*
Ga0070702_1012895712	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	KMFESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA*
Ga0068863_1015831972	3300005841	Switchgrass Rhizosphere	LESDPVIAVVSTLLTGAVLVGVLVSLLFRQRPAQRSVQRSTNAN*
Ga0066696_101952362	3300006032	Soil	LESDPVIAVVSTLLVSAVVLGVLLSLFLRRRSPHAA*
Ga0066696_109718802	3300006032	Soil	IRLESDPVIAVVSTLLTGSVFIGVLLSLFFRRRPAHAA*
Ga0075365_100712221	3300006038	Populus Endosphere	DPVIAVVSSLLTGAVLLGVLVSLFFRQGTAKRSANAA*
Ga0075432_105665142	3300006058	Populus Rhizosphere	LESDPVIAVVSTLLTGAVLVGVLISLFFRKRPAHAN*
Ga0075021_107945272	3300006354	Watersheds	RLESDPVIAVVSTLLTGAVLIGALVSLFFRQRPSHAN*
Ga0074048_100497551	3300006581	Soil	SIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQRTAQRSANAT*
Ga0075428_1000976833	3300006844	Populus Rhizosphere	SIRLESDPVIAVVSTLLTGAVLLGVLVSLFFRQRNVQRSANAA*
Ga0075428_1010972211	3300006844	Populus Rhizosphere	ESIRLESDPVIAVVSTLLTGAIFVGVLVSLLFRQRPASAR*
Ga0075433_113265521	3300006852	Populus Rhizosphere	LESDPVIAVVSTLLTGAVLLGVLLSLFFRKRPALR*
Ga0075425_1017721671	3300006854	Populus Rhizosphere	SIRLESDPVIAVVSTLLTGAVLLGVLLSLFFRKRPALR*
Ga0075424_1005509402	3300006904	Populus Rhizosphere	RLESDPVIAVVSTLLTGAVLLGVLISLLFRQRPPKGERYAA*
Ga0075436_1007025082	3300006914	Populus Rhizosphere	IRLESDPVIAVVSTLLVSAVVLGVLASLVIRRRPALRPDA*
Ga0075419_107537922	3300006969	Populus Rhizosphere	DPVIAVVSTLLTGAVLLGVLVSLLFRQRPAQRLANET*
Ga0075435_1002043833	3300007076	Populus Rhizosphere	RLESDPVIAVVSTLLVSAVVLGVLASLVIRRRPALRPDA*
Ga0066710_1042537602	3300009012	Grasslands Soil	MFESIRLESDPVIAVVSTLLTGSVLVGVLIPLFFRKSAHAH
Ga0099827_104428482	3300009090	Vadose Zone Soil	IAVVSTLLTGAVLLGVLISLFFRQRPEQRSANAA*
Ga0105247_112990102	3300009101	Switchgrass Rhizosphere	KKMFESIRLESDPVIAVVSTLLTGAVFIGVLVSLFFRQSSPQRS*
Ga0066709_1020684982	3300009137	Grasslands Soil	SDPVIAVVSTLLVSAVVLGVLISLFLRRRSPHAA*
Ga0099792_108285002	3300009143	Vadose Zone Soil	LESDPVIAVVSTLLTGAIFVGVLVSLFFRQRAPQRSANVA*
Ga0075423_111547662	3300009162	Populus Rhizosphere	ETDPVIAVVSTLLTGAVLLGVLISLFFRQRPENAT*
Ga0075423_114974782	3300009162	Populus Rhizosphere	LESDPVIAVVSTLLTGAVLLGVLISLLFRQRPVQRLANEA*
Ga0126384_103901672	3300010046	Tropical Forest Soil	FESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQGPAQG*
Ga0126382_106745922	3300010047	Tropical Forest Soil	RLESDPVIAVVSTLLTGAVLLGVLISLLFRQKPVQRLANEA*
Ga0126378_115143282	3300010361	Tropical Forest Soil	KKMFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG*
Ga0126379_118912171	3300010366	Tropical Forest Soil	ESIRLESDPVIAVVSTLLTGAVLVGVLIAFSFRQRASPHAT*
Ga0134125_119702731	3300010371	Terrestrial Soil	RLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRAANAA*
Ga0126381_1040593782	3300010376	Tropical Forest Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQGPAQG*
Ga0126383_130861291	3300010398	Tropical Forest Soil	SIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRRERAQMRD*
Ga0126383_131104231	3300010398	Tropical Forest Soil	LTAACQMYAGIRESGSVIAVVSSLLIGSMLFGALLSVLLGRRPARVS*
Ga0137362_112363952	3300012205	Vadose Zone Soil	ESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG*
Ga0137362_113536083	3300012205	Vadose Zone Soil	RLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG*
Ga0137384_107495651	3300012357	Vadose Zone Soil	SIRLESDPVIAVVSTLLVSAVVLGVLIAMFLRRRSPHVA*
Ga0157284_101162251	3300012893	Soil	SDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA*
Ga0157297_103578981	3300012914	Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLVSLFFRQRNVQRSANAA*
Ga0137410_105733611	3300012944	Vadose Zone Soil	RLESDPVIAVVSTLLVGAVVLGVLVPVVMRRRPIDAA*
Ga0126369_105591191	3300012971	Tropical Forest Soil	KKMFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQGPAQG*
Ga0126369_110493272	3300012971	Tropical Forest Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPPKGERYAA*
Ga0126369_114900682	3300012971	Tropical Forest Soil	FESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRPRPAQG*
Ga0126369_121937162	3300012971	Tropical Forest Soil	MYASIRLESDPTVVSSLLIGSVLFGALLLLLPGRRPARVA*
Ga0164309_107740431	3300012984	Soil	LESDPVIAVVSTLLTGAVLLGVLVSLFFRQGTTKRS*
Ga0164305_119157582	3300012989	Soil	FESIRLESDPVIAVVSTLLTGAVLLGVLVSLFFRQGTAKRSANAA*
Ga0157378_108324742	3300013297	Miscanthus Rhizosphere	SIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGTAKRAANAA*
Ga0137412_110283182	3300015242	Vadose Zone Soil	ESIRLESDPVIAVVSTLLTGAIFLGVVVSLFLRRRFSHAA*
Ga0132256_1013869982	3300015372	Arabidopsis Rhizosphere	RLESDPVIAVVSTLLTGAVFLGVLVSVFIRRRPANAH*
Ga0132257_1031591211	3300015373	Arabidopsis Rhizosphere	IRLESDPVIAVVSTLLVSAVALGVLASLFLRRRSAHVA*
Ga0182041_103773622	3300016294	Soil	MYESIRLESDPVIAVVFSLLIGPVLSGVLLSVLLKRRPARVS
Ga0182035_117916302	3300016341	Soil	SDPVIAVVSTLLTGSVLLGVLVSLFFRPRTVTHAH
Ga0182035_118186882	3300016341	Soil	LESDPVIAVVSTLLVSAVVLGVFVSILVRRRSAHVA
Ga0182040_100477517	3300016387	Soil	MFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRDT
Ga0182040_102009884	3300016387	Soil	FESIRLESDPVIAVVSTLLTGAVLLGVLISLFFGQRDT
Ga0182037_103252521	3300016404	Soil	IRLESDPVIAVVSTLLTGAVLLGVLISLFFGQRDT
Ga0182039_101755841	3300016422	Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRDT
Ga0182039_108663702	3300016422	Soil	MYESIRLESDPVIAVVSSLLIGSVLFGVLLSVLLRR
Ga0182038_111312081	3300016445	Soil	KKMFESIRLESDPVIAVVSSLLTGAVLAGVLASLLLRPRARDAT
Ga0134069_11579832	3300017654	Grasslands Soil	LESDPVIAVVSTLLTGAVLLGVLISLLFRQRPPKGERYAA
Ga0187785_101905922	3300017947	Tropical Peatland	MYESIRLQSDPVIAVVSSLLIGSVLLGALLSVLLRRWPARVS
Ga0187777_105982911	3300017974	Tropical Peatland	RLESDPVIAVVSTLLVSAVVLGVLVSILVRRRSAHVA
Ga0184616_103566452	3300018055	Groundwater Sediment	FESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQRNAQRSANAT
Ga0187784_109379692	3300018062	Tropical Peatland	ESDPVIAVVSTLLTGAVLAGVLVSLLMRRQTANAA
Ga0190274_130723731	3300018476	Soil	RLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGTAKRSANAA
Ga0190271_131973841	3300018481	Soil	ESDPVIAVVSTLLTGAILIGVIVSLFFRQRPANAN
Ga0222621_10984072	3300021510	Groundwater Sediment	FESIRLESDPVIAVVSTLLTGAVLLGVLVSLFFRQGTAKRSANAA
Ga0126371_137571881	3300021560	Tropical Forest Soil	MFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPPKGERYAA
Ga0222622_108570142	3300022756	Groundwater Sediment	KKMFESIRLESDPVIAVVSTLLTGSVLLGVLISLLFRQRRAHAA
Ga0247744_10674672	3300023073	Soil	MFESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA
Ga0247693_10592051	3300024181	Soil	RLESDPVIAVVSTLLVSVVVLGVLISMFLRGRSAHVA
Ga0207642_106819882	3300025899	Miscanthus Rhizosphere	KKMFESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA
Ga0207710_107089172	3300025900	Switchgrass Rhizosphere	ESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGTAKRSANAA
Ga0207660_108811382	3300025917	Corn Rhizosphere	RLESDPVIAVVSTLLVSTVALGVLASLFLRRRSAHVA
Ga0207664_117410111	3300025929	Agricultural Soil	ESIRLESDPVIAVVSTLLTGAVLIGVLLSLLFRRSPTQRLTNEA
Ga0207678_112443631	3300026067	Corn Rhizosphere	PVIAVVSSLLTGAVLLGVLVSLFFRQGTAKRSANAA
Ga0209236_12159352	3300026298	Grasslands Soil	MYESIRLESDPVIAVVSTLLVSAVLLGVLIAMFLRRRSTHVA
Ga0209055_10339051	3300026309	Soil	KKMFESIRLESDPVIAVVSTLLTGAVLLGVLISLLFRQRPPRGERYAA
Ga0209378_10517611	3300026528	Soil	SIRLESDPVIAVVSTLLTGAVLLGVLLSLFVRKRPASR
Ga0209995_10932631	3300027471	Arabidopsis Thaliana Rhizosphere	ESDPVIAVVSTLLVGAVALGVLVWTFVRRRPADAT
Ga0209465_103434371	3300027874	Tropical Forest Soil	KMFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG
Ga0209590_104544022	3300027882	Vadose Zone Soil	LESDPVIAVVSTLLVSGVVLGVLVSAFLHRRPANAT
Ga0209068_106330501	3300027894	Watersheds	FESIRLESDPVIAVVSTLLTGAVLIGALVSLFFRQRPSHAN
Ga0209168_100292911	3300027986	Surface Soil	ESIRLESDPVLAVVSTLLTGAVLAGVLIWIFARQRTAHAT
Ga0137415_110366661	3300028536	Vadose Zone Soil	KMYESIRLESDPVIAVVSTLLVSAVMLGVLVSAFLRRRPANAA
Ga0307287_102982711	3300028796	Soil	SIRLESDPVIAVVSTLLTGAVLLGVLVSLFFRQGTAKRSANAA
Ga0308309_103065561	3300028906	Soil	MYDSIRLESDPVIAVVSSLLIGSVLFGVLLSVVVRRKLARVP
Ga0307496_100187131	3300031200	Soil	VIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA
Ga0318538_100118764	3300031546	Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRPRPAQG
Ga0318538_107835991	3300031546	Soil	ESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG
Ga0318571_103454531	3300031549	Soil	LESDPVIAVVSTLLTGAVLFGVLISLFFRQRPAQG
Ga0318573_101014171	3300031564	Soil	SIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG
Ga0318515_101119103	3300031572	Soil	SIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRDT
Ga0318555_105782072	3300031640	Soil	MYESIRLESDPVTAVVSAPLIGSVLFGMLLSVLLRRRPARVS
Ga0318561_108464281	3300031679	Soil	MYESIRLESDPVIAVVSSLLIGSVLFGVLLSVLLRRRPARVS
Ga0307469_116865542	3300031720	Hardwood Forest Soil	IRLESDPVIAVVSTLLVSAVVLGVLIAMFLRRRSPHVA
Ga0318501_102541642	3300031736	Soil	LESDPVIAVVSSLLTGTVLAGVLASLLLRPRARDAT
Ga0306918_104044003	3300031744	Soil	MAGELTAACQMYAGIRESGSVIAVVSSLLIGSMLFGALLSVLLGRRPARVS
Ga0318492_103966092	3300031748	Soil	ESDPVIAVVSTLLVSAVVLGVFVSILVRRRSAHVA
Ga0318547_100068241	3300031781	Soil	FESIRLESDPVIAVVSTLLTGSVFIGVLLSLFFRRRPAHAA
Ga0318552_100140443	3300031782	Soil	LESDPVIAVVSTLLTGAVLLGVLISLFFRQRPTQG
Ga0318548_105224692	3300031793	Soil	IRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPAQG
Ga0318523_106677402	3300031798	Soil	MFESIRLESDPVIAVVSSLLTGTVLAGVLASLLLRPRARDAT
Ga0310917_105081392	3300031833	Soil	ESIRLESDPVIAVVSTLLTGSVLLGVLVSLFFRPRTVTHAH
Ga0318511_100035271	3300031845	Soil	SIRLESDPVIAVVSTLLTGAVLFGVLISLFFRQRPAQG
Ga0318495_104021322	3300031860	Soil	SIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPPKGERYAA
Ga0306925_101586111	3300031890	Soil	IRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRDT
Ga0307407_108867062	3300031903	Rhizosphere	KMYESIRLESDPVIAVVSTLLVGAVVLGVLVSVVARRRPARAT
Ga0306923_117840642	3300031910	Soil	IRLESDPVIAVVSTLLTGSVLLGVLVSLFFRPKAVTHAH
Ga0310901_104550792	3300031940	Soil	ESIRLESDPVIAVVSSLLTGAVLLGVLVSLFFRQGNAQRSANAA
Ga0310910_103105431	3300031946	Soil	MFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFGQRDT
Ga0310910_111346901	3300031946	Soil	MYESICLESDPVIAVVSSLLIGSMLIGALLSVLLRSRPARVS
Ga0318530_100646412	3300031959	Soil	PKKMFESIRLESDPVIAVVSSLLTGTVLAGVLASLLLRPRARDAT
Ga0306922_105329941	3300032001	Soil	KKMFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFGQRDT
Ga0318569_100451431	3300032010	Soil	FESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRPRPAQG
Ga0318507_103949111	3300032025	Soil	PVIAVVSTLLTGAVLLGVLISLFFRQRPPKGERYAA
Ga0318559_103287601	3300032039	Soil	YESIRLESDPVTAVVSAPLIGSVLFGMLLSVLLRRRPARVS
Ga0318558_103343292	3300032044	Soil	SIRLESDPVIAVVSSLLTGTVLAGVLASLLLRPRARDAT
Ga0318532_102085692	3300032051	Soil	ESDPVIAVVSTLLTGAVLLGVLISLFFRQRPPKGERYAA
Ga0306924_100360611	3300032076	Soil	KMFESIRLESDPVIAVVSTLLTGAVLIGVLVAFPFRPRAAHAT
Ga0306924_106456982	3300032076	Soil	KMFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRPPKGERYAA
Ga0307471_1003888971	3300032180	Hardwood Forest Soil	IRLESDPVIAVVSTLLVSTVALGVLASLFLRRRSAHVA
Ga0306920_1002917076	3300032261	Soil	KMFESIRLESDPVIAVVSTLLTGAVLLGVLISLFFRQRDT
Ga0306920_1024970182	3300032261	Soil	RLPCQMFASIRLESDPIVVSSLLIGSVLFGALLLLLPGRRPARVA
Ga0335078_112352372	3300032805	Soil	FESIRLESDPVIAVVSTLLTGAVLIGVLIPLFFRRKPVHAS

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign