NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060957

Metagenome / Metatranscriptome Family F060957

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060957
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 44 residues
Representative Sequence MTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVDAAV
Number of Associated Samples 123
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.67 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.727 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.303 % of family members)
Environment Ontology (ENVO) Unclassified
(36.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(34.848 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.00%    β-sheet: 0.00%    Coil/Unstructured: 96.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF09084NMT1 24.24
PF03401TctC 7.58
PF00072Response_reg 0.76
PF00196GerE 0.76
PF13378MR_MLE_C 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 24.24
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 24.24
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 7.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.73 %
UnclassifiedrootN/A2.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459012|GOYVCMS01A2IOYAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300000789|JGI1027J11758_12490005All Organisms → cellular organisms → Bacteria → Proteobacteria681Open in IMG/M
3300000890|JGI11643J12802_10849365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria797Open in IMG/M
3300001867|JGI12627J18819_10239817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300001990|JGI24737J22298_10029933All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300004629|Ga0008092_11271191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300005328|Ga0070676_10163158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1436Open in IMG/M
3300005332|Ga0066388_108667930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300005337|Ga0070682_100036861All Organisms → cellular organisms → Bacteria2990Open in IMG/M
3300005366|Ga0070659_100933729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300005454|Ga0066687_10825893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300005713|Ga0066905_102091678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300005719|Ga0068861_102704958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300005764|Ga0066903_104680220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300006047|Ga0075024_100729492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300006354|Ga0075021_10918782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300006844|Ga0075428_101586377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300006847|Ga0075431_100360758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1460Open in IMG/M
3300006847|Ga0075431_101347942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300006852|Ga0075433_11918558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300006939|Ga0081244_1514795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1362Open in IMG/M
3300009093|Ga0105240_11711354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300009100|Ga0075418_10407636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1454Open in IMG/M
3300009147|Ga0114129_13508726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300009156|Ga0111538_11009625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1053Open in IMG/M
3300009162|Ga0075423_11866202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300009168|Ga0105104_10973076Not Available501Open in IMG/M
3300010043|Ga0126380_11632903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300010048|Ga0126373_10432463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1347Open in IMG/M
3300010361|Ga0126378_12893359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300010366|Ga0126379_13612434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300010371|Ga0134125_13083179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300010403|Ga0134123_10332265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1363Open in IMG/M
3300011271|Ga0137393_10490100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1054Open in IMG/M
3300012199|Ga0137383_10953316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
3300012201|Ga0137365_10156821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.1708Open in IMG/M
3300012210|Ga0137378_11461050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300012212|Ga0150985_112925045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria889Open in IMG/M
3300012350|Ga0137372_10738988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300012360|Ga0137375_10896785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300012362|Ga0137361_11279187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria657Open in IMG/M
3300012922|Ga0137394_10766260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300012927|Ga0137416_11170661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria692Open in IMG/M
3300012955|Ga0164298_10884303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium648Open in IMG/M
3300012957|Ga0164303_10241839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1028Open in IMG/M
3300012961|Ga0164302_10457686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria888Open in IMG/M
3300012986|Ga0164304_10943229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300013308|Ga0157375_11618099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria766Open in IMG/M
3300014154|Ga0134075_10483359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300014157|Ga0134078_10672183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300014326|Ga0157380_12428199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300015264|Ga0137403_10342839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1383Open in IMG/M
3300015371|Ga0132258_13010616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1168Open in IMG/M
3300015372|Ga0132256_102329415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300016270|Ga0182036_11690783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300016371|Ga0182034_11793226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300016422|Ga0182039_10025570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603709Open in IMG/M
3300016422|Ga0182039_10050267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602833Open in IMG/M
3300016445|Ga0182038_11295633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300016445|Ga0182038_12017866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300017974|Ga0187777_11128936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300018431|Ga0066655_10457608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300018468|Ga0066662_10036378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602992Open in IMG/M
3300018469|Ga0190270_10830851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria934Open in IMG/M
3300020062|Ga0193724_1043040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria959Open in IMG/M
3300020580|Ga0210403_10823902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300021082|Ga0210380_10348351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300021178|Ga0210408_11241773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300021361|Ga0213872_10110726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1220Open in IMG/M
3300025899|Ga0207642_10043180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601986Open in IMG/M
3300025933|Ga0207706_11543527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300025960|Ga0207651_10166061All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300026142|Ga0207698_10078294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2654Open in IMG/M
3300027388|Ga0208995_1003866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2452Open in IMG/M
3300028592|Ga0247822_10305517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1217Open in IMG/M
3300028592|Ga0247822_11782045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300028597|Ga0247820_10394345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria925Open in IMG/M
3300028708|Ga0307295_10045941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1121Open in IMG/M
3300028712|Ga0307285_10115638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium717Open in IMG/M
3300028754|Ga0307297_10277393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300028811|Ga0307292_10434316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300028814|Ga0307302_10575940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300030336|Ga0247826_10345039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1083Open in IMG/M
3300031198|Ga0307500_10027331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1270Open in IMG/M
3300031421|Ga0308194_10253621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031474|Ga0170818_110845948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300031543|Ga0318516_10889032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300031546|Ga0318538_10233713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria985Open in IMG/M
3300031546|Ga0318538_10636443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300031549|Ga0318571_10211017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031640|Ga0318555_10751186Not Available527Open in IMG/M
3300031668|Ga0318542_10506658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria627Open in IMG/M
3300031679|Ga0318561_10359030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria799Open in IMG/M
3300031713|Ga0318496_10398122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300031723|Ga0318493_10901759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300031751|Ga0318494_10821470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300031765|Ga0318554_10538574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300031770|Ga0318521_10027500All Organisms → cellular organisms → Bacteria → Proteobacteria2746Open in IMG/M
3300031778|Ga0318498_10051254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601831Open in IMG/M
3300031781|Ga0318547_10226062All Organisms → cellular organisms → Bacteria → Proteobacteria1123Open in IMG/M
3300031782|Ga0318552_10703241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300031792|Ga0318529_10046686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601854Open in IMG/M
3300031792|Ga0318529_10607427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300031795|Ga0318557_10313967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria720Open in IMG/M
3300031796|Ga0318576_10347822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium701Open in IMG/M
3300031797|Ga0318550_10126849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1217Open in IMG/M
3300031797|Ga0318550_10340747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300031798|Ga0318523_10269784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300031805|Ga0318497_10225449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1037Open in IMG/M
3300031821|Ga0318567_10140184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1332Open in IMG/M
3300031858|Ga0310892_10184963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1240Open in IMG/M
3300031879|Ga0306919_10204105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1470Open in IMG/M
3300031890|Ga0306925_10833022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria954Open in IMG/M
3300031893|Ga0318536_10022629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2870Open in IMG/M
3300031910|Ga0306923_11634094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300031941|Ga0310912_10196114All Organisms → cellular organisms → Bacteria → Proteobacteria1542Open in IMG/M
3300031941|Ga0310912_10562938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300031946|Ga0310910_10668930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria822Open in IMG/M
3300032025|Ga0318507_10369437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300032035|Ga0310911_10108803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601527Open in IMG/M
3300032035|Ga0310911_10572783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300032044|Ga0318558_10199622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300032051|Ga0318532_10270426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300032052|Ga0318506_10003782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68604403Open in IMG/M
3300032060|Ga0318505_10478437Not Available588Open in IMG/M
3300032064|Ga0318510_10008581All Organisms → cellular organisms → Bacteria → Proteobacteria2894Open in IMG/M
3300032066|Ga0318514_10796966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300032094|Ga0318540_10024449All Organisms → cellular organisms → Bacteria → Proteobacteria2556Open in IMG/M
3300032159|Ga0268251_10580987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300032174|Ga0307470_11415228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300032261|Ga0306920_104418783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300034113|Ga0364937_142010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.27%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.52%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.76%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.76%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006939Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N56_003608502170459012Grass SoilMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHM
JGI1027J11758_1249000523300000789SoilMTKPQLMPWIGGAVEAKAAFSPLICPIDESIASQMIESDAEVVDRAVKHA
JGI11643J12802_1084936513300000890SoilMTIPQLMPWIGGPAKFDAGLSPLVCPIDDSVASHMID
JGI12627J18819_1023981713300001867Forest SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDQSVASHMIESDAKVVDAAVKHA
JGI24737J22298_1002993333300001990Corn RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESXAKVVDAA
Ga0008092_1127119123300004629Tropical Rainforest SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDA
Ga0070676_1016315823300005328Miscanthus RhizosphereMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVVD
Ga0066388_10866793023300005332Tropical Forest SoilMTIPQLMPWIGGPAKFDAGLSLLVCPIDESVASHMIESDAKVVDAAV
Ga0070682_10003686113300005337Corn RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDA
Ga0070659_10093372923300005366Corn RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDAAVKH
Ga0066687_1082589323300005454SoilMTIPQLMPWIGGPVKFEGGLSPLVCPTDQSVASHMIESDAKVVDAAVKHAHT
Ga0066905_10209167823300005713Tropical Forest SoilMTVAQLMPWIGGPVKFEAASSPLICPIDDTVASHI
Ga0068861_10270495813300005719Switchgrass RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDAAVKHS
Ga0066903_10468022013300005764Tropical Forest SoilMTIPQLMPWIGGPAKFDAGLSPLVCPIDESVASHMIESDAKVVDAAV
Ga0075024_10072949213300006047WatershedsMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAVKHS
Ga0075021_1091878223300006354WatershedsMTVPQLMPWIGGATKFEAKFSALVCPIDESIASQI
Ga0075428_10158637713300006844Populus RhizosphereMTVPQLMPWIGSPTAFPDAAFSPLISPVDESVVSQMIESNA
Ga0075431_10036075833300006847Populus RhizosphereMTVPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVDAAVKHAH
Ga0075431_10134794223300006847Populus RhizosphereMTVPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDA
Ga0075433_1191855823300006852Populus RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPIDDSVASHMIESDANVVDA
Ga0081244_151479523300006939Tropical Rainforest SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVDAAV
Ga0105240_1171135423300009093Corn RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDA
Ga0075418_1040763613300009100Populus RhizosphereMTVPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVD
Ga0114129_1350872613300009147Populus RhizosphereMGVPQLMPWIGGPAQFEAAYSPLICPIDETVASQIIESDAKVVD
Ga0111538_1100962523300009156Populus RhizosphereMTIPQLMPWIGGPVKFEAGFSPLVCPIDESVASHMIESDANVVDAAVK
Ga0075423_1186620223300009162Populus RhizosphereMTKPQLMPWIGGPVDAKNAKACFSPLICPIDESVASQMIESDAEMV
Ga0105104_1097307623300009168Freshwater SedimentMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVV
Ga0126380_1163290313300010043Tropical Forest SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKIID
Ga0126373_1043246313300010048Tropical Forest SoilMTIPQLMPWIGGPVKFDAGLSPLVCPIDESVASHMIESDAKVVDAAVAH
Ga0126378_1289335913300010361Tropical Forest SoilMTIPQLMPWIGGPVKFDAGLSPLVCPIDETVASQIIESDAKVVDAAVK
Ga0126379_1361243423300010366Tropical Forest SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESNA
Ga0134125_1308317923300010371Terrestrial SoilMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVVDAAVKHAH
Ga0134123_1033226513300010403Terrestrial SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIE
Ga0137393_1049010013300011271Vadose Zone SoilMTIPQLMPWIGGATKFEAGFSALVCPIDDTIASEIMESDAKVIDTAVEHAH
Ga0137383_1095331613300012199Vadose Zone SoilMTIPQLMPWIGGPVKFEADLSPLVCPIDESVASHMIESDAKVVDAAVKHAHA
Ga0137365_1015682113300012201Vadose Zone SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKV
Ga0137378_1146105023300012210Vadose Zone SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKIVDA
Ga0150985_11292504513300012212Avena Fatua RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAVKHSHAA
Ga0137372_1073898823300012350Vadose Zone SoilMTIPQLMPWIGGPTTYEAAFSPLVCPIDESVASHMIESDAKVVDAAVKHA
Ga0137375_1089678513300012360Vadose Zone SoilMTIPQLMPWIGGPVKFEAGFSPIVCPIDESVASHMIESDAKVVDAAVKH
Ga0137361_1127918723300012362Vadose Zone SoilMTVPQLMPWIGGPVKFEADLSPLVCPIDETVASQIIESDA
Ga0137394_1076626023300012922Vadose Zone SoilMTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHMIESDAKVVDAAV
Ga0137416_1117066123300012927Vadose Zone SoilMTVPQLMPWIGGATKFEAQFSALVCPIDESIASQIIESDAKVI
Ga0164298_1088430323300012955SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASYMIESDAKVVDAAV
Ga0164303_1024183913300012957SoilMTIPQLMPWIGGPAKFDAGLSPRVCPIDDSVASHMIESDANVVDAAVEHA
Ga0164302_1045768613300012961SoilMTRVEKGAPMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVV
Ga0164304_1094322923300012986SoilMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKVVDAAV
Ga0157375_1161809923300013308Miscanthus RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPIDDSVASHMIESDANVVDAAVE
Ga0134075_1048335913300014154Grasslands SoilMSIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIESDAKVVD
Ga0134078_1067218323300014157Grasslands SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVASHMIES
Ga0157380_1242819913300014326Switchgrass RhizosphereMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIE
Ga0137403_1034283913300015264Vadose Zone SoilMTKPQLMPWIGGPVEFKANFSPLICPIDESVASQMIESDAKVVDAAVK
Ga0132258_1301061623300015371Arabidopsis RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESD
Ga0132256_10232941523300015372Arabidopsis RhizosphereMTIPQLMPWIGGPVKFEAGLSALVCPIDETVASQIIESDAKVV
Ga0182036_1169078323300016270SoilMTIPQLMPWIGGPMKFEAGLSPLVCPIDETVASQIIESDAKVVDA
Ga0182034_1179322623300016371SoilMTIPQLMPWIGGAAKFDAPFSALVCPIDDKVESEIIESDAKVIDAAVRHA
Ga0182039_1002557013300016422SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAA
Ga0182039_1005026743300016422SoilMTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAAV
Ga0182038_1129563323300016445SoilMTISQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHAH
Ga0182038_1201786623300016445SoilMTIPQLMPWIGGPMKFEAGLSPLVCPIDETVASQIIESDAK
Ga0187777_1112893623300017974Tropical PeatlandMTVPRLMPWIGGATRFDAEFSALVCPTDESIASHII
Ga0066655_1045760823300018431Grasslands SoilMTVPQLMPWIGGATKFEAKFSALVCPIDESIASQMIESD
Ga0066662_1003637813300018468Grasslands SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVK
Ga0190270_1083085123300018469SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDA
Ga0193724_104304023300020062SoilMTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHM
Ga0210403_1082390213300020580SoilMTIPQLMPWIGGPVKFEADLSPLVCPIDESVASHM
Ga0210380_1034835123300021082Groundwater SedimentMTKPQLMPWIGGPVELKGDFTPLICPTDDSVASQMIES
Ga0210408_1124177313300021178SoilMTVPQLMPWIGGATKFEAQFSALVCPIDESIASQIIESDAKVID
Ga0213872_1011072623300021361RhizosphereMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDA
Ga0207642_1004318033300025899Miscanthus RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVV
Ga0207706_1154352713300025933Corn RhizosphereMTIPQLMPWIGGPAKFEAGLSPLVCPTDESVASHMIESDAKV
Ga0207651_1016606113300025960Switchgrass RhizosphereMTIPQLMPWIGGPVKFEAGFSPLICPIDESVASHMIESDAK
Ga0207698_1007829433300026142Corn RhizosphereMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASQMIESDAKVVDAAVK
Ga0208995_100386633300027388Forest SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMI
Ga0247822_1030551713300028592SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAK
Ga0247822_1178204523300028592SoilMTIPQLMPWIGGPTTHEAAFSPLICPIDESVASQMIESDAPVVDAAVEHAHA
Ga0247820_1039434513300028597SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASQMIESDAK
Ga0307295_1004594123300028708SoilMTKPQLMPWIGGPVELKGDFTPLICPTDDSVASQMIESDAKVVDAAVK
Ga0307285_1011563813300028712SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIESDAKVVDAAVKHSQA
Ga0307297_1027739313300028754SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAVKH
Ga0307292_1043431623300028811SoilMTKPQLMPWIGGPVELKGDFTPLICPTDDSVASQMIESDAKVVDAAVKHAHD
Ga0307302_1057594013300028814SoilMTIPQLMPWIGGPAKFDAGMSPLVCPTDDSVASHMIESDAKVVDA
Ga0247826_1034503923300030336SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAAFKHSHA
Ga0307500_1002733113300031198SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDDSVASHMIESDAKVVDAA
Ga0308194_1025362123300031421SoilMTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHMIESDAKVVD
Ga0170818_11084594813300031474Forest SoilMTIPQLMPWIGGPAKFDAQLSPLVCPTDDSVASHMIESDAKVVDA
Ga0318516_1088903213300031543SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASHII
Ga0318538_1023371313300031546SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVSHAHA
Ga0318538_1063644313300031546SoilMTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAAVRHA
Ga0318571_1021101723300031549SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKH
Ga0318555_1075118623300031640SoilMTVPQLMPWIGGATKFDAPFSALVCPIDDTIASEIIESDVKVVDAAVKH
Ga0318542_1050665823300031668SoilMTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAVKHAHA
Ga0318561_1035903013300031679SoilMTIPQLMPWIGGAAKFDAPFSALVCPIDDKVESEIIESDTKVIDAAVRHAH
Ga0318496_1039812213300031713SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVSHA
Ga0318493_1090175923300031723SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVALQI
Ga0318494_1082147023300031751SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHAHA
Ga0318554_1053857413300031765SoilMTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVV
Ga0318521_1002750013300031770SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVS
Ga0318498_1005125413300031778SoilMTIPQLMPWIGGPVIFEAGLSPLVCPIDDTVASQIIESDAKVVD
Ga0318547_1022606213300031781SoilMTVPQLMPWIGGATKFDAPFSALVCPIDDTIASEIIESDVKVVDA
Ga0318552_1070324113300031782SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESD
Ga0318529_1004668633300031792SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAVSH
Ga0318529_1060742723300031792SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIE
Ga0318557_1031396713300031795SoilMTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESD
Ga0318576_1034782223300031796SoilMTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAAVRH
Ga0318550_1012684913300031797SoilMTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAVKHALRRS
Ga0318550_1034074713300031797SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHA
Ga0318523_1026978423300031798SoilMTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAVKH
Ga0318497_1022544923300031805SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQI
Ga0318567_1014018423300031821SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDESVTSHMIESDAKVVDAAV
Ga0310892_1018496323300031858SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASQMIESDAKV
Ga0306919_1020410523300031879SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVD
Ga0306925_1083302223300031890SoilMTIPQLMPWIGGPVKFDAGLSPLVSPIDETVASQIIESDAKVVDAAVK
Ga0318536_1002262943300031893SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKV
Ga0306923_1163409413300031910SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAA
Ga0310912_1019611433300031941SoilMTIPQLMPWIGGAAKFDAPFSALVCPIDDKVESEIIESDAKVIDAA
Ga0310912_1056293823300031941SoilMTIPQLMPWIGGPMKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVK
Ga0310910_1066893023300031946SoilMTVPQLMPWIGGAQKFEAPLSALICPIDDSIASEIIESDAKVIDAAVKHAHT
Ga0318507_1036943713300032025SoilMTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAK
Ga0310911_1010880333300032035SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAV
Ga0310911_1057278313300032035SoilMTIPQLMPWIGGATKFDAQFSALVCPIDDKIESEIIESDAKVIDAA
Ga0318558_1019962223300032044SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAK
Ga0318532_1027042623300032051SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQIIESDAKVVDAAVKHAH
Ga0318506_1000378213300032052SoilMTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDAAV
Ga0318505_1047843723300032060SoilMTVPQLMPWIGGATKFDAPFSALVCPIDDTIASEIIESDVKV
Ga0318510_1000858113300032064SoilMTIPQLMPWIGGPVKFDAGLSPLVCPIDETVASQIIESDAKVVD
Ga0318514_1079696623300032066SoilMTIPQLMPWIGGPVKFEAGLSPLVCPIDETVASQII
Ga0318540_1002444943300032094SoilMTVPQLMPWIGGPVKFEADFSPLICPIDDSVASQMIESDAAVVDA
Ga0268251_1058098723300032159AgaveMGVPQLMPWIGGPAQFEAAYSPLICPIDETVASQIIE
Ga0307470_1141522823300032174Hardwood Forest SoilMTIPQLMPWIGGPAKFDAGLSPLVCPTDESVASHMIE
Ga0306920_10441878313300032261SoilMTKPQLMPWIGGAVQFEAALSPLICPIDDSVASHMIESD
Ga0364937_142010_2_1063300034113SedimentMTIPQLMPWIGGVTKFEADFSALVCPIDDSVASEI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.