Basic Information | |
---|---|
Family ID | F060878 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 44 residues |
Representative Sequence | GAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.76 % |
% of genes near scaffold ends (potentially truncated) | 99.24 % |
% of genes from short scaffolds (< 2000 bps) | 90.91 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.697 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.879 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.061 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.56% β-sheet: 34.88% Coil/Unstructured: 32.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF00274 | Glycolytic | 3.79 |
PF00578 | AhpC-TSA | 3.79 |
PF01022 | HTH_5 | 3.03 |
PF00903 | Glyoxalase | 2.27 |
PF12681 | Glyoxalase_2 | 1.52 |
PF07885 | Ion_trans_2 | 1.52 |
PF01432 | Peptidase_M3 | 1.52 |
PF03861 | ANTAR | 1.52 |
PF06897 | DUF1269 | 1.52 |
PF01883 | FeS_assembly_P | 1.52 |
PF13581 | HATPase_c_2 | 1.52 |
PF03640 | Lipoprotein_15 | 1.52 |
PF04107 | GCS2 | 1.52 |
PF00196 | GerE | 1.52 |
PF01061 | ABC2_membrane | 0.76 |
PF00587 | tRNA-synt_2b | 0.76 |
PF00313 | CSD | 0.76 |
PF03631 | Virul_fac_BrkB | 0.76 |
PF00296 | Bac_luciferase | 0.76 |
PF04828 | GFA | 0.76 |
PF03706 | LPG_synthase_TM | 0.76 |
PF00990 | GGDEF | 0.76 |
PF07676 | PD40 | 0.76 |
PF13649 | Methyltransf_25 | 0.76 |
PF04463 | 2-thiour_desulf | 0.76 |
PF02518 | HATPase_c | 0.76 |
PF08240 | ADH_N | 0.76 |
PF13340 | DUF4096 | 0.76 |
PF07690 | MFS_1 | 0.76 |
PF07040 | DUF1326 | 0.76 |
PF00248 | Aldo_ket_red | 0.76 |
PF01850 | PIN | 0.76 |
PF13377 | Peripla_BP_3 | 0.76 |
PF00211 | Guanylate_cyc | 0.76 |
PF08450 | SGL | 0.76 |
PF02233 | PNTB | 0.76 |
PF07992 | Pyr_redox_2 | 0.76 |
PF00535 | Glycos_transf_2 | 0.76 |
PF01451 | LMWPc | 0.76 |
PF14938 | SNAP | 0.76 |
PF00440 | TetR_N | 0.76 |
PF00107 | ADH_zinc_N | 0.76 |
PF13439 | Glyco_transf_4 | 0.76 |
PF07099 | DUF1361 | 0.76 |
PF00953 | Glycos_transf_4 | 0.76 |
PF03795 | YCII | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 3.79 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 1.52 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 1.52 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.52 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 1.52 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 1.52 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.76 |
COG4330 | Uncharacterized membrane protein, DUF1361 domain | Function unknown [S] | 0.76 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.76 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.76 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.76 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.76 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.76 |
COG1683 | Uncharacterized conserved protein YbbK, DUF523 family | Function unknown [S] | 0.76 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.76 |
COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 0.76 |
COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.70 % |
Unclassified | root | N/A | 5.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_10345336 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
3300000956|JGI10216J12902_112500815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1308 | Open in IMG/M |
3300002459|JGI24751J29686_10069097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 728 | Open in IMG/M |
3300002568|C688J35102_118830308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300002908|JGI25382J43887_10275157 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300004114|Ga0062593_100759166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 957 | Open in IMG/M |
3300004114|Ga0062593_100903447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus pyridinivorans | 893 | Open in IMG/M |
3300004156|Ga0062589_100278129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1277 | Open in IMG/M |
3300004156|Ga0062589_101196624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
3300004156|Ga0062589_102836854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300004157|Ga0062590_100454677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
3300004157|Ga0062590_100602342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
3300004479|Ga0062595_100192151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1251 | Open in IMG/M |
3300004479|Ga0062595_100909676 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300004479|Ga0062595_101208401 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300004480|Ga0062592_100284087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1240 | Open in IMG/M |
3300004643|Ga0062591_100288291 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300005186|Ga0066676_10209736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1256 | Open in IMG/M |
3300005329|Ga0070683_100288893 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300005332|Ga0066388_105708338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300005355|Ga0070671_101067896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
3300005435|Ga0070714_100238028 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
3300005437|Ga0070710_10942420 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300005440|Ga0070705_101343172 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300005451|Ga0066681_10816406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
3300005543|Ga0070672_100629139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
3300005548|Ga0070665_101654821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300005555|Ga0066692_10248557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1122 | Open in IMG/M |
3300005563|Ga0068855_102621957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300005564|Ga0070664_101473889 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005617|Ga0068859_100194384 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
3300005841|Ga0068863_102276388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300006028|Ga0070717_10049866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3438 | Open in IMG/M |
3300006031|Ga0066651_10500919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300006034|Ga0066656_11056290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300006581|Ga0074048_10032772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300006604|Ga0074060_11686684 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300006804|Ga0079221_10924484 | Not Available | 644 | Open in IMG/M |
3300006844|Ga0075428_101977431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300006852|Ga0075433_10287385 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300006853|Ga0075420_100058001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3436 | Open in IMG/M |
3300006871|Ga0075434_100705330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1026 | Open in IMG/M |
3300006969|Ga0075419_10285779 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300007076|Ga0075435_101818059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300009093|Ga0105240_10798672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1022 | Open in IMG/M |
3300009093|Ga0105240_12555696 | Not Available | 528 | Open in IMG/M |
3300009098|Ga0105245_10173311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2056 | Open in IMG/M |
3300009101|Ga0105247_10014966 | All Organisms → cellular organisms → Bacteria | 4651 | Open in IMG/M |
3300009137|Ga0066709_101414776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
3300009147|Ga0114129_10250331 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
3300009147|Ga0114129_10862043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1150 | Open in IMG/M |
3300009147|Ga0114129_10939663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1093 | Open in IMG/M |
3300009177|Ga0105248_10599519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1243 | Open in IMG/M |
3300009545|Ga0105237_11074897 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300010038|Ga0126315_10926158 | Not Available | 580 | Open in IMG/M |
3300010333|Ga0134080_10660618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300010375|Ga0105239_11099233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 915 | Open in IMG/M |
3300011119|Ga0105246_12584397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300011270|Ga0137391_11339763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300011431|Ga0137438_1044288 | Not Available | 1317 | Open in IMG/M |
3300012207|Ga0137381_10943496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
3300012354|Ga0137366_10020828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5114 | Open in IMG/M |
3300012354|Ga0137366_11199977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300012913|Ga0157298_10272279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300012914|Ga0157297_10215140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
3300012917|Ga0137395_10994878 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300012951|Ga0164300_10577544 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300012955|Ga0164298_10825711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300012957|Ga0164303_10920975 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300012985|Ga0164308_10930315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
3300012985|Ga0164308_11812406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
3300012986|Ga0164304_11122419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300012986|Ga0164304_11314865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300012986|Ga0164304_11548661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300012987|Ga0164307_10697143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 795 | Open in IMG/M |
3300012987|Ga0164307_11527432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300012989|Ga0164305_10551089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
3300012989|Ga0164305_11256547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 645 | Open in IMG/M |
3300012989|Ga0164305_12090570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300013306|Ga0163162_11569736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300013306|Ga0163162_12787679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. RD6.2 | 563 | Open in IMG/M |
3300014166|Ga0134079_10738719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300015201|Ga0173478_10156935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
3300015371|Ga0132258_10589878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 2789 | Open in IMG/M |
3300015371|Ga0132258_10930204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2195 | Open in IMG/M |
3300015371|Ga0132258_11447357 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300015371|Ga0132258_12517930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
3300015371|Ga0132258_12651020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
3300015371|Ga0132258_12823166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1209 | Open in IMG/M |
3300015372|Ga0132256_100197721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2055 | Open in IMG/M |
3300015372|Ga0132256_100267486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1784 | Open in IMG/M |
3300015372|Ga0132256_100949074 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300015372|Ga0132256_102562565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300015372|Ga0132256_102908932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 576 | Open in IMG/M |
3300015372|Ga0132256_103169487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300015373|Ga0132257_100252344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2106 | Open in IMG/M |
3300015373|Ga0132257_100948673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1080 | Open in IMG/M |
3300015373|Ga0132257_101981292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
3300015373|Ga0132257_104545638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300015374|Ga0132255_103828919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300015374|Ga0132255_104008427 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300015374|Ga0132255_105118721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300015374|Ga0132255_105942599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300017654|Ga0134069_1362032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300018081|Ga0184625_10614482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300018482|Ga0066669_10523603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
3300021560|Ga0126371_10432967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1460 | Open in IMG/M |
3300022898|Ga0247745_1056842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300025898|Ga0207692_10287798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 996 | Open in IMG/M |
3300025908|Ga0207643_10503821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300025916|Ga0207663_10594906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
3300025924|Ga0207694_10158468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1827 | Open in IMG/M |
3300025939|Ga0207665_10452470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 985 | Open in IMG/M |
3300025939|Ga0207665_10533628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
3300025939|Ga0207665_11144566 | Not Available | 621 | Open in IMG/M |
3300025940|Ga0207691_10429204 | Not Available | 1126 | Open in IMG/M |
3300025941|Ga0207711_10227790 | Not Available | 1706 | Open in IMG/M |
3300025944|Ga0207661_10072333 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
3300026089|Ga0207648_10454482 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300026095|Ga0207676_12459022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300027909|Ga0209382_10792932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
3300027909|Ga0209382_10971899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
3300028381|Ga0268264_10783717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
3300031170|Ga0307498_10129467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
3300031474|Ga0170818_110244290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300031547|Ga0310887_10467596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300031765|Ga0318554_10704019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300031908|Ga0310900_10281686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1213 | Open in IMG/M |
3300031912|Ga0306921_10444272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1511 | Open in IMG/M |
3300032010|Ga0318569_10509532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300032054|Ga0318570_10156752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
3300032180|Ga0307471_104343956 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 10.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 9.09% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.30% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 4.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_103453361 | 3300000891 | Soil | DAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS* |
JGI10216J12902_1125008153 | 3300000956 | Soil | GPATGAFYASLDDAGKVTLRDTVRASLPQGPFTLPARAWLALGTVPG* |
JGI24751J29686_100690971 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | GPATSAFYGSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR* |
C688J35102_1188303082 | 3300002568 | Soil | PATGAFYASLDDAGKARLRETLRASLPEGPFTLPARAWLALGIVPG* |
JGI25382J43887_102751572 | 3300002908 | Grasslands Soil | PFTGAAGPATGAFCASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG* |
Ga0062593_1007591662 | 3300004114 | Soil | EPFTGAAGPATGAFYASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS* |
Ga0062593_1009034471 | 3300004114 | Soil | AGPATGAFYASLDDAGKATLRDTVRASLPEGRFTLQARAWLALGTVPG* |
Ga0062589_1002781291 | 3300004156 | Soil | GAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0062589_1011966242 | 3300004156 | Soil | GAAGPATGAFYASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS* |
Ga0062589_1028368542 | 3300004156 | Soil | DDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPPAEL* |
Ga0062590_1004546771 | 3300004157 | Soil | AAGPATGAFYASLDDAGKATLRDTVRASLPAGPFTLPARAWLALGTVPG* |
Ga0062590_1006023423 | 3300004157 | Soil | ASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS* |
Ga0062595_1001921511 | 3300004479 | Soil | FYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTKRSRTA* |
Ga0062595_1009096761 | 3300004479 | Soil | FYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG* |
Ga0062595_1012084011 | 3300004479 | Soil | PATGAFYASLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPG* |
Ga0062592_1002840873 | 3300004480 | Soil | GAFYASLDAAGKATLRDTVRASLPQGPFTLPARAWLALGTVPS* |
Ga0062591_1002882913 | 3300004643 | Soil | AFYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG* |
Ga0066676_102097361 | 3300005186 | Soil | AFYASLEDAGKATLRDTVRVSLPEGPFTLPARAWLALGTVPG* |
Ga0070683_1002888931 | 3300005329 | Corn Rhizosphere | AGPATGAFYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG* |
Ga0066388_1057083381 | 3300005332 | Tropical Forest Soil | GGAGPATGAFYASLDDAGKATLRDTVRASLPEGPFALPGRAWLALGTVPG* |
Ga0070671_1010678961 | 3300005355 | Switchgrass Rhizosphere | AFYASLDDAGKVTLRDTVRASLPDGPFTMPARAWLALGTVPG* |
Ga0070714_1002380281 | 3300005435 | Agricultural Soil | YASLDDAGRATLRDAVRASLPESPFTLPARAWLALGTVPG* |
Ga0070710_109424202 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGAFYASLDDAGKATLRDTVRVSLPEGPFTLPARAWLALGTVPG* |
Ga0070705_1013431721 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GAFYASLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG* |
Ga0066681_108164062 | 3300005451 | Soil | ASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0070672_1006291394 | 3300005543 | Miscanthus Rhizosphere | SLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR* |
Ga0070665_1016548211 | 3300005548 | Switchgrass Rhizosphere | AGPATGAFYASLDDAGKATLRDTVRASLPKGPFTLPARAWLALGTVPG* |
Ga0066692_102485572 | 3300005555 | Soil | AGKATLRDTVRASLPEGPFTLPARAWLALGTAPG* |
Ga0068855_1026219571 | 3300005563 | Corn Rhizosphere | GGGGPASGAFYASLDDAGRATLRDAVRASLPESPFTLPARAWLALGTVPA* |
Ga0070664_1014738891 | 3300005564 | Corn Rhizosphere | GSGGPSTGAFYDSLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPS* |
Ga0068859_1001943841 | 3300005617 | Switchgrass Rhizosphere | ATGAFYASLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG* |
Ga0068863_1022763881 | 3300005841 | Switchgrass Rhizosphere | FYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0070717_100498668 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DDAGKATLRDTVRASLPEGPFTLSARAWLALGTVPG* |
Ga0066651_105009191 | 3300006031 | Soil | AFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG* |
Ga0066656_110562902 | 3300006034 | Soil | AAGPATGAFYASLDDAGKVTLRDTVRASLPQGPFTLPARAWLALGTVPG* |
Ga0074048_100327721 | 3300006581 | Soil | SLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0074060_116866843 | 3300006604 | Soil | TGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0079221_109244842 | 3300006804 | Agricultural Soil | SGGPSTGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPGFSA* |
Ga0075428_1019774311 | 3300006844 | Populus Rhizosphere | AFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPGFKP* |
Ga0075433_102873854 | 3300006852 | Populus Rhizosphere | SLDDAGKATLRDTVRASLPEAPFTLPARAWLALGTVVG* |
Ga0075420_1000580016 | 3300006853 | Populus Rhizosphere | LDDAGKATLRDTVRASLPQGPFTLPARAWIALGTVPG* |
Ga0075434_1007053301 | 3300006871 | Populus Rhizosphere | GAAGPATGAFYASLDDAGKATLRDTVRASLPQGPFTLPARAWLALGTVPG* |
Ga0075419_102857791 | 3300006969 | Populus Rhizosphere | ASLDDAGKATLRDTVRASLPQGPFTLPARAWIALGTVPG* |
Ga0075435_1018180592 | 3300007076 | Populus Rhizosphere | SLDDAGKATLRDTVRISLPEGPFTLPARAWLALGTVTG* |
Ga0105240_107986721 | 3300009093 | Corn Rhizosphere | DAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR* |
Ga0105240_125556961 | 3300009093 | Corn Rhizosphere | TGAFYDSLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPS* |
Ga0105245_101733114 | 3300009098 | Miscanthus Rhizosphere | PFTGGGGPASGAFYDSLDDAGKATLRDSVRASLPEAPFTLPARAWLALGTVPG* |
Ga0105247_100149668 | 3300009101 | Switchgrass Rhizosphere | LDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG* |
Ga0066709_1014147761 | 3300009137 | Grasslands Soil | TGAAGPATGAFYASLDDAGKATLRNTVRASLPEGPFTLPARAWLALGTVPGL* |
Ga0114129_102503311 | 3300009147 | Populus Rhizosphere | SLDDAGKATLRDTVRASLPEGPFTLRARAWLALGTVPG* |
Ga0114129_108620431 | 3300009147 | Populus Rhizosphere | DDAGKAALRDTARASLPEGPFTLPARAWLALGTVPG* |
Ga0114129_109396631 | 3300009147 | Populus Rhizosphere | DDPGKATMRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0105248_105995191 | 3300009177 | Switchgrass Rhizosphere | GAFYDSLDDAGKATLRETVRASLPEGPFTLPARAWLALGTVPS* |
Ga0105237_110748971 | 3300009545 | Corn Rhizosphere | AGKATLRETVRASLPEGPFTLPARAWLALGTVPS* |
Ga0126315_109261583 | 3300010038 | Serpentine Soil | LDDAGKATLRDTVRSSLPEGPFTLPARAWLALGTAPG* |
Ga0134080_106606181 | 3300010333 | Grasslands Soil | GAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG* |
Ga0105239_110992331 | 3300010375 | Corn Rhizosphere | PATGAFYASLDDAGKATLRDGVRGSLPEGPFTLPARAWLAIGTVPG* |
Ga0105246_125843971 | 3300011119 | Miscanthus Rhizosphere | GAFYASLEDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0137391_113397631 | 3300011270 | Vadose Zone Soil | EPFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0137438_10442882 | 3300011431 | Soil | DDAGKATLRDTVRASVPEGPFTLEARAWLALGTVPH* |
Ga0137381_109434962 | 3300012207 | Vadose Zone Soil | DDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPG* |
Ga0137366_100208288 | 3300012354 | Vadose Zone Soil | TGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0137366_111999772 | 3300012354 | Vadose Zone Soil | GAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTAPA* |
Ga0157298_102722791 | 3300012913 | Soil | DDAGKVTLRDTVRASLPDGPFTMPARAWLALGTVPG* |
Ga0157297_102151401 | 3300012914 | Soil | PATGAFYASLDDADKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0137395_109948781 | 3300012917 | Vadose Zone Soil | TGAAGPATGAFYASLDDAGKSTLRDTVRASLPEVPFTLPARAWLALGTVPG* |
Ga0164300_105775441 | 3300012951 | Soil | SLDDAGKETLRETVRAFLPDGPFTLPARAWLALGSVAR* |
Ga0164298_108257112 | 3300012955 | Soil | WKPFTGAAGPATGAFYASLDHAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0164303_109209752 | 3300012957 | Soil | YASLDDAGKETLRETVRAFLPDGPFTLPARAWLALGTVAR* |
Ga0164308_109303153 | 3300012985 | Soil | EPFTGAAGPATGAFYASLDDAGKATLRHTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0164308_118124061 | 3300012985 | Soil | DSLDDAGKATLRDSVRDSLPEAPFTLPARAWLALGTVPG* |
Ga0164304_111224192 | 3300012986 | Soil | YDSLDDAGKATLRDSVRDSLPEAPFTLPARAWLALGTVPG* |
Ga0164304_113148652 | 3300012986 | Soil | ASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVSG* |
Ga0164304_115486613 | 3300012986 | Soil | PATGAFYASLDDAGKATLRDSVRASLPEAPFTLPARAWLALGSVPG* |
Ga0164307_106971432 | 3300012987 | Soil | FYAGLDDANKAVLRDTVRTSLPEGPFTLPARAWLAIGTVPG* |
Ga0164307_115274321 | 3300012987 | Soil | AGPATGAFYASLDDDDKATLRDTVHASLPEGPFTLPARAWLALGTVPG* |
Ga0164305_105510891 | 3300012989 | Soil | PFTGGGGPASGAFYDSLDDAGKATLRDTVRASLPEAPFTLPARAWLALGTVPG* |
Ga0164305_112565473 | 3300012989 | Soil | AGPATGAFYASLDDGGKATLRDTVRASLPEGPFTLPARAWLALGTVPERR* |
Ga0164305_120905701 | 3300012989 | Soil | LDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0163162_115697361 | 3300013306 | Switchgrass Rhizosphere | PATGAFYASLDDAGQATLRDTVRAALPEGPFTLPARAWLALGTVPG* |
Ga0163162_127876791 | 3300013306 | Switchgrass Rhizosphere | PFTGAAGPATGAFYASLDDAGQATLRDTVRASLPEGPFTLPARAWLALGTAPG* |
Ga0134079_107387191 | 3300014166 | Grasslands Soil | DDAGKATLRDTVRASLPEGPFTLPARAWLAVGTVPG* |
Ga0173478_101569353 | 3300015201 | Soil | DARRATGAFHASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132258_105898784 | 3300015371 | Arabidopsis Rhizosphere | AGKATLRDTVRASLPEGPFTLPARAWLALGTAAG* |
Ga0132258_109302041 | 3300015371 | Arabidopsis Rhizosphere | DDAGKATLRDTVRSSLPAGAFTLTARAWLALGTVPG* |
Ga0132258_114473571 | 3300015371 | Arabidopsis Rhizosphere | SLDDAGKATLRDTVRASLPEGPFTLPAPAWLALGTVPGK* |
Ga0132258_125179301 | 3300015371 | Arabidopsis Rhizosphere | SGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132258_126510201 | 3300015371 | Arabidopsis Rhizosphere | GPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132258_128231662 | 3300015371 | Arabidopsis Rhizosphere | AALIGMLVAAATGAFYASLDDAGKATLRDTVRASLPEAPFTLPARAWLALGTVPG* |
Ga0132256_1001977214 | 3300015372 | Arabidopsis Rhizosphere | ATGAFYASLDDAGKATLRDTARASLPQGPFTLPARAWLALGTVPG* |
Ga0132256_1002674861 | 3300015372 | Arabidopsis Rhizosphere | FYASLDNVGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132256_1009490741 | 3300015372 | Arabidopsis Rhizosphere | AGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132256_1025625652 | 3300015372 | Arabidopsis Rhizosphere | YASLDDAGKAILRDTVRASLPEAPFTLSARAWLALGTVPGYQGLS* |
Ga0132256_1029089321 | 3300015372 | Arabidopsis Rhizosphere | AFYASLDDPGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132256_1031694872 | 3300015372 | Arabidopsis Rhizosphere | LDDAGKATLRDTVRDSLPEGPFTLPARAWLALGTVPG* |
Ga0132257_1002523441 | 3300015373 | Arabidopsis Rhizosphere | SLDDAGKATLRDSVRASLPEGAFTLPARAWLALGTVPG* |
Ga0132257_1009486731 | 3300015373 | Arabidopsis Rhizosphere | PFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132257_1019812921 | 3300015373 | Arabidopsis Rhizosphere | LDDSGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132257_1045456381 | 3300015373 | Arabidopsis Rhizosphere | PASGAFYASLDDAGKATLRDTVRASLPDAPFTLQGRAWLALGVVPA* |
Ga0132255_1038289192 | 3300015374 | Arabidopsis Rhizosphere | FTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132255_1040084272 | 3300015374 | Arabidopsis Rhizosphere | YASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG* |
Ga0132255_1051187211 | 3300015374 | Arabidopsis Rhizosphere | AGKATLRDTVRASLPEGPFTLPARAWLALGTIPG* |
Ga0132255_1059425992 | 3300015374 | Arabidopsis Rhizosphere | MDEIALRDMVRASLPEGSFTLSARAWLALGTVPG* |
Ga0134069_13620322 | 3300017654 | Grasslands Soil | PFTGAAGPATGAFYASLDDAGKVTLRDAVRASLPEGPFTLPARAWLALGTVPG |
Ga0184625_106144821 | 3300018081 | Groundwater Sediment | ATGAFYASLDDAGKATLRDTVCASLPEGPFTLPARAWLALGTVPG |
Ga0066669_105236032 | 3300018482 | Grasslands Soil | DDAGKVTLRDAVRASLPEGPFTLPARAWLALGTVPG |
Ga0126371_104329673 | 3300021560 | Tropical Forest Soil | YSSLDDAGKATLRDNVRASLPEGPFTLPARAWLALGTVPG |
Ga0247745_10568422 | 3300022898 | Soil | FYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Ga0207692_102877983 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPERR |
Ga0207643_105038212 | 3300025908 | Miscanthus Rhizosphere | EPFTAGGGPSTGAFYASLDHAGKATLRDTVRASLPEGAFTLPARAWLALGTVPG |
Ga0207663_105949061 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGPATGAFYASLDDAGKASLRDTVRDSLPEGPFTLPARAWLALGTVPG |
Ga0207694_101584685 | 3300025924 | Corn Rhizosphere | PFTGGGGPATSAFYGSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR |
Ga0207665_104524701 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPERR |
Ga0207665_105336281 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DAGKATLRHTVRASLPKGPFTLPARAWLALGTVPG |
Ga0207665_111445662 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPGFSA |
Ga0207691_104292044 | 3300025940 | Miscanthus Rhizosphere | TSAFYGSLDDAGKATLRDLVRASLPEGPFTLPGRAWLALGTTPGLAGRSR |
Ga0207711_102277904 | 3300025941 | Switchgrass Rhizosphere | EPFTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPS |
Ga0207661_100723334 | 3300025944 | Corn Rhizosphere | FYASLDDAGKATLRDTVRAALPEGPFTLPARAWLALGTVPG |
Ga0207648_104544823 | 3300026089 | Miscanthus Rhizosphere | PFTGGAGPASGAFYASLEDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Ga0207676_124590221 | 3300026095 | Switchgrass Rhizosphere | ATAPFYASRDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Ga0209382_107929323 | 3300027909 | Populus Rhizosphere | FTGAAGPATGAFYASLDDAGKATLRDTVRASLPQGPFTLPARAWIALGTVPG |
Ga0209382_109718992 | 3300027909 | Populus Rhizosphere | FTGAAGPATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Ga0268264_107837173 | 3300028381 | Switchgrass Rhizosphere | ATGAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Ga0307498_101294671 | 3300031170 | Soil | AGPATGAFYASLDDAGRATLRDIVRASLPEGPFTLPARAWLALGAVPG |
Ga0170818_1102442901 | 3300031474 | Forest Soil | IGAFYASLDDAGKATLRDSVRASLPEGPFTLPARAWLALGTVPG |
Ga0310887_104675962 | 3300031547 | Soil | GAFYASLDDAGKATLRDTVRASLPEGPFTLPARAWLALGTVPG |
Ga0318554_107040193 | 3300031765 | Soil | FYDSLDDAGKATLRDSVRASLPEGPFTLPARAWLALGTVPG |
Ga0310900_102816861 | 3300031908 | Soil | SLDDAGKATLRDTVRASLPERPFTLPARAWLALGTVPG |
Ga0306921_104442721 | 3300031912 | Soil | GPATGAFYASLDDAGKATLRAKVHASLPEGSFTLQARAWLALGSAPG |
Ga0318569_105095322 | 3300032010 | Soil | STGAFYASLDDAGKTTLRDTVRASLPEGPFTLPARAWLALGTAPG |
Ga0318570_101567521 | 3300032054 | Soil | ASLDDAGKATLRAKVHASLPEGSFTLQARAWLALGSAPG |
Ga0307471_1043439562 | 3300032180 | Hardwood Forest Soil | PFTGAAGPATGAFYASHDDAGKATLRDTVRISLPEGPFTLPARAWLALGTVTG |
⦗Top⦘ |