Basic Information | |
---|---|
Family ID | F060895 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 46 residues |
Representative Sequence | MNTELERIVRAAGAPEEAMTELWFVVFCQQFADLLIAEMEGTDTQP |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 50.00 % |
% of genes near scaffold ends (potentially truncated) | 17.42 % |
% of genes from short scaffolds (< 2000 bps) | 78.79 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.818 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.212 % of family members) |
Environment Ontology (ENVO) | Unclassified (64.394 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF00487 | FA_desaturase | 6.82 |
PF02310 | B12-binding | 6.82 |
PF04055 | Radical_SAM | 5.30 |
PF13392 | HNH_3 | 3.79 |
PF03401 | TctC | 1.52 |
PF02668 | TauD | 1.52 |
PF02585 | PIG-L | 0.76 |
PF13609 | Porin_4 | 0.76 |
PF13671 | AAA_33 | 0.76 |
PF03104 | DNA_pol_B_exo1 | 0.76 |
PF00149 | Metallophos | 0.76 |
PF00581 | Rhodanese | 0.76 |
PF13640 | 2OG-FeII_Oxy_3 | 0.76 |
PF00155 | Aminotran_1_2 | 0.76 |
PF03480 | DctP | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 6.82 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 6.82 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.52 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.52 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.76 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.82 % |
All Organisms | root | All Organisms | 43.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02J69Q2 | Not Available | 510 | Open in IMG/M |
3300000756|JGI12421J11937_10145002 | Not Available | 593 | Open in IMG/M |
3300002408|B570J29032_109221209 | Not Available | 641 | Open in IMG/M |
3300003388|JGI25910J50241_10169403 | Not Available | 561 | Open in IMG/M |
3300004112|Ga0065166_10101083 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
3300004112|Ga0065166_10467610 | Not Available | 532 | Open in IMG/M |
3300005525|Ga0068877_10381094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 799 | Open in IMG/M |
3300005525|Ga0068877_10717455 | Not Available | 534 | Open in IMG/M |
3300005527|Ga0068876_10000023 | Not Available | 109033 | Open in IMG/M |
3300005527|Ga0068876_10004845 | Not Available | 9387 | Open in IMG/M |
3300005581|Ga0049081_10018881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2616 | Open in IMG/M |
3300005582|Ga0049080_10079896 | Not Available | 1119 | Open in IMG/M |
3300005582|Ga0049080_10224286 | Not Available | 617 | Open in IMG/M |
3300005662|Ga0078894_10349042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1340 | Open in IMG/M |
3300005662|Ga0078894_10488670 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
3300005662|Ga0078894_10971596 | Not Available | 732 | Open in IMG/M |
3300005662|Ga0078894_10973612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 732 | Open in IMG/M |
3300006484|Ga0070744_10155346 | Not Available | 656 | Open in IMG/M |
3300006805|Ga0075464_10514851 | Not Available | 733 | Open in IMG/M |
3300007544|Ga0102861_1009610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2296 | Open in IMG/M |
3300007562|Ga0102915_1255992 | Not Available | 566 | Open in IMG/M |
3300007597|Ga0102919_1077297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300007634|Ga0102901_1100325 | Not Available | 828 | Open in IMG/M |
3300007639|Ga0102865_1198908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300007992|Ga0105748_10304972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300008055|Ga0108970_11271498 | Not Available | 525 | Open in IMG/M |
3300008107|Ga0114340_1079856 | Not Available | 1354 | Open in IMG/M |
3300008113|Ga0114346_1007307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7124 | Open in IMG/M |
3300008113|Ga0114346_1065629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 1756 | Open in IMG/M |
3300008113|Ga0114346_1317523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300008116|Ga0114350_1006344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9770 | Open in IMG/M |
3300008267|Ga0114364_1017024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3114 | Open in IMG/M |
3300008267|Ga0114364_1022149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2620 | Open in IMG/M |
3300008267|Ga0114364_1037577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
3300008267|Ga0114364_1083750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 1036 | Open in IMG/M |
3300008267|Ga0114364_1177191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300008962|Ga0104242_1029036 | Not Available | 948 | Open in IMG/M |
3300008996|Ga0102831_1237452 | Not Available | 602 | Open in IMG/M |
3300008996|Ga0102831_1292677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300009056|Ga0102860_1028847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
3300009059|Ga0102830_1221057 | Not Available | 553 | Open in IMG/M |
3300009068|Ga0114973_10109104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
3300009151|Ga0114962_10015808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5424 | Open in IMG/M |
3300009155|Ga0114968_10114081 | Not Available | 1637 | Open in IMG/M |
3300009158|Ga0114977_10340066 | Not Available | 847 | Open in IMG/M |
3300009159|Ga0114978_10003267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13323 | Open in IMG/M |
3300009159|Ga0114978_10381614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300009159|Ga0114978_10386152 | Not Available | 841 | Open in IMG/M |
3300009161|Ga0114966_10233568 | Not Available | 1145 | Open in IMG/M |
3300009181|Ga0114969_10738117 | Not Available | 527 | Open in IMG/M |
3300009183|Ga0114974_10097332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
3300009185|Ga0114971_10207946 | Not Available | 1158 | Open in IMG/M |
3300010160|Ga0114967_10159767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
3300010312|Ga0102883_1171076 | Not Available | 618 | Open in IMG/M |
3300010354|Ga0129333_10502583 | Not Available | 1062 | Open in IMG/M |
3300011010|Ga0139557_1017292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
3300011010|Ga0139557_1055614 | Not Available | 669 | Open in IMG/M |
3300011336|Ga0153703_1114 | Not Available | 29369 | Open in IMG/M |
3300013372|Ga0177922_10151085 | Not Available | 734 | Open in IMG/M |
3300014819|Ga0119954_1000854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10531 | Open in IMG/M |
3300016791|Ga0182095_1203696 | Not Available | 625 | Open in IMG/M |
3300016797|Ga0182090_1014258 | Not Available | 646 | Open in IMG/M |
3300017722|Ga0181347_1165868 | Not Available | 596 | Open in IMG/M |
3300017747|Ga0181352_1168827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300017754|Ga0181344_1056785 | Not Available | 1162 | Open in IMG/M |
3300017754|Ga0181344_1175391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300017754|Ga0181344_1224117 | Not Available | 524 | Open in IMG/M |
3300017766|Ga0181343_1006936 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
3300017766|Ga0181343_1053184 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300017766|Ga0181343_1204542 | Not Available | 540 | Open in IMG/M |
3300017778|Ga0181349_1020701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2688 | Open in IMG/M |
3300017778|Ga0181349_1258730 | Not Available | 578 | Open in IMG/M |
3300017780|Ga0181346_1099668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
3300019784|Ga0181359_1020699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2490 | Open in IMG/M |
3300020141|Ga0211732_1383649 | Not Available | 969 | Open in IMG/M |
3300020151|Ga0211736_10271888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1651 | Open in IMG/M |
3300020159|Ga0211734_10768918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7616 | Open in IMG/M |
3300020159|Ga0211734_10769174 | Not Available | 859 | Open in IMG/M |
3300020159|Ga0211734_10781625 | Not Available | 508 | Open in IMG/M |
3300020160|Ga0211733_10369634 | Not Available | 3385 | Open in IMG/M |
3300020160|Ga0211733_10470477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 2074 | Open in IMG/M |
3300020161|Ga0211726_10265067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4341 | Open in IMG/M |
3300020161|Ga0211726_10634499 | Not Available | 663 | Open in IMG/M |
3300020161|Ga0211726_11078861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1167 | Open in IMG/M |
3300020162|Ga0211735_11488944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2058 | Open in IMG/M |
3300020172|Ga0211729_10196831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 577 | Open in IMG/M |
3300020172|Ga0211729_10357512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 1169 | Open in IMG/M |
3300020172|Ga0211729_11254212 | Not Available | 534 | Open in IMG/M |
3300020205|Ga0211731_10558605 | Not Available | 510 | Open in IMG/M |
3300020527|Ga0208232_1005885 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
3300020571|Ga0208723_1018709 | Not Available | 1093 | Open in IMG/M |
3300021519|Ga0194048_10043191 | Not Available | 1845 | Open in IMG/M |
3300021519|Ga0194048_10097420 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
3300021961|Ga0222714_10641068 | Not Available | 525 | Open in IMG/M |
3300021962|Ga0222713_10441616 | Not Available | 791 | Open in IMG/M |
3300021963|Ga0222712_10673579 | Not Available | 587 | Open in IMG/M |
3300022407|Ga0181351_1007550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4295 | Open in IMG/M |
3300022407|Ga0181351_1225507 | Not Available | 604 | Open in IMG/M |
3300022752|Ga0214917_10289457 | Not Available | 736 | Open in IMG/M |
3300023174|Ga0214921_10020363 | Not Available | 7110 | Open in IMG/M |
3300023174|Ga0214921_10134104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1735 | Open in IMG/M |
3300023174|Ga0214921_10151506 | Not Available | 1571 | Open in IMG/M |
3300023174|Ga0214921_10178922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
3300023174|Ga0214921_10201760 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1241 | Open in IMG/M |
3300023184|Ga0214919_10046036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4245 | Open in IMG/M |
3300024346|Ga0244775_10132830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2106 | Open in IMG/M |
3300024346|Ga0244775_10170594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1832 | Open in IMG/M |
3300024346|Ga0244775_10635655 | Not Available | 864 | Open in IMG/M |
3300024348|Ga0244776_10747481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 598 | Open in IMG/M |
3300027205|Ga0208926_1025407 | Not Available | 891 | Open in IMG/M |
3300027529|Ga0255077_1040818 | Not Available | 858 | Open in IMG/M |
3300027608|Ga0208974_1051013 | Not Available | 1189 | Open in IMG/M |
3300027608|Ga0208974_1078594 | Not Available | 905 | Open in IMG/M |
3300027621|Ga0208951_1078830 | Not Available | 922 | Open in IMG/M |
3300027697|Ga0209033_1049072 | Not Available | 1526 | Open in IMG/M |
3300027736|Ga0209190_1005545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8052 | Open in IMG/M |
3300027746|Ga0209597_1281179 | Not Available | 645 | Open in IMG/M |
3300027749|Ga0209084_1000186 | Not Available | 60159 | Open in IMG/M |
3300027759|Ga0209296_1237906 | Not Available | 756 | Open in IMG/M |
3300027769|Ga0209770_10270007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300027782|Ga0209500_10060975 | Not Available | 1976 | Open in IMG/M |
3300027793|Ga0209972_10184398 | Not Available | 977 | Open in IMG/M |
3300027797|Ga0209107_10330306 | Not Available | 710 | Open in IMG/M |
3300027797|Ga0209107_10436601 | Not Available | 591 | Open in IMG/M |
3300031951|Ga0315904_10749506 | Not Available | 812 | Open in IMG/M |
3300033992|Ga0334992_0048269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 2437 | Open in IMG/M |
3300033994|Ga0334996_0201173 | Not Available | 1064 | Open in IMG/M |
3300034060|Ga0334983_0770904 | Not Available | 505 | Open in IMG/M |
3300034102|Ga0335029_0376470 | Not Available | 866 | Open in IMG/M |
3300034103|Ga0335030_0132424 | Not Available | 1791 | Open in IMG/M |
3300034104|Ga0335031_0784994 | Not Available | 535 | Open in IMG/M |
3300034280|Ga0334997_0307916 | Not Available | 1021 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.64% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.61% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.09% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.58% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.55% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.03% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.27% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.52% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.52% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.52% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.76% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.76% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.76% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.76% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_2588610 | 2035265000 | Freshwater | MNTELERIVRAAGAPEEVMGQLWFAVFCQQFAHLLIAELETEIVDTK |
JGI12421J11937_101450022 | 3300000756 | Freshwater And Sediment | MNTELERIVRAAGAPEQAMAELWFVVFCQQFANLLIQELEADSVNTKL* |
B570J29032_1092212091 | 3300002408 | Freshwater | MNTELERIVRAAGAPEQAMAELWFVVFCQQFADLLIAEMEGTDSQS* |
JGI25910J50241_101694031 | 3300003388 | Freshwater Lake | MNTELERLARAAGAPEEIMTELWFAIFCQQFAHLLIQELEVDSVDTK* |
Ga0065166_101010832 | 3300004112 | Freshwater Lake | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFAHLLIAEMEGTDSRP* |
Ga0065166_104676102 | 3300004112 | Freshwater Lake | VAMNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIQEMEGPDSQP* |
Ga0068877_103810942 | 3300005525 | Freshwater Lake | FQAMNTELERLVRAAGAPEEAMDQLWFAIFCQQFADLLITEMEMDQEADLLQVDA* |
Ga0068877_107174551 | 3300005525 | Freshwater Lake | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGT |
Ga0068876_1000002310 | 3300005527 | Freshwater Lake | MNTELERLVRAAGAPEEAMDQLWFAIFCQQFADLLITEMEMDQEADLLQVDA* |
Ga0068876_100048451 | 3300005527 | Freshwater Lake | MNTELERIVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEGTDTQP* |
Ga0049081_100188811 | 3300005581 | Freshwater Lentic | RAAGAPEEVMTELWFSVFCQQFADLLIAEMEGTNSQP* |
Ga0049080_100798962 | 3300005582 | Freshwater Lentic | VNTELERIVRAAGAPEEVMTELWFSVFCQQFADLLIAEMEGTNSQP* |
Ga0049080_102242862 | 3300005582 | Freshwater Lentic | MNTELERLARAAGAPEEIMTELWFVVFCQQFADLLISEMEADSVDTK* |
Ga0078894_103490425 | 3300005662 | Freshwater Lake | VNAELERLVRAAGAPEEVMTELWFAVFCKQFAHLLIQEMEG* |
Ga0078894_104886705 | 3300005662 | Freshwater Lake | MNTELERIVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEG* |
Ga0078894_109715962 | 3300005662 | Freshwater Lake | MNTELERIVRAAGAPEEAMTELWFVVFCQQFADLLIAEMEGPDSRP* |
Ga0078894_109736122 | 3300005662 | Freshwater Lake | MNTELERIVRAAGAPEEVMDQLWFAVFCQQFADLLISEMEIDQEDDLRQVDA* |
Ga0070744_101553461 | 3300006484 | Estuarine | MNTELERIMRAAGAPEEVMTELWFVVFCQQFADLLISEMEG* |
Ga0075464_105148512 | 3300006805 | Aqueous | MNTELERIVRAAGAPEEVMDQLWFAVFCQQFAHLLISEIEGTDSQP* |
Ga0102861_10096108 | 3300007544 | Estuarine | MNAELERIVRAAGAPDEAMEQLWFVVFCQQFADLLIAEMEG* |
Ga0102915_12559921 | 3300007562 | Estuarine | MNAELERLVREAGAPEEVMDQLWFVVFCQQFADLLISEIEGTDPQS* |
Ga0102919_10772976 | 3300007597 | Estuarine | AMNTELERIMRAAGAPEEVMTELWFVVFCQQFADLLISEMEG* |
Ga0102901_11003252 | 3300007634 | Estuarine | VNTELERLVRAAGAPEEVMTELWFAIFCQQFADLLIAEMEG* |
Ga0102865_11989081 | 3300007639 | Estuarine | NAELERIVRAAGAPDEAMEQLWFVVFCQQFADLLIAEMEG* |
Ga0105748_103049722 | 3300007992 | Estuary Water | MNTELERIVRAAGAPEEVMDQLWFVVFCQQFADLLIAEMEG* |
Ga0108970_112714983 | 3300008055 | Estuary | MNTELERIVRAAGAPEEAMAELWFVVFCQQFADLLIAEIEMDQEA |
Ga0114340_10798566 | 3300008107 | Freshwater, Plankton | MNTELERIVRAAGAPEQAMAELWFVVFCQQFADLLIAEMEGTDTQP* |
Ga0114346_100730711 | 3300008113 | Freshwater, Plankton | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGPDSRP* |
Ga0114346_10656292 | 3300008113 | Freshwater, Plankton | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEMDQEADLLQVDA* |
Ga0114346_13175232 | 3300008113 | Freshwater, Plankton | MAMNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIQELEG* |
Ga0114350_10063446 | 3300008116 | Freshwater, Plankton | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGTDTQP* |
Ga0114364_10170244 | 3300008267 | Freshwater, Plankton | MNTELERLARAAGAPEEAMTELWFVVFCQQFADLLIQELEGTDTQP* |
Ga0114364_10221496 | 3300008267 | Freshwater, Plankton | VNAELERLVRAAGAPEEVMTELWFVVFCQQFADLLIAELEG* |
Ga0114364_10375776 | 3300008267 | Freshwater, Plankton | MNTELERIVRAAGAPEEAMTELWFSVFCQQFADLLIAEMEG* |
Ga0114364_10837501 | 3300008267 | Freshwater, Plankton | MNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIAEMEMDQEADLLQVDA* |
Ga0114364_11771911 | 3300008267 | Freshwater, Plankton | MNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIQELEG* |
Ga0104242_10290363 | 3300008962 | Freshwater | MNTELERIVRAAGAPEEAMAELWFVVFCQQFADLLISEMEIDQEDDLRQVDA* |
Ga0102831_12374522 | 3300008996 | Estuarine | MNTELERLVRAAGAPEEVMDQLWFVVFCQQFADLLISEIEGTDPQS* |
Ga0102831_12926771 | 3300008996 | Estuarine | MAMNTELERIVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEG* |
Ga0102860_10288475 | 3300009056 | Estuarine | MNTELERIVRAAGAPDEAMEQLWFVVFCQQFADLLIAEMEG* |
Ga0102830_12210572 | 3300009059 | Estuarine | MNTELERLVRAAGAPEEVMTELWFAIFCQQFADLLIAEMEG* |
Ga0114973_101091043 | 3300009068 | Freshwater Lake | MNAELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGPDSRP* |
Ga0114962_100158084 | 3300009151 | Freshwater Lake | MNTELERIVRAAGAPDEAMDQLWFVVFCQQFADLLIQELEADSVDTK* |
Ga0114968_101140814 | 3300009155 | Freshwater Lake | MNTELERIVRASGAPEEAMNQLWFVVFCQQFADLLIAELEAEIVDTK* |
Ga0114977_103400661 | 3300009158 | Freshwater Lake | VNAELDRLVRAAGAPEEVMTELWFVVFCQQFADLLISEMEADSVDTK* |
Ga0114978_100032674 | 3300009159 | Freshwater Lake | VNAELERLVRAAGAPEEAMAELWFVVFCQQFADLLISEMEGSDSRP* |
Ga0114978_103816141 | 3300009159 | Freshwater Lake | VNTELERIVRASGAPEEAMAELWFVVFCQQFADLLIAEMEADSVDTK* |
Ga0114978_103861522 | 3300009159 | Freshwater Lake | MNTELERLVRAAGAPEEAMAELWFVVFCQQFADLLIAEMEANSVDT |
Ga0114966_102335684 | 3300009161 | Freshwater Lake | VNAELERIVRAAGAPEEVMTELWFAVFCQQFAHLLITELEAEIVDTK* |
Ga0114969_107381172 | 3300009181 | Freshwater Lake | MNAELERIVRAAGAPEQAMDQLWFVVFCQQFADLLITEMEGTDSQP* |
Ga0114974_100973322 | 3300009183 | Freshwater Lake | MNTELERIVRAAGAPEEAMDELWFVVFCQQFADLLIAEMEGPDSRP* |
Ga0114971_102079461 | 3300009185 | Freshwater Lake | VNTELERLVRAAGAPEEVMTELWFAVFCQQFAHLLITELEAEIV |
Ga0114967_101597675 | 3300010160 | Freshwater Lake | MNTELERIVRASGAPEEAMNQLWFVVFCQQFADLLIAELE |
Ga0102883_11710763 | 3300010312 | Estuarine | MNTELERIVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEGPDRRP* |
Ga0129333_105025833 | 3300010354 | Freshwater To Marine Saline Gradient | MNTELERIVRAAGAPEEAMDQLWFVVFCQQFAHLLIAEMEMDQEADLLQVDA* |
Ga0139557_10172923 | 3300011010 | Freshwater | MNTELERLARAAGAPEEIMTELWFAIFCQQFAHLLIQELEG* |
Ga0139557_10556141 | 3300011010 | Freshwater | MNTELERIVRAAGAPEQAMAELWFVVFCQQFAQLLIAEMEMD |
Ga0153703_11148 | 3300011336 | Freshwater | MNAELERLVRAAGAPEEVMTELWFAIFCQQFADLLIAEMEG* |
Ga0177922_101510852 | 3300013372 | Freshwater | MNTELERIVRAAGAPEEVMTELWFSVFCQQFADLLIAEMEGTNSQP* |
Ga0119954_10008549 | 3300014819 | Freshwater | MNAELERIVRAAGAPEQAMDQLWFVVFCQQFANLLIQELEADSVDTK* |
Ga0182095_12036962 | 3300016791 | Salt Marsh | MNTELERIVRAAGAPEEAMDQLWFMVFCQQFADLLIRELEGTDSQP |
Ga0182090_10142581 | 3300016797 | Salt Marsh | MNTELERIVRAAGAPEEAMDQLWFVVFCQQFADLLIRELEGTDSQP |
Ga0181347_11658683 | 3300017722 | Freshwater Lake | MNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLL |
Ga0181352_11688271 | 3300017747 | Freshwater Lake | LERIVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEGXQTLRIFV |
Ga0181344_10567851 | 3300017754 | Freshwater Lake | MNTELERIVRAAGAPEEAMDQLWFVVFCQQFAHLLIS |
Ga0181344_11753913 | 3300017754 | Freshwater Lake | ELESIVRAAGAPEEAMDQLWFVVFCQQFADLLIQELEGXQTLGKII |
Ga0181344_12241172 | 3300017754 | Freshwater Lake | ERIVRAAGAPEQAMTELWFVVFCQQFAHLLIAEMEGADPSHK |
Ga0181343_10069364 | 3300017766 | Freshwater Lake | MNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIAEIEMDQEADLLQVDA |
Ga0181343_10531842 | 3300017766 | Freshwater Lake | AGAPEEVMTELWFVVFCQQFADLLIAEMEGTDTQP |
Ga0181343_12045421 | 3300017766 | Freshwater Lake | MNTELERIVRAAGAPEEAMDQLWFAIFCQQFADLLIQELEANSVDTK |
Ga0181349_10207011 | 3300017778 | Freshwater Lake | MNTELERLVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEGTNSQP |
Ga0181349_12587303 | 3300017778 | Freshwater Lake | MNTELERIVRAAGAPEEAMTELWFVVFCQQFADLLISEMEADSV |
Ga0181346_10996686 | 3300017780 | Freshwater Lake | TELERIVRAAGAPEEIMTELWFAIFCQQFADLLISEMEGXQTLRIFV |
Ga0181359_10206992 | 3300019784 | Freshwater Lake | MNTELERLARAAGAPEEAMTELWFVVFCQQFADLLIQELEGTDTQP |
Ga0211732_13836492 | 3300020141 | Freshwater | MNTELERLVRAAGAPEEVMTELWFVVFCQQFAHLLITEMEIDQEADLLQVDA |
Ga0211736_102718885 | 3300020151 | Freshwater | MNTELERLVRAAGAPEEVMTELWFVVFCQQFADLLITKMEGTDPQP |
Ga0211734_107689182 | 3300020159 | Freshwater | MNAELERIVRAAGAPEEAMDQLWFVVFCQQFAHLLIAELETEIVDTK |
Ga0211734_107691742 | 3300020159 | Freshwater | MNTELERLARSAGAPEEIMDQLWFAVFCQQFAHLLIAEMEGTDPSHK |
Ga0211734_107816252 | 3300020159 | Freshwater | MNTELERIVRAAGAPEEVMTELWFAVFCQQFAHLLIAELEAEIVDTK |
Ga0211733_103696341 | 3300020160 | Freshwater | MNTELECLVRAAGAPEEVMTELWFAIFCQQFAHLLITEMEGTDTQP |
Ga0211733_104704773 | 3300020160 | Freshwater | MNTELERLVRAAGAPEEVMTELWFAIFCQQFAHLLIIEMEMDQEADPLQVDA |
Ga0211726_102650672 | 3300020161 | Freshwater | MNTELERLVRAAGAPEEVMTELWFAIFCQQFAHLLITTMEMDQEADLLQVDA |
Ga0211726_106344991 | 3300020161 | Freshwater | MNTELERIVRAAGAPEEVMTELWFVVFCQQFAHLLIAEMEG |
Ga0211726_110788611 | 3300020161 | Freshwater | MNTELERIVRAAGAPEEIMDQLWFAVFCQQFAHLLIAEMEGTDPSHK |
Ga0211735_114889442 | 3300020162 | Freshwater | MNTELERLVRAAGAPEEVMTELWFAIFCQQFAHLLITEMEGTDTQP |
Ga0211729_101968312 | 3300020172 | Freshwater | MNTELERLVRAAGAPEEVMTELWFVVFCQQFAHLLIAEMEMDQEAGLLQVDA |
Ga0211729_103575122 | 3300020172 | Freshwater | MNIELERLVRAAGAPEEVMTELWFAIFCQQFAHLLIIEMEMDQEADPLQVDA |
Ga0211729_112542122 | 3300020172 | Freshwater | MNTELERIVRAAGAPEEIMSQLWFAVFCQQFAHLLIAELETEIVDTK |
Ga0211731_105586052 | 3300020205 | Freshwater | MNTELERIVRAAGAPEEIMTELWFVVFCQQFADLLIAELETEIVDTK |
Ga0208232_10058854 | 3300020527 | Freshwater | MNTELERIVRAAGAPEEAMAELWFVVFCQQFADLLIAEMEMDQEADLLQVDA |
Ga0208723_10187094 | 3300020571 | Freshwater | MNTELERIVRAAGAPEQAMTELWFVVFCQQFADLLISEMEMDQEADLLQVDA |
Ga0194048_100431914 | 3300021519 | Anoxic Zone Freshwater | VNAELERIVRAAGAPEEVMTELWFAVFCQQFAHLLITELEAEIVDTK |
Ga0194048_100974202 | 3300021519 | Anoxic Zone Freshwater | MNTELERIVRAAGAPEEAMTELWFVVFCQQFADLLIAEMEGTDTQP |
Ga0222714_106410681 | 3300021961 | Estuarine Water | VIVNAELERLVRAAGAPEEVMTELWFAVFCQQFAHLLITEMEGTDSQS |
Ga0222713_104416161 | 3300021962 | Estuarine Water | VNTELERLVRAAGAPEEVMDQLWFAVFCQQFAHLLITEMEGTDSQS |
Ga0222712_106735792 | 3300021963 | Estuarine Water | MNTELERIVRAAGAPEEAMDQLWFVVFCQQFADLLIAEMEGPDSRP |
Ga0181351_10075501 | 3300022407 | Freshwater Lake | VNTELERLARAAGAPEEIMTELWFAIFCQQFAHLLIQELEVDSVDTK |
Ga0181351_12255073 | 3300022407 | Freshwater Lake | MNTELERIVRAAGAPEEIMTELWFAIFCQQFADLLISEMEG |
Ga0214917_102894572 | 3300022752 | Freshwater | MNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIQEMEG |
Ga0214921_100203639 | 3300023174 | Freshwater | MNTELERIVRAAGAPEEAMAELWFVVFCQQFADLLISEMEIDQEDDLRQVDA |
Ga0214921_101341044 | 3300023174 | Freshwater | MNAELERIVRAAGAPEEAMTELWFVVFCQQFADLLITELEAEIVDTK |
Ga0214921_101515064 | 3300023174 | Freshwater | MNAELERIVRAAGAPEQAMDQLWFVVFCQQFANLLIQELEADSVDTK |
Ga0214921_101789223 | 3300023174 | Freshwater | MNTELERIVRAAGAPEEVMTELWFVIFCQQFADLLIAEMEG |
Ga0214921_102017604 | 3300023174 | Freshwater | MNTELERIVRASGAPEEAMNQLWFVVFCQQFADLLITELEAEIVDTK |
Ga0214919_100460366 | 3300023184 | Freshwater | MNTELERIVRAAGAPEEAMAELWFVVFCQQFADLLISEMEGASSQS |
Ga0244775_101328302 | 3300024346 | Estuarine | MNTELERLVRAAGAPEEVMTELWFAIFCQQFADLLIAEMEG |
Ga0244775_101705942 | 3300024346 | Estuarine | MNTELERIMRAAGAPEEVMTELWFVVFCQQFADLLISEMEG |
Ga0244775_106356551 | 3300024346 | Estuarine | IELERLVRAAGAPEEVMDQLWFVVFCQQFADLLISEIEGTDPQS |
Ga0244776_107474812 | 3300024348 | Estuarine | MNTELERIVRAAGVPEEVMTELWFVVFCQQFADLLIAEMEMNQEAVPLQVDA |
Ga0208926_10254072 | 3300027205 | Estuarine | MNAELERIVRAAGAPDEAMEQLWFVVFCQQFADLLIAEMEG |
Ga0255077_10408183 | 3300027529 | Freshwater | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGTDTQP |
Ga0208974_10510131 | 3300027608 | Freshwater Lentic | MNTELERIVRAAGAPEEAMTELWFVVFCQQFADLLISEMEAD |
Ga0208974_10785945 | 3300027608 | Freshwater Lentic | MNTELERLARAAGAPEEIMTELWFVVFCQQFADLLISEMEADSVDTK |
Ga0208951_10788303 | 3300027621 | Freshwater Lentic | MNTELERLARAAGAPEEIMTELWFAIFCQQFAHLLIQELEVDSVDTK |
Ga0209033_10490722 | 3300027697 | Freshwater Lake | MNTELERIVRAAGAPEEAMTELWFVVFCQQFAHLLIAEMEGTDSRP |
Ga0209190_100554513 | 3300027736 | Freshwater Lake | MNAELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGPDSRP |
Ga0209597_12811791 | 3300027746 | Freshwater Lake | MNTELERIVRASGAPEEAMNQLWFVVFCQQFADLLIAELEAEIVDTK |
Ga0209084_100018610 | 3300027749 | Freshwater Lake | MNTELERIVRAAGAPDEAMDQLWFVVFCQQFADLLIQELEADSVDTK |
Ga0209296_12379062 | 3300027759 | Freshwater Lake | MNTELERIVRAAGAPEEAMDELWFVVFCQQFADLLIAEMEGPDSRP |
Ga0209770_102700071 | 3300027769 | Freshwater Lake | VNAELERLVRAAGAPEEVMTELWFAVFCKQFAHLLIQEMEG |
Ga0209500_100609752 | 3300027782 | Freshwater Lake | VNAELERLVRAAGAPEEAMAELWFVVFCQQFADLLISEMEGSDSRP |
Ga0209972_101843982 | 3300027793 | Freshwater Lake | MNTELERIVRAAGAPEEVMTELWFVVFCQQFADLLIAEMEGTDTQP |
Ga0209107_103303062 | 3300027797 | Freshwater And Sediment | MNTELERIVRAAGAPEQAMAELWFVVFCQQFANLLIQELEADSVNTKL |
Ga0209107_104366012 | 3300027797 | Freshwater And Sediment | MNTELERIVRAAGAPEEAMTELWFVVFCQQFADLLISEMEADSVDTK |
Ga0315904_107495061 | 3300031951 | Freshwater | MNTELERIVRAAGAPEQAMDQLWFVVFCQQFADLLIAEMEGPDSRP |
Ga0334992_0048269_1144_1302 | 3300033992 | Freshwater | MNTELERIVRAAGAPEQAMAELWFVVFCQQFADLLISEMEMDQEADLLQVDA |
Ga0334996_0201173_405_548 | 3300033994 | Freshwater | MNTELERIVRAAGAPEEVMTELWFSVFCQQFADLLIAEMEADSVDTK |
Ga0334983_0770904_371_505 | 3300034060 | Freshwater | MNTELERIVRAAGAPEQAMAELWFVVFCQQFADLLISEMEMDQEA |
Ga0335029_0376470_44_202 | 3300034102 | Freshwater | MNTELERLARAAGAPEEIMTELWFAIFCQQFAHLLIAEMEMDQEADLLQVDA |
Ga0335030_0132424_1156_1296 | 3300034103 | Freshwater | MNTELERIVRAAGAPKEAMTELWFVVFCQQFADLLIAEMEGTDTQP |
Ga0335031_0784994_350_490 | 3300034104 | Freshwater | MNTELERIVRAAGAPEQAMAELWFVVFCQQFADLLIAEMEGTDTQP |
Ga0334997_0307916_200_340 | 3300034280 | Freshwater | MNTKLERIVRAAGAPEQAMAELWFVVFCQQFADLLIAEMEGTDSQS |
⦗Top⦘ |