NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060878

Metagenome / Metatranscriptome Family F060878

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060878
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 44 residues
Representative Sequence GAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Number of Associated Samples 96
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 99.24 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.697 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.879 % of family members)
Environment Ontology (ENVO) Unclassified
(31.061 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.56%    β-sheet: 34.88%    Coil/Unstructured: 32.56%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00274Glycolytic 3.79
PF00578AhpC-TSA 3.79
PF01022HTH_5 3.03
PF00903Glyoxalase 2.27
PF12681Glyoxalase_2 1.52
PF07885Ion_trans_2 1.52
PF01432Peptidase_M3 1.52
PF03861ANTAR 1.52
PF06897DUF1269 1.52
PF01883FeS_assembly_P 1.52
PF13581HATPase_c_2 1.52
PF03640Lipoprotein_15 1.52
PF04107GCS2 1.52
PF00196GerE 1.52
PF01061ABC2_membrane 0.76
PF00587tRNA-synt_2b 0.76
PF00313CSD 0.76
PF03631Virul_fac_BrkB 0.76
PF00296Bac_luciferase 0.76
PF04828GFA 0.76
PF03706LPG_synthase_TM 0.76
PF00990GGDEF 0.76
PF07676PD40 0.76
PF13649Methyltransf_25 0.76
PF044632-thiour_desulf 0.76
PF02518HATPase_c 0.76
PF08240ADH_N 0.76
PF13340DUF4096 0.76
PF07690MFS_1 0.76
PF07040DUF1326 0.76
PF00248Aldo_ket_red 0.76
PF01850PIN 0.76
PF13377Peripla_BP_3 0.76
PF00211Guanylate_cyc 0.76
PF08450SGL 0.76
PF02233PNTB 0.76
PF07992Pyr_redox_2 0.76
PF00535Glycos_transf_2 0.76
PF01451LMWPc 0.76
PF14938SNAP 0.76
PF00440TetR_N 0.76
PF00107ADH_zinc_N 0.76
PF13439Glyco_transf_4 0.76
PF07099DUF1361 0.76
PF00953Glycos_transf_4 0.76
PF03795YCII 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG3588Fructose-bisphosphate aldolase class 1Carbohydrate transport and metabolism [G] 3.79
COG4803Uncharacterized membrane proteinFunction unknown [S] 1.52
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 1.52
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 1.52
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 1.52
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 1.52
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.76
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.76
COG4330Uncharacterized membrane protein, DUF1361 domainFunction unknown [S] 0.76
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.76
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.76
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.76
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.76
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.76
COG1683Uncharacterized conserved protein YbbK, DUF523 familyFunction unknown [S] 0.76
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.76
COG1282NAD/NADP transhydrogenase beta subunitEnergy production and conversion [C] 0.76
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.76
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.70 %
UnclassifiedrootN/A5.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_10345336All Organisms → cellular organisms → Bacteria1884Open in IMG/M
3300000956|JGI10216J12902_112500815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1308Open in IMG/M
3300002459|JGI24751J29686_10069097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae728Open in IMG/M
3300002568|C688J35102_118830308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300002908|JGI25382J43887_10275157All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300004114|Ga0062593_100759166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium957Open in IMG/M
3300004114|Ga0062593_100903447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus pyridinivorans893Open in IMG/M
3300004156|Ga0062589_100278129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1277Open in IMG/M
3300004156|Ga0062589_101196624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300004156|Ga0062589_102836854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300004157|Ga0062590_100454677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1073Open in IMG/M
3300004157|Ga0062590_100602342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium966Open in IMG/M
3300004479|Ga0062595_100192151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1251Open in IMG/M
3300004479|Ga0062595_100909676All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300004479|Ga0062595_101208401All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300004480|Ga0062592_100284087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1240Open in IMG/M
3300004643|Ga0062591_100288291All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300005186|Ga0066676_10209736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1256Open in IMG/M
3300005329|Ga0070683_100288893All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300005332|Ga0066388_105708338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300005355|Ga0070671_101067896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300005435|Ga0070714_100238028All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300005437|Ga0070710_10942420All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005440|Ga0070705_101343172All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005451|Ga0066681_10816406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300005543|Ga0070672_100629139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium936Open in IMG/M
3300005548|Ga0070665_101654821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300005555|Ga0066692_10248557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1122Open in IMG/M
3300005563|Ga0068855_102621957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300005564|Ga0070664_101473889All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005617|Ga0068859_100194384All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300005841|Ga0068863_102276388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300006028|Ga0070717_10049866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3438Open in IMG/M
3300006031|Ga0066651_10500919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300006034|Ga0066656_11056290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300006581|Ga0074048_10032772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300006604|Ga0074060_11686684All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300006804|Ga0079221_10924484Not Available644Open in IMG/M
3300006844|Ga0075428_101977431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300006852|Ga0075433_10287385All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300006853|Ga0075420_100058001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3436Open in IMG/M
3300006871|Ga0075434_100705330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1026Open in IMG/M
3300006969|Ga0075419_10285779All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300007076|Ga0075435_101818059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300009093|Ga0105240_10798672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1022Open in IMG/M
3300009093|Ga0105240_12555696Not Available528Open in IMG/M
3300009098|Ga0105245_10173311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2056Open in IMG/M
3300009101|Ga0105247_10014966All Organisms → cellular organisms → Bacteria4651Open in IMG/M
3300009137|Ga0066709_101414776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1010Open in IMG/M
3300009147|Ga0114129_10250331All Organisms → cellular organisms → Bacteria2379Open in IMG/M
3300009147|Ga0114129_10862043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1150Open in IMG/M
3300009147|Ga0114129_10939663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1093Open in IMG/M
3300009177|Ga0105248_10599519All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1243Open in IMG/M
3300009545|Ga0105237_11074897All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300010038|Ga0126315_10926158Not Available580Open in IMG/M
3300010333|Ga0134080_10660618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300010375|Ga0105239_11099233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium915Open in IMG/M
3300011119|Ga0105246_12584397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300011270|Ga0137391_11339763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300011431|Ga0137438_1044288Not Available1317Open in IMG/M
3300012207|Ga0137381_10943496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium745Open in IMG/M
3300012354|Ga0137366_10020828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5114Open in IMG/M
3300012354|Ga0137366_11199977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012913|Ga0157298_10272279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300012914|Ga0157297_10215140All Organisms → cellular organisms → Bacteria → Terrabacteria group674Open in IMG/M
3300012917|Ga0137395_10994878All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300012951|Ga0164300_10577544All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300012955|Ga0164298_10825711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012957|Ga0164303_10920975All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300012985|Ga0164308_10930315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300012985|Ga0164308_11812406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300012986|Ga0164304_11122419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300012986|Ga0164304_11314865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300012986|Ga0164304_11548661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300012987|Ga0164307_10697143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium795Open in IMG/M
3300012987|Ga0164307_11527432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300012989|Ga0164305_10551089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300012989|Ga0164305_11256547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi645Open in IMG/M
3300012989|Ga0164305_12090570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300013306|Ga0163162_11569736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300013306|Ga0163162_12787679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. RD6.2563Open in IMG/M
3300014166|Ga0134079_10738719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300015201|Ga0173478_10156935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300015371|Ga0132258_10589878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli2789Open in IMG/M
3300015371|Ga0132258_10930204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2195Open in IMG/M
3300015371|Ga0132258_11447357All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300015371|Ga0132258_12517930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1287Open in IMG/M
3300015371|Ga0132258_12651020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1251Open in IMG/M
3300015371|Ga0132258_12823166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1209Open in IMG/M
3300015372|Ga0132256_100197721All Organisms → cellular organisms → Bacteria → Terrabacteria group2055Open in IMG/M
3300015372|Ga0132256_100267486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1784Open in IMG/M
3300015372|Ga0132256_100949074All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300015372|Ga0132256_102562565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300015372|Ga0132256_102908932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium576Open in IMG/M
3300015372|Ga0132256_103169487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300015373|Ga0132257_100252344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2106Open in IMG/M
3300015373|Ga0132257_100948673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300015373|Ga0132257_101981292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium751Open in IMG/M
3300015373|Ga0132257_104545638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300015374|Ga0132255_103828919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300015374|Ga0132255_104008427All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300015374|Ga0132255_105118721All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300015374|Ga0132255_105942599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300017654|Ga0134069_1362032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300018081|Ga0184625_10614482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300018482|Ga0066669_10523603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1029Open in IMG/M
3300021560|Ga0126371_10432967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1460Open in IMG/M
3300022898|Ga0247745_1056842All Organisms → cellular organisms → Bacteria → Terrabacteria group626Open in IMG/M
3300025898|Ga0207692_10287798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium996Open in IMG/M
3300025908|Ga0207643_10503821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300025916|Ga0207663_10594906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300025924|Ga0207694_10158468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1827Open in IMG/M
3300025939|Ga0207665_10452470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium985Open in IMG/M
3300025939|Ga0207665_10533628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300025939|Ga0207665_11144566Not Available621Open in IMG/M
3300025940|Ga0207691_10429204Not Available1126Open in IMG/M
3300025941|Ga0207711_10227790Not Available1706Open in IMG/M
3300025944|Ga0207661_10072333All Organisms → cellular organisms → Bacteria2821Open in IMG/M
3300026089|Ga0207648_10454482All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300026095|Ga0207676_12459022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300027909|Ga0209382_10792932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1009Open in IMG/M
3300027909|Ga0209382_10971899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300028381|Ga0268264_10783717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria951Open in IMG/M
3300031170|Ga0307498_10129467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300031474|Ga0170818_110244290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300031547|Ga0310887_10467596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300031765|Ga0318554_10704019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300031908|Ga0310900_10281686All Organisms → cellular organisms → Bacteria → Terrabacteria group1213Open in IMG/M
3300031912|Ga0306921_10444272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1511Open in IMG/M
3300032010|Ga0318569_10509532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300032054|Ga0318570_10156752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1020Open in IMG/M
3300032180|Ga0307471_104343956All Organisms → cellular organisms → Bacteria500Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere10.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil9.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.30%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere4.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.52%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.76%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1034533613300000891SoilDAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS*
JGI10216J12902_11250081533300000956SoilGPATGAFYASLDDAGKVTLRDTVRASLPQGPFTLPARAWLALGTVPG*
JGI24751J29686_1006909713300002459Corn, Switchgrass And Miscanthus RhizosphereGPATSAFYGSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR*
C688J35102_11883030823300002568SoilPATGAFYASLDDAGKARLRETLRASLPEGPFTLPARAWLALGIVPG*
JGI25382J43887_1027515723300002908Grasslands SoilPFTGAAGPATGAFCASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG*
Ga0062593_10075916623300004114SoilEPFTGAAGPATGAFYASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS*
Ga0062593_10090344713300004114SoilAGPATGAFYASLDDAGKATLRDTVRASLPEGRFTLQARAWLALGTVPG*
Ga0062589_10027812913300004156SoilGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0062589_10119662423300004156SoilGAAGPATGAFYASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS*
Ga0062589_10283685423300004156SoilDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPPAEL*
Ga0062590_10045467713300004157SoilAAGPATGAFYASLDDAGKATLRDTVRASLPAGPFTLPARAWLALGTVPG*
Ga0062590_10060234233300004157SoilASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS*
Ga0062595_10019215113300004479SoilFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTKRSRTA*
Ga0062595_10090967613300004479SoilFYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG*
Ga0062595_10120840113300004479SoilPATGAFYASLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPG*
Ga0062592_10028408733300004480SoilGAFYASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS*
Ga0062591_10028829133300004643SoilAFYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG*
Ga0066676_1020973613300005186SoilAFYASLEDAGKATLRDTVRVSLPEGPFTLPARAWLALGTVPG*
Ga0070683_10028889313300005329Corn RhizosphereAGPATGAFYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG*
Ga0066388_10570833813300005332Tropical Forest SoilGGAGPATGAFYASLDDAGKATLRDTVRASLPEGPFALPGRAWLALGTVPG*
Ga0070671_10106789613300005355Switchgrass RhizosphereAFYASLDDAGKVTLRDTVRASLPDGPFTMPARAWLALGTVPG*
Ga0070714_10023802813300005435Agricultural SoilYASLDDAGRATLRDAVRASLPESPFTLPARAWLALGTVPG*
Ga0070710_1094242023300005437Corn, Switchgrass And Miscanthus RhizosphereATGAFYASLDDAGKATLRDTVRVSLPEGPFTLPARAWLALGTVPG*
Ga0070705_10134317213300005440Corn, Switchgrass And Miscanthus RhizosphereGAFYASLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG*
Ga0066681_1081640623300005451SoilASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0070672_10062913943300005543Miscanthus RhizosphereSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR*
Ga0070665_10165482113300005548Switchgrass RhizosphereAGPATGAFYASLDDAGKATLRDTVRASLPKGPFTLPARAWLALGTVPG*
Ga0066692_1024855723300005555SoilAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG*
Ga0068855_10262195713300005563Corn RhizosphereGGGGPASGAFYASLDDAGRATLRDAVRASLPESPFTLPARAWLALGTVPA*
Ga0070664_10147388913300005564Corn RhizosphereGSGGPSTGAFYDSLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPS*
Ga0068859_10019438413300005617Switchgrass RhizosphereATGAFYASLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG*
Ga0068863_10227638813300005841Switchgrass RhizosphereFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0070717_1004986683300006028Corn, Switchgrass And Miscanthus RhizosphereDDAGKATLRDTVRASLPEGPFTLSARAWLALGTVPG*
Ga0066651_1050091913300006031SoilAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG*
Ga0066656_1105629023300006034SoilAAGPATGAFYASLDDAGKVTLRDTVRASLPQGPFTLPARAWLALGTVPG*
Ga0074048_1003277213300006581SoilSLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0074060_1168668433300006604SoilTGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0079221_1092448423300006804Agricultural SoilSGGPSTGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPGFSA*
Ga0075428_10197743113300006844Populus RhizosphereAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPGFKP*
Ga0075433_1028738543300006852Populus RhizosphereSLDDAGKATLRDTVRASLPEAPFTLPARAWLALGTVVG*
Ga0075420_10005800163300006853Populus RhizosphereLDDAGKATLRDTVRASLPQGPFTLPARAWIALGTVPG*
Ga0075434_10070533013300006871Populus RhizosphereGAAGPATGAFYASLDDAGKATLRDTVRASLPQGPFTLPARAWLALGTVPG*
Ga0075419_1028577913300006969Populus RhizosphereASLDDAGKATLRDTVRASLPQGPFTLPARAWIALGTVPG*
Ga0075435_10181805923300007076Populus RhizosphereSLDDAGKATLRDTVRISLPEGPFTLPARAWLALGTVTG*
Ga0105240_1079867213300009093Corn RhizosphereDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR*
Ga0105240_1255569613300009093Corn RhizosphereTGAFYDSLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPS*
Ga0105245_1017331143300009098Miscanthus RhizospherePFTGGGGPASGAFYDSLDDAGKATLRDSVRASLPEAPFTLPARAWLALGTVPG*
Ga0105247_1001496683300009101Switchgrass RhizosphereLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG*
Ga0066709_10141477613300009137Grasslands SoilTGAAGPATGAFYASLDDAGKATLRNTVRASLPEGPFTLPARAWLALGTVPGL*
Ga0114129_1025033113300009147Populus RhizosphereSLDDAGKATLRDTVRASLPEGPFTLRARAWLALGTVPG*
Ga0114129_1086204313300009147Populus RhizosphereDDAGKAALRDTARASLPEGPFTLPARAWLALGTVPG*
Ga0114129_1093966313300009147Populus RhizosphereDDPGKATMRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0105248_1059951913300009177Switchgrass RhizosphereGAFYDSLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPS*
Ga0105237_1107489713300009545Corn RhizosphereAGKATLRETVRASLPEGPFTLPARAWLALGTVPS*
Ga0126315_1092615833300010038Serpentine SoilLDDAGKATLRDTVRSSLPEGPFTLPARAWLALGTAPG*
Ga0134080_1066061813300010333Grasslands SoilGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG*
Ga0105239_1109923313300010375Corn RhizospherePATGAFYASLDDAGKATLRDGVRGSLPEGPFTLPARAWLAIGTVPG*
Ga0105246_1258439713300011119Miscanthus RhizosphereGAFYASLEDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0137391_1133976313300011270Vadose Zone SoilEPFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0137438_104428823300011431SoilDDAGKATLRDTVRASVPEGPFTLEARAWLALGTVPH*
Ga0137381_1094349623300012207Vadose Zone SoilDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG*
Ga0137366_1002082883300012354Vadose Zone SoilTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0137366_1119997723300012354Vadose Zone SoilGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPA*
Ga0157298_1027227913300012913SoilDDAGKVTLRDTVRASLPDGPFTMPARAWLALGTVPG*
Ga0157297_1021514013300012914SoilPATGAFYASLDDADKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0137395_1099487813300012917Vadose Zone SoilTGAAGPATGAFYASLDDAGKSTLRDTVRASLPEVPFTLPARAWLALGTVPG*
Ga0164300_1057754413300012951SoilSLDDAGKETLRETVRAFLPDGPFTLPARAWLALGSVAR*
Ga0164298_1082571123300012955SoilWKPFTGAAGPATGAFYASLDHAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0164303_1092097523300012957SoilYASLDDAGKETLRETVRAFLPDGPFTLPARAWLALGTVAR*
Ga0164308_1093031533300012985SoilEPFTGAAGPATGAFYASLDDAGKATLRHTVRASLPEGPFTLPARAWLALGTVPG*
Ga0164308_1181240613300012985SoilDSLDDAGKATLRDSVRDSLPEAPFTLPARAWLALGTVPG*
Ga0164304_1112241923300012986SoilYDSLDDAGKATLRDSVRDSLPEAPFTLPARAWLALGTVPG*
Ga0164304_1131486523300012986SoilASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVSG*
Ga0164304_1154866133300012986SoilPATGAFYASLDDAGKATLRDSVRASLPEAPFTLPARAWLALGSVPG*
Ga0164307_1069714323300012987SoilFYAGLDDANKAVLRDTVRTSLPEGPFTLPARAWLAIGTVPG*
Ga0164307_1152743213300012987SoilAGPATGAFYASLDDDDKATLRDTVHASLPEGPFTLPARAWLALGTVPG*
Ga0164305_1055108913300012989SoilPFTGGGGPASGAFYDSLDDAGKATLRDTVRASLPEAPFTLPARAWLALGTVPG*
Ga0164305_1125654733300012989SoilAGPATGAFYASLDDGGKATLRDTVRASLPEGPFTLPARAWLALGTVPERR*
Ga0164305_1209057013300012989SoilLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0163162_1156973613300013306Switchgrass RhizospherePATGAFYASLDDAGQATLRDTVRAALPEGPFTLPARAWLALGTVPG*
Ga0163162_1278767913300013306Switchgrass RhizospherePFTGAAGPATGAFYASLDDAGQATLRDTVRASLPEGPFTLPARAWLALGTAPG*
Ga0134079_1073871913300014166Grasslands SoilDDAGKATLRDTVRASLPEGPFTLPARAWLAVGTVPG*
Ga0173478_1015693533300015201SoilDARRATGAFHASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132258_1058987843300015371Arabidopsis RhizosphereAGKATLRDTVRASLPEGPFTLPARAWLALGTAAG*
Ga0132258_1093020413300015371Arabidopsis RhizosphereDDAGKATLRDTVRSSLPAGAFTLTARAWLALGTVPG*
Ga0132258_1144735713300015371Arabidopsis RhizosphereSLDDAGKATLRDTVRASLPEGPFTLPAPAWLALGTVPGK*
Ga0132258_1251793013300015371Arabidopsis RhizosphereSGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132258_1265102013300015371Arabidopsis RhizosphereGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132258_1282316623300015371Arabidopsis RhizosphereAALIGMLVAAATGAFYASLDDAGKATLRDTVRASLPEAPFTLPARAWLALGTVPG*
Ga0132256_10019772143300015372Arabidopsis RhizosphereATGAFYASLDDAGKATLRDTARASLPQGPFTLPARAWLALGTVPG*
Ga0132256_10026748613300015372Arabidopsis RhizosphereFYASLDNVGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132256_10094907413300015372Arabidopsis RhizosphereAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132256_10256256523300015372Arabidopsis RhizosphereYASLDDAGKAILRDTVRASLPEAPFTLSARAWLALGTVPGYQGLS*
Ga0132256_10290893213300015372Arabidopsis RhizosphereAFYASLDDPGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132256_10316948723300015372Arabidopsis RhizosphereLDDAGKATLRDTVRDSLPEGPFTLPARAWLALGTVPG*
Ga0132257_10025234413300015373Arabidopsis RhizosphereSLDDAGKATLRDSVRASLPEGAFTLPARAWLALGTVPG*
Ga0132257_10094867313300015373Arabidopsis RhizospherePFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132257_10198129213300015373Arabidopsis RhizosphereLDDSGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132257_10454563813300015373Arabidopsis RhizospherePASGAFYASLDDAGKATLRDTVRASLPDAPFTLQGRAWLALGVVPA*
Ga0132255_10382891923300015374Arabidopsis RhizosphereFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132255_10400842723300015374Arabidopsis RhizosphereYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG*
Ga0132255_10511872113300015374Arabidopsis RhizosphereAGKATLRDTVRASLPEGPFTLPARAWLALGTIPG*
Ga0132255_10594259923300015374Arabidopsis RhizosphereMDEIALRDMVRASLPEGSFTLSARAWLALGTVPG*
Ga0134069_136203223300017654Grasslands SoilPFTGAAGPATGAFYASLDDAGKVTLRDAVRASLPEGPFTLPARAWLALGTVPG
Ga0184625_1061448213300018081Groundwater SedimentATGAFYASLDDAGKATLRDTVCASLPEGPFTLPARAWLALGTVPG
Ga0066669_1052360323300018482Grasslands SoilDDAGKVTLRDAVRASLPEGPFTLPARAWLALGTVPG
Ga0126371_1043296733300021560Tropical Forest SoilYSSLDDAGKATLRDNVRASLPEGPFTLPARAWLALGTVPG
Ga0247745_105684223300022898SoilFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Ga0207692_1028779833300025898Corn, Switchgrass And Miscanthus RhizosphereAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPERR
Ga0207643_1050382123300025908Miscanthus RhizosphereEPFTAGGGPSTGAFYASLDHAGKATLRDTVRASLPEGAFTLPARAWLALGTVPG
Ga0207663_1059490613300025916Corn, Switchgrass And Miscanthus RhizosphereAAGPATGAFYASLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG
Ga0207694_1015846853300025924Corn RhizospherePFTGGGGPATSAFYGSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR
Ga0207665_1045247013300025939Corn, Switchgrass And Miscanthus RhizosphereTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPERR
Ga0207665_1053362813300025939Corn, Switchgrass And Miscanthus RhizosphereDAGKATLRHTVRASLPKGPFTLPARAWLALGTVPG
Ga0207665_1114456623300025939Corn, Switchgrass And Miscanthus RhizosphereSLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPGFSA
Ga0207691_1042920443300025940Miscanthus RhizosphereTSAFYGSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR
Ga0207711_1022779043300025941Switchgrass RhizosphereEPFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPS
Ga0207661_1007233343300025944Corn RhizosphereFYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG
Ga0207648_1045448233300026089Miscanthus RhizospherePFTGGAGPASGAFYASLEDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Ga0207676_1245902213300026095Switchgrass RhizosphereATAPFYASRDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Ga0209382_1079293233300027909Populus RhizosphereFTGAAGPATGAFYASLDDAGKATLRDTVRASLPQGPFTLPARAWIALGTVPG
Ga0209382_1097189923300027909Populus RhizosphereFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Ga0268264_1078371733300028381Switchgrass RhizosphereATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Ga0307498_1012946713300031170SoilAGPATGAFYASLDDAGRATLRDIVRASLPEGPFTLPARAWLALGAVPG
Ga0170818_11024429013300031474Forest SoilIGAFYASLDDAGKATLRDSVRASLPEGPFTLPARAWLALGTVPG
Ga0310887_1046759623300031547SoilGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG
Ga0318554_1070401933300031765SoilFYDSLDDAGKATLRDSVRASLPEGPFTLPARAWLALGTVPG
Ga0310900_1028168613300031908SoilSLDDAGKATLRDTVRASLPERPFTLPARAWLALGTVPG
Ga0306921_1044427213300031912SoilGPATGAFYASLDDAGKATLRAKVHASLPEGSFTLQARAWLALGSAPG
Ga0318569_1050953223300032010SoilSTGAFYASLDDAGKTTLRDTVRASLPEGPFTLPARAWLALGTAPG
Ga0318570_1015675213300032054SoilASLDDAGKATLRAKVHASLPEGSFTLQARAWLALGSAPG
Ga0307471_10434395623300032180Hardwood Forest SoilPFTGAAGPATGAFYASHDDAGKATLRDTVRISLPEGPFTLPARAWLALGTVTG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.