| Basic Information | |
|---|---|
| Family ID | F060957 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVDAAV |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.67 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.303 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.848 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.00% β-sheet: 0.00% Coil/Unstructured: 96.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 24.24 |
| PF03401 | TctC | 7.58 |
| PF00072 | Response_reg | 0.76 |
| PF00196 | GerE | 0.76 |
| PF13378 | MR_MLE_C | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 24.24 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 24.24 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 7.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.73 % |
| Unclassified | root | N/A | 2.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01A2IOY | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300000789|JGI1027J11758_12490005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300000890|JGI11643J12802_10849365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300001867|JGI12627J18819_10239817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300001990|JGI24737J22298_10029933 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300004629|Ga0008092_11271191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300005328|Ga0070676_10163158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1436 | Open in IMG/M |
| 3300005332|Ga0066388_108667930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005337|Ga0070682_100036861 | All Organisms → cellular organisms → Bacteria | 2990 | Open in IMG/M |
| 3300005366|Ga0070659_100933729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300005454|Ga0066687_10825893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300005713|Ga0066905_102091678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300005719|Ga0068861_102704958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300005764|Ga0066903_104680220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300006047|Ga0075024_100729492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300006354|Ga0075021_10918782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300006844|Ga0075428_101586377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300006847|Ga0075431_100360758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1460 | Open in IMG/M |
| 3300006847|Ga0075431_101347942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300006852|Ga0075433_11918558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300006939|Ga0081244_1514795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1362 | Open in IMG/M |
| 3300009093|Ga0105240_11711354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300009100|Ga0075418_10407636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1454 | Open in IMG/M |
| 3300009147|Ga0114129_13508726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300009156|Ga0111538_11009625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
| 3300009162|Ga0075423_11866202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300009168|Ga0105104_10973076 | Not Available | 501 | Open in IMG/M |
| 3300010043|Ga0126380_11632903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300010048|Ga0126373_10432463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1347 | Open in IMG/M |
| 3300010361|Ga0126378_12893359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300010366|Ga0126379_13612434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300010371|Ga0134125_13083179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010403|Ga0134123_10332265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1363 | Open in IMG/M |
| 3300011271|Ga0137393_10490100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300012199|Ga0137383_10953316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300012201|Ga0137365_10156821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1708 | Open in IMG/M |
| 3300012210|Ga0137378_11461050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300012212|Ga0150985_112925045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300012350|Ga0137372_10738988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300012360|Ga0137375_10896785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300012362|Ga0137361_11279187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300012922|Ga0137394_10766260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300012927|Ga0137416_11170661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300012955|Ga0164298_10884303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300012957|Ga0164303_10241839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300012961|Ga0164302_10457686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300012986|Ga0164304_10943229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300013308|Ga0157375_11618099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300014154|Ga0134075_10483359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300014157|Ga0134078_10672183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300014326|Ga0157380_12428199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300015264|Ga0137403_10342839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1383 | Open in IMG/M |
| 3300015371|Ga0132258_13010616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300015372|Ga0132256_102329415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300016270|Ga0182036_11690783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300016371|Ga0182034_11793226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300016422|Ga0182039_10025570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3709 | Open in IMG/M |
| 3300016422|Ga0182039_10050267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2833 | Open in IMG/M |
| 3300016445|Ga0182038_11295633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300016445|Ga0182038_12017866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300017974|Ga0187777_11128936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300018431|Ga0066655_10457608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300018468|Ga0066662_10036378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2992 | Open in IMG/M |
| 3300018469|Ga0190270_10830851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300020062|Ga0193724_1043040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 959 | Open in IMG/M |
| 3300020580|Ga0210403_10823902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300021082|Ga0210380_10348351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300021178|Ga0210408_11241773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300021361|Ga0213872_10110726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
| 3300025899|Ga0207642_10043180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1986 | Open in IMG/M |
| 3300025933|Ga0207706_11543527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300025960|Ga0207651_10166061 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300026142|Ga0207698_10078294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2654 | Open in IMG/M |
| 3300027388|Ga0208995_1003866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2452 | Open in IMG/M |
| 3300028592|Ga0247822_10305517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1217 | Open in IMG/M |
| 3300028592|Ga0247822_11782045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300028597|Ga0247820_10394345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 925 | Open in IMG/M |
| 3300028708|Ga0307295_10045941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300028712|Ga0307285_10115638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300028754|Ga0307297_10277393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300028811|Ga0307292_10434316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300028814|Ga0307302_10575940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300030336|Ga0247826_10345039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1083 | Open in IMG/M |
| 3300031198|Ga0307500_10027331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300031421|Ga0308194_10253621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031474|Ga0170818_110845948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300031543|Ga0318516_10889032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031546|Ga0318538_10233713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300031546|Ga0318538_10636443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300031549|Ga0318571_10211017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300031640|Ga0318555_10751186 | Not Available | 527 | Open in IMG/M |
| 3300031668|Ga0318542_10506658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300031679|Ga0318561_10359030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300031713|Ga0318496_10398122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300031723|Ga0318493_10901759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300031751|Ga0318494_10821470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300031765|Ga0318554_10538574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031770|Ga0318521_10027500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2746 | Open in IMG/M |
| 3300031778|Ga0318498_10051254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1831 | Open in IMG/M |
| 3300031781|Ga0318547_10226062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1123 | Open in IMG/M |
| 3300031782|Ga0318552_10703241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300031792|Ga0318529_10046686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1854 | Open in IMG/M |
| 3300031792|Ga0318529_10607427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300031795|Ga0318557_10313967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 720 | Open in IMG/M |
| 3300031796|Ga0318576_10347822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300031797|Ga0318550_10126849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1217 | Open in IMG/M |
| 3300031797|Ga0318550_10340747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300031798|Ga0318523_10269784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300031805|Ga0318497_10225449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1037 | Open in IMG/M |
| 3300031821|Ga0318567_10140184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1332 | Open in IMG/M |
| 3300031858|Ga0310892_10184963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300031879|Ga0306919_10204105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1470 | Open in IMG/M |
| 3300031890|Ga0306925_10833022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300031893|Ga0318536_10022629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2870 | Open in IMG/M |
| 3300031910|Ga0306923_11634094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300031941|Ga0310912_10196114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1542 | Open in IMG/M |
| 3300031941|Ga0310912_10562938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300031946|Ga0310910_10668930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
| 3300032025|Ga0318507_10369437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300032035|Ga0310911_10108803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1527 | Open in IMG/M |
| 3300032035|Ga0310911_10572783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300032044|Ga0318558_10199622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
| 3300032051|Ga0318532_10270426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300032052|Ga0318506_10003782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4403 | Open in IMG/M |
| 3300032060|Ga0318505_10478437 | Not Available | 588 | Open in IMG/M |
| 3300032064|Ga0318510_10008581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2894 | Open in IMG/M |
| 3300032066|Ga0318514_10796966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300032094|Ga0318540_10024449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2556 | Open in IMG/M |
| 3300032159|Ga0268251_10580987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300032174|Ga0307470_11415228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300032261|Ga0306920_104418783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300034113|Ga0364937_142010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.52% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.76% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.76% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_00360850 | 2170459012 | Grass Soil | MTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHM |
| JGI1027J11758_124900052 | 3300000789 | Soil | MTKPQLMPWIGGAVEAKAAFSPLICPIDESIASQMIESDAEVVDRAVKHA |
| JGI11643J12802_108493651 | 3300000890 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPIDDSVASHMID |
| JGI12627J18819_102398171 | 3300001867 | Forest Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDQSVASHMIESDAKVVDAAVKHA |
| JGI24737J22298_100299333 | 3300001990 | Corn Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESXAKVVDAA |
| Ga0008092_112711912 | 3300004629 | Tropical Rainforest Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDA |
| Ga0070676_101631582 | 3300005328 | Miscanthus Rhizosphere | MTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVVD |
| Ga0066388_1086679302 | 3300005332 | Tropical Forest Soil | MTIPQLMPWIGGPAKFDAGLSLLVCPIDESVASHMIESDAKVVDAAV |
| Ga0070682_1000368611 | 3300005337 | Corn Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDA |
| Ga0070659_1009337292 | 3300005366 | Corn Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDAAVKH |
| Ga0066687_108258932 | 3300005454 | Soil | MTIPQLMPWIGGPVKFEGGLSPLVCPTDQSVASHMIESDAKVVDAAVKHAHT |
| Ga0066905_1020916782 | 3300005713 | Tropical Forest Soil | MTVAQLMPWIGGPVKFEAASSPLICPIDDTVASHI |
| Ga0068861_1027049581 | 3300005719 | Switchgrass Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDAAVKHS |
| Ga0066903_1046802201 | 3300005764 | Tropical Forest Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPIDESVASHMIESDAKVVDAAV |
| Ga0075024_1007294921 | 3300006047 | Watersheds | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAVKHS |
| Ga0075021_109187822 | 3300006354 | Watersheds | MTVPQLMPWIGGATKFEAKFSALVCPIDESIASQI |
| Ga0075428_1015863771 | 3300006844 | Populus Rhizosphere | MTVPQLMPWIGSPTAFPDAAFSPLISPVDESVVSQMIESNA |
| Ga0075431_1003607583 | 3300006847 | Populus Rhizosphere | MTVPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVDAAVKHAH |
| Ga0075431_1013479422 | 3300006847 | Populus Rhizosphere | MTVPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDA |
| Ga0075433_119185582 | 3300006852 | Populus Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPIDDSVASHMIESDANVVDA |
| Ga0081244_15147952 | 3300006939 | Tropical Rainforest Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVDAAV |
| Ga0105240_117113542 | 3300009093 | Corn Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDA |
| Ga0075418_104076361 | 3300009100 | Populus Rhizosphere | MTVPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVD |
| Ga0114129_135087261 | 3300009147 | Populus Rhizosphere | MGVPQLMPWIGGPAQFEAAYSPLICPIDETVASQIIESDAKVVD |
| Ga0111538_110096252 | 3300009156 | Populus Rhizosphere | MTIPQLMPWIGGPVKFEAGFSPLVCPIDESVASHMIESDANVVDAAVK |
| Ga0075423_118662022 | 3300009162 | Populus Rhizosphere | MTKPQLMPWIGGPVDAKNAKACFSPLICPIDESVASQMIESDAEMV |
| Ga0105104_109730762 | 3300009168 | Freshwater Sediment | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVV |
| Ga0126380_116329031 | 3300010043 | Tropical Forest Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKIID |
| Ga0126373_104324631 | 3300010048 | Tropical Forest Soil | MTIPQLMPWIGGPVKFDAGLSPLVCPIDESVASHMIESDAKVVDAAVAH |
| Ga0126378_128933591 | 3300010361 | Tropical Forest Soil | MTIPQLMPWIGGPVKFDAGLSPLVCPIDETVASQIIESDAKVVDAAVK |
| Ga0126379_136124342 | 3300010366 | Tropical Forest Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESNA |
| Ga0134125_130831792 | 3300010371 | Terrestrial Soil | MTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVVDAAVKHAH |
| Ga0134123_103322651 | 3300010403 | Terrestrial Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIE |
| Ga0137393_104901001 | 3300011271 | Vadose Zone Soil | MTIPQLMPWIGGATKFEAGFSALVCPIDDTIASEIMESDAKVIDTAVEHAH |
| Ga0137383_109533161 | 3300012199 | Vadose Zone Soil | MTIPQLMPWIGGPVKFEADLSPLVCPIDESVASHMIESDAKVVDAAVKHAHA |
| Ga0137365_101568211 | 3300012201 | Vadose Zone Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKV |
| Ga0137378_114610502 | 3300012210 | Vadose Zone Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKIVDA |
| Ga0150985_1129250451 | 3300012212 | Avena Fatua Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAVKHSHAA |
| Ga0137372_107389882 | 3300012350 | Vadose Zone Soil | MTIPQLMPWIGGPTTYEAAFSPLVCPIDESVASHMIESDAKVVDAAVKHA |
| Ga0137375_108967851 | 3300012360 | Vadose Zone Soil | MTIPQLMPWIGGPVKFEAGFSPIVCPIDESVASHMIESDAKVVDAAVKH |
| Ga0137361_112791872 | 3300012362 | Vadose Zone Soil | MTVPQLMPWIGGPVKFEADLSPLVCPIDETVASQIIESDA |
| Ga0137394_107662602 | 3300012922 | Vadose Zone Soil | MTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHMIESDAKVVDAAV |
| Ga0137416_111706612 | 3300012927 | Vadose Zone Soil | MTVPQLMPWIGGATKFEAQFSALVCPIDESIASQIIESDAKVI |
| Ga0164298_108843032 | 3300012955 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASYMIESDAKVVDAAV |
| Ga0164303_102418391 | 3300012957 | Soil | MTIPQLMPWIGGPAKFDAGLSPRVCPIDDSVASHMIESDANVVDAAVEHA |
| Ga0164302_104576861 | 3300012961 | Soil | MTRVEKGAPMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVV |
| Ga0164304_109432292 | 3300012986 | Soil | MTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVVDAAV |
| Ga0157375_116180992 | 3300013308 | Miscanthus Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPIDDSVASHMIESDANVVDAAVE |
| Ga0134075_104833591 | 3300014154 | Grasslands Soil | MSIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVD |
| Ga0134078_106721832 | 3300014157 | Grasslands Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIES |
| Ga0157380_124281991 | 3300014326 | Switchgrass Rhizosphere | MTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIE |
| Ga0137403_103428391 | 3300015264 | Vadose Zone Soil | MTKPQLMPWIGGPVEFKANFSPLICPIDESVASQMIESDAKVVDAAVK |
| Ga0132258_130106162 | 3300015371 | Arabidopsis Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESD |
| Ga0132256_1023294152 | 3300015372 | Arabidopsis Rhizosphere | MTIPQLMPWIGGPVKFEAGLSALVCPIDETVASQIIESDAKVV |
| Ga0182036_116907832 | 3300016270 | Soil | MTIPQLMPWIGGPMKFEAGLSPLVCPIDETVASQIIESDAKVVDA |
| Ga0182034_117932262 | 3300016371 | Soil | MTIPQLMPWIGGAAKFDAPFSALVCPIDDKVESEIIESDAKVIDAAVRHA |
| Ga0182039_100255701 | 3300016422 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAA |
| Ga0182039_100502674 | 3300016422 | Soil | MTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAAV |
| Ga0182038_112956332 | 3300016445 | Soil | MTISQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHAH |
| Ga0182038_120178662 | 3300016445 | Soil | MTIPQLMPWIGGPMKFEAGLSPLVCPIDETVASQIIESDAK |
| Ga0187777_111289362 | 3300017974 | Tropical Peatland | MTVPRLMPWIGGATRFDAEFSALVCPTDESIASHII |
| Ga0066655_104576082 | 3300018431 | Grasslands Soil | MTVPQLMPWIGGATKFEAKFSALVCPIDESIASQMIESD |
| Ga0066662_100363781 | 3300018468 | Grasslands Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVK |
| Ga0190270_108308512 | 3300018469 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDA |
| Ga0193724_10430402 | 3300020062 | Soil | MTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHM |
| Ga0210403_108239021 | 3300020580 | Soil | MTIPQLMPWIGGPVKFEADLSPLVCPIDESVASHM |
| Ga0210380_103483512 | 3300021082 | Groundwater Sediment | MTKPQLMPWIGGPVELKGDFTPLICPTDDSVASQMIES |
| Ga0210408_112417731 | 3300021178 | Soil | MTVPQLMPWIGGATKFEAQFSALVCPIDESIASQIIESDAKVID |
| Ga0213872_101107262 | 3300021361 | Rhizosphere | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDA |
| Ga0207642_100431803 | 3300025899 | Miscanthus Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVV |
| Ga0207706_115435271 | 3300025933 | Corn Rhizosphere | MTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKV |
| Ga0207651_101660611 | 3300025960 | Switchgrass Rhizosphere | MTIPQLMPWIGGPVKFEAGFSPLICPIDESVASHMIESDAK |
| Ga0207698_100782943 | 3300026142 | Corn Rhizosphere | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASQMIESDAKVVDAAVK |
| Ga0208995_10038663 | 3300027388 | Forest Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMI |
| Ga0247822_103055171 | 3300028592 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAK |
| Ga0247822_117820452 | 3300028592 | Soil | MTIPQLMPWIGGPTTHEAAFSPLICPIDESVASQMIESDAPVVDAAVEHAHA |
| Ga0247820_103943451 | 3300028597 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASQMIESDAK |
| Ga0307295_100459412 | 3300028708 | Soil | MTKPQLMPWIGGPVELKGDFTPLICPTDDSVASQMIESDAKVVDAAVK |
| Ga0307285_101156381 | 3300028712 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDAAVKHSQA |
| Ga0307297_102773931 | 3300028754 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAVKH |
| Ga0307292_104343162 | 3300028811 | Soil | MTKPQLMPWIGGPVELKGDFTPLICPTDDSVASQMIESDAKVVDAAVKHAHD |
| Ga0307302_105759401 | 3300028814 | Soil | MTIPQLMPWIGGPAKFDAGMSPLVCPTDDSVASHMIESDAKVVDA |
| Ga0247826_103450392 | 3300030336 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAFKHSHA |
| Ga0307500_100273311 | 3300031198 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAA |
| Ga0308194_102536212 | 3300031421 | Soil | MTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHMIESDAKVVD |
| Ga0170818_1108459481 | 3300031474 | Forest Soil | MTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHMIESDAKVVDA |
| Ga0318516_108890321 | 3300031543 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASHII |
| Ga0318538_102337131 | 3300031546 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVSHAHA |
| Ga0318538_106364431 | 3300031546 | Soil | MTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAAVRHA |
| Ga0318571_102110172 | 3300031549 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKH |
| Ga0318555_107511862 | 3300031640 | Soil | MTVPQLMPWIGGATKFDAPFSALVCPIDDTIASEIIESDVKVVDAAVKH |
| Ga0318542_105066582 | 3300031668 | Soil | MTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAVKHAHA |
| Ga0318561_103590301 | 3300031679 | Soil | MTIPQLMPWIGGAAKFDAPFSALVCPIDDKVESEIIESDTKVIDAAVRHAH |
| Ga0318496_103981221 | 3300031713 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVSHA |
| Ga0318493_109017592 | 3300031723 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVALQI |
| Ga0318494_108214702 | 3300031751 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHAHA |
| Ga0318554_105385741 | 3300031765 | Soil | MTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVV |
| Ga0318521_100275001 | 3300031770 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVS |
| Ga0318498_100512541 | 3300031778 | Soil | MTIPQLMPWIGGPVIFEAGLSPLVCPIDDTVASQIIESDAKVVD |
| Ga0318547_102260621 | 3300031781 | Soil | MTVPQLMPWIGGATKFDAPFSALVCPIDDTIASEIIESDVKVVDA |
| Ga0318552_107032411 | 3300031782 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESD |
| Ga0318529_100466863 | 3300031792 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVSH |
| Ga0318529_106074272 | 3300031792 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIE |
| Ga0318557_103139671 | 3300031795 | Soil | MTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESD |
| Ga0318576_103478222 | 3300031796 | Soil | MTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAAVRH |
| Ga0318550_101268491 | 3300031797 | Soil | MTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAVKHALRRS |
| Ga0318550_103407471 | 3300031797 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHA |
| Ga0318523_102697842 | 3300031798 | Soil | MTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAVKH |
| Ga0318497_102254492 | 3300031805 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQI |
| Ga0318567_101401842 | 3300031821 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAV |
| Ga0310892_101849632 | 3300031858 | Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASQMIESDAKV |
| Ga0306919_102041052 | 3300031879 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVD |
| Ga0306925_108330222 | 3300031890 | Soil | MTIPQLMPWIGGPVKFDAGLSPLVSPIDETVASQIIESDAKVVDAAVK |
| Ga0318536_100226294 | 3300031893 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKV |
| Ga0306923_116340941 | 3300031910 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAA |
| Ga0310912_101961143 | 3300031941 | Soil | MTIPQLMPWIGGAAKFDAPFSALVCPIDDKVESEIIESDAKVIDAA |
| Ga0310912_105629382 | 3300031941 | Soil | MTIPQLMPWIGGPMKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVK |
| Ga0310910_106689302 | 3300031946 | Soil | MTVPQLMPWIGGAQKFEAPLSALICPIDDSIASEIIESDAKVIDAAVKHAHT |
| Ga0318507_103694371 | 3300032025 | Soil | MTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAK |
| Ga0310911_101088033 | 3300032035 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAV |
| Ga0310911_105727831 | 3300032035 | Soil | MTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAA |
| Ga0318558_101996222 | 3300032044 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAK |
| Ga0318532_102704262 | 3300032051 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHAH |
| Ga0318506_100037821 | 3300032052 | Soil | MTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAV |
| Ga0318505_104784372 | 3300032060 | Soil | MTVPQLMPWIGGATKFDAPFSALVCPIDDTIASEIIESDVKV |
| Ga0318510_100085811 | 3300032064 | Soil | MTIPQLMPWIGGPVKFDAGLSPLVCPIDETVASQIIESDAKVVD |
| Ga0318514_107969662 | 3300032066 | Soil | MTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQII |
| Ga0318540_100244494 | 3300032094 | Soil | MTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDA |
| Ga0268251_105809872 | 3300032159 | Agave | MGVPQLMPWIGGPAQFEAAYSPLICPIDETVASQIIE |
| Ga0307470_114152282 | 3300032174 | Hardwood Forest Soil | MTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIE |
| Ga0306920_1044187831 | 3300032261 | Soil | MTKPQLMPWIGGAVQFEAALSPLICPIDDSVASHMIESD |
| Ga0364937_142010_2_106 | 3300034113 | Sediment | MTIPQLMPWIGGVTKFEADFSALVCPIDDSVASEI |
| ⦗Top⦘ |