| Basic Information | |
|---|---|
| Family ID | F060875 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 38 residues |
| Representative Sequence | DTSVRRWQKLTGGSARHAASGRSFDDLAREAEVANAA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 96.21 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.485 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.576 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 3.08% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 6.06 |
| PF16450 | Prot_ATP_ID_OB | 1.52 |
| PF13408 | Zn_ribbon_recom | 0.76 |
| PF14759 | Reductase_C | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.48 % |
| Mycobacterium avium subsp. paratuberculosis | subspecies | Mycobacterium avium subsp. paratuberculosis | 0.76 % |
| Unclassified | root | N/A | 0.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001081|JGI12662J13196_1018617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300001661|JGI12053J15887_10407564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300001867|JGI12627J18819_10413938 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100766584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300004081|Ga0063454_100698951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300004091|Ga0062387_101452462 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005179|Ga0066684_11092712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300005180|Ga0066685_11012504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 548 | Open in IMG/M |
| 3300005184|Ga0066671_11010619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300005437|Ga0070710_10553611 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005554|Ga0066661_10860758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300005555|Ga0066692_10719766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300005560|Ga0066670_10567667 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005561|Ga0066699_10435581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300005610|Ga0070763_10427296 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005764|Ga0066903_106341468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300006606|Ga0074062_10010815 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006800|Ga0066660_11335817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 561 | Open in IMG/M |
| 3300009038|Ga0099829_10467955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300009137|Ga0066709_101941886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300009143|Ga0099792_10042501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. | 2175 | Open in IMG/M |
| 3300009162|Ga0075423_11074192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. | 857 | Open in IMG/M |
| 3300009792|Ga0126374_11584636 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010043|Ga0126380_10265547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. | 1198 | Open in IMG/M |
| 3300010048|Ga0126373_12288804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300010159|Ga0099796_10049501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. | 1453 | Open in IMG/M |
| 3300010343|Ga0074044_10793014 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010358|Ga0126370_11239028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300010360|Ga0126372_10623022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300010361|Ga0126378_11058356 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300010361|Ga0126378_12938896 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010366|Ga0126379_13478272 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010376|Ga0126381_101683590 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 916 | Open in IMG/M |
| 3300010376|Ga0126381_102279510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
| 3300010376|Ga0126381_102834472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300010376|Ga0126381_104991811 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010396|Ga0134126_12106287 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300011120|Ga0150983_10681299 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300011120|Ga0150983_13555811 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300011270|Ga0137391_10824240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
| 3300011270|Ga0137391_11048912 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012181|Ga0153922_1080203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300012203|Ga0137399_11574517 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012285|Ga0137370_10325028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. | 922 | Open in IMG/M |
| 3300012361|Ga0137360_10511399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1023 | Open in IMG/M |
| 3300012361|Ga0137360_10832002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300012683|Ga0137398_11205767 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012922|Ga0137394_11558866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
| 3300012927|Ga0137416_10856545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 806 | Open in IMG/M |
| 3300012927|Ga0137416_11484506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300012930|Ga0137407_11836814 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012948|Ga0126375_10841661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 731 | Open in IMG/M |
| 3300012971|Ga0126369_10132160 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300012971|Ga0126369_11436225 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012971|Ga0126369_11520452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 759 | Open in IMG/M |
| 3300012971|Ga0126369_11716981 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012971|Ga0126369_12033806 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012988|Ga0164306_10662107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK307 | 825 | Open in IMG/M |
| 3300016270|Ga0182036_11265751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300016387|Ga0182040_11719392 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300016422|Ga0182039_10813934 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300018006|Ga0187804_10507398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK307 | 542 | Open in IMG/M |
| 3300018468|Ga0066662_10180101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas | 1643 | Open in IMG/M |
| 3300020579|Ga0210407_10833427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300020580|Ga0210403_11033641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300020581|Ga0210399_10214790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-Safj-400b-B2 | 1601 | Open in IMG/M |
| 3300020581|Ga0210399_10437681 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300020581|Ga0210399_10538009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 969 | Open in IMG/M |
| 3300021088|Ga0210404_10846973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300021170|Ga0210400_10961685 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300021178|Ga0210408_11277662 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021405|Ga0210387_11757679 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021432|Ga0210384_11656412 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021439|Ga0213879_10187809 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021478|Ga0210402_10398118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1278 | Open in IMG/M |
| 3300021478|Ga0210402_11572670 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300021559|Ga0210409_11402478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300025898|Ga0207692_10277393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1013 | Open in IMG/M |
| 3300025905|Ga0207685_10767427 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025915|Ga0207693_10516156 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300026359|Ga0257163_1042524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 721 | Open in IMG/M |
| 3300026527|Ga0209059_1309494 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027076|Ga0208860_1029356 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300027326|Ga0209731_1005193 | Mycobacterium avium subsp. paratuberculosis → Mycobacterium avium subsp. paratuberculosis K-10 | 1606 | Open in IMG/M |
| 3300027381|Ga0208983_1055604 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027502|Ga0209622_1062466 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027583|Ga0209527_1083004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 720 | Open in IMG/M |
| 3300027643|Ga0209076_1104799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 802 | Open in IMG/M |
| 3300027651|Ga0209217_1055487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300027701|Ga0209447_10074020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 934 | Open in IMG/M |
| 3300027812|Ga0209656_10385509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300027874|Ga0209465_10018999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3153 | Open in IMG/M |
| 3300027903|Ga0209488_11011109 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027908|Ga0209006_11395258 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031057|Ga0170834_101611819 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031122|Ga0170822_13288546 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300031128|Ga0170823_12880419 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031545|Ga0318541_10717837 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031561|Ga0318528_10467671 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031573|Ga0310915_10526705 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031680|Ga0318574_10316417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 908 | Open in IMG/M |
| 3300031682|Ga0318560_10442359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300031724|Ga0318500_10236230 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300031744|Ga0306918_10309157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1219 | Open in IMG/M |
| 3300031748|Ga0318492_10162709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1130 | Open in IMG/M |
| 3300031748|Ga0318492_10483478 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031751|Ga0318494_10308044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 914 | Open in IMG/M |
| 3300031770|Ga0318521_10271709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 993 | Open in IMG/M |
| 3300031770|Ga0318521_10330116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300031771|Ga0318546_10371311 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300031771|Ga0318546_10532466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK307 | 825 | Open in IMG/M |
| 3300031797|Ga0318550_10587300 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031798|Ga0318523_10655874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300031832|Ga0318499_10363948 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300031835|Ga0318517_10183519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK307 | 941 | Open in IMG/M |
| 3300031912|Ga0306921_11962836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300031941|Ga0310912_10903963 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031942|Ga0310916_10197728 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300031946|Ga0310910_10279077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300031946|Ga0310910_10910794 | Not Available | 689 | Open in IMG/M |
| 3300031946|Ga0310910_11258467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300031962|Ga0307479_11275784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300032039|Ga0318559_10206238 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300032041|Ga0318549_10169470 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300032051|Ga0318532_10349173 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032059|Ga0318533_10757577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300032068|Ga0318553_10721150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300032076|Ga0306924_10142860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2737 | Open in IMG/M |
| 3300032076|Ga0306924_11374332 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300032261|Ga0306920_100293937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2420 | Open in IMG/M |
| 3300032261|Ga0306920_103644781 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300033289|Ga0310914_10092289 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12662J13196_10186171 | 3300001081 | Forest Soil | PGYVDTVVRRWQALTGGSALHAISGRSFDDLAREAEVADAA* |
| JGI12053J15887_104075641 | 3300001661 | Forest Soil | AYVDTIIRRWQKLTLDTAQHAESGRIFDDLAQEAEAADVA* |
| JGI12627J18819_104139381 | 3300001867 | Forest Soil | AYVDTVVRRWQALTGGNARHAVSGRNFDDLAREAEAADAV* |
| JGIcombinedJ26739_1007665841 | 3300002245 | Forest Soil | DTIVRRWQALTGGSARHAASDRCFDDLADEAEAADAT* |
| Ga0063454_1006989511 | 3300004081 | Soil | LLKLIHWRVDTGLHRWQALTGGTARHAVSGRSFDDLAAEVGAADV* |
| Ga0062387_1014524622 | 3300004091 | Bog Forest Soil | AYVDTIVRRWQVLTGGSARHAANGRSFDDLAGETEVADVA* |
| Ga0066684_110927121 | 3300005179 | Soil | YVDTIVRRWQKLSGGSALHGIGGRSFDDLAREAEVANAA* |
| Ga0066685_110125041 | 3300005180 | Soil | GHLDTAMRRWQALTGGSARHAASGRSFDDLADEAEAADAA* |
| Ga0066671_110106192 | 3300005184 | Soil | TIVRRWQKLTGNTARHAETGRAFDDLASEASEAEVADAA* |
| Ga0070710_105536113 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YVDTTVRRWQAQTGGSARHAASGRSFDDLASEAEATHAA* |
| Ga0066661_108607582 | 3300005554 | Soil | VDAIVRRWQALTRGSARHGVTGRSFDDFGREAQVVNAA* |
| Ga0066692_107197663 | 3300005555 | Soil | AIRRWQALTGGNARHLASDRSFDDLADEAEAADAG* |
| Ga0066670_105676673 | 3300005560 | Soil | YVDTIIRRWQKLTGGSALHSASGRSFDDLADDMETADAA* |
| Ga0066699_104355813 | 3300005561 | Soil | IRRWEALTGGSARHAATSRSFDDLAREMEAANAV* |
| Ga0070763_104272964 | 3300005610 | Soil | VRRWQALTGGSARHAVSGRSFDDLAREAEAGNAV* |
| Ga0066903_1063414683 | 3300005764 | Tropical Forest Soil | AYVDTTIRRWQRLTGGRVRHAASGCSFDDLAREAEPGHAL* |
| Ga0074062_100108152 | 3300006606 | Soil | YVDTAIRRWQALTGGTACHTVSGRHFDDLADEAEAADAA* |
| Ga0066660_113358172 | 3300006800 | Soil | YVDPIVRRWQKLSGGSALHGVSGRSFDELAREAEAANAA* |
| Ga0099829_104679551 | 3300009038 | Vadose Zone Soil | LDGQWRWQKLTGGIARHAETGHAFDDLAGEAEVANAA* |
| Ga0066709_1019418863 | 3300009137 | Grasslands Soil | YVDTTVRRWQVHTGGSARHAMSGRSFDDLACEAEAADAA* |
| Ga0099792_100425013 | 3300009143 | Vadose Zone Soil | SAYVDTIVRRWQALTGGNALHSTSGRRFDDLAREVEVADAA* |
| Ga0075423_110741921 | 3300009162 | Populus Rhizosphere | AIRRWQVLTGGKARHAASGSHFDDLAGEAEAANAV* |
| Ga0126374_115846361 | 3300009792 | Tropical Forest Soil | IRRWQALIGASTRHAASGRSFDDFAREAEAANAR* |
| Ga0126380_102655473 | 3300010043 | Tropical Forest Soil | VDTIVRRWQALTGGSAHHAGSGRSFDDLTRDTEAANAV* |
| Ga0126373_122888043 | 3300010048 | Tropical Forest Soil | TIRRWQALTGGSARHAASGRSFDDLAREAEADNAL* |
| Ga0099796_100495013 | 3300010159 | Vadose Zone Soil | VRRWQKLTGGSARHAASGRSFDDLAREVEVANAA* |
| Ga0074044_107930141 | 3300010343 | Bog Forest Soil | IRRWQALTGGSARHAASGRSFDDLTREAEAANAA* |
| Ga0126370_112390283 | 3300010358 | Tropical Forest Soil | VDTIIRRWQTATGGRARHAASGRAFDDLADEAEATNAA* |
| Ga0126372_106230221 | 3300010360 | Tropical Forest Soil | TIRRWQALTGGSARHAASGCSFDDLAGEAEAADVR* |
| Ga0126378_110583561 | 3300010361 | Tropical Forest Soil | DRLYVDTIIRRWQALTVGSAIQVSSGRCFDELSREAEAAHAV* |
| Ga0126378_129388962 | 3300010361 | Tropical Forest Soil | IVRRWQALTGGSARHAASGRTFDDLVREPETADAR* |
| Ga0126379_134782722 | 3300010366 | Tropical Forest Soil | DTTIRRWQKLTGGSARHAASGRSFDDLACEAEAAHAA* |
| Ga0126381_1016835903 | 3300010376 | Tropical Forest Soil | TIIRRWQAQTGEWAHHASSGRSFDDLARELEAGNGK* |
| Ga0126381_1022795101 | 3300010376 | Tropical Forest Soil | TIRRWQALTGGSARHAASGRSFDDLAREAEADNAD* |
| Ga0126381_1028344723 | 3300010376 | Tropical Forest Soil | IIRRWQRLTGGSACHAASGRGFDDLAQEAEAANAV* |
| Ga0126381_1049918112 | 3300010376 | Tropical Forest Soil | VYTAIRRWQSLTGDQARHAATGRPFDDLVCEAEAANAA* |
| Ga0134126_121062873 | 3300010396 | Terrestrial Soil | DTSVRRWQKLTGGSARHAASGRSFDDLAREAEVANAA* |
| Ga0150983_106812991 | 3300011120 | Forest Soil | LSLAITRRCVGVDTIIRRWQAPAGASGRHVASSRDFVDLAREAEVANAA* |
| Ga0150983_135558111 | 3300011120 | Forest Soil | IRRWQVLTGGKARHAASGHLFDDLAGEAEAADVV* |
| Ga0137391_108242402 | 3300011270 | Vadose Zone Soil | DTIIRRWQKLTGNSGRHAENGRTFDDLASEAEVADAA* |
| Ga0137391_110489123 | 3300011270 | Vadose Zone Soil | YVDTIIRRWQRLFGRSARHAVSNRTFDDLVREAEVIDAL* |
| Ga0153922_10802031 | 3300012181 | Attine Ant Fungus Gardens | IIRRWQKLFGGVALHAESGRSFDELACEAEVADAA* |
| Ga0137399_115745172 | 3300012203 | Vadose Zone Soil | DTAIRRWQVLTGGKARHAASGRLFDDLAGEAEAPDAA* |
| Ga0137370_103250281 | 3300012285 | Vadose Zone Soil | PAYADTIVRRWQTLTGGSARHSASGLSFDDLVCEAEAANAA* |
| Ga0137360_105113991 | 3300012361 | Vadose Zone Soil | MDTIVLRWQALTGETACHAVSGGSFDDLAREAEVVDAA* |
| Ga0137360_108320021 | 3300012361 | Vadose Zone Soil | GGATAWSSIPAMVDTIVRRWQALSGGSARHALSGRNFDDLAREAEAANAA* |
| Ga0137398_112057672 | 3300012683 | Vadose Zone Soil | DTIIRRWQKLTGDIARHAESGRSFADLTSEGEVTDAV* |
| Ga0137394_115588662 | 3300012922 | Vadose Zone Soil | MELDPVFVDTAILRWQALTGGKAHHAAGGHLFDDLAGEAEATDAV* |
| Ga0137416_108565453 | 3300012927 | Vadose Zone Soil | AIRRWQALTGGHARHGASGRSFDDLADEAEAADAA* |
| Ga0137416_114845061 | 3300012927 | Vadose Zone Soil | DTVVLRWQRLTGGSALHAVSSRSFDDLADEAEAADAT* |
| Ga0137407_118368141 | 3300012930 | Vadose Zone Soil | TLVRRWQTVSGGTARHAASGQDFDDLAREAEVANAA* |
| Ga0126375_108416613 | 3300012948 | Tropical Forest Soil | LLWARARPGYVDTAIRRWQNLTGDQARHAATERSFDDLVREAEAANAA* |
| Ga0126369_101321601 | 3300012971 | Tropical Forest Soil | VYVDTIVRRWQALTGGSARHAASGRTFDDLVREPETADAR* |
| Ga0126369_114362251 | 3300012971 | Tropical Forest Soil | MRRWQTLTGDRARRAATGRLFDDLVREAEAANAA* |
| Ga0126369_115204521 | 3300012971 | Tropical Forest Soil | IVRRWQKQTGGSARHAPSGRSFDDLAREAEVANAA* |
| Ga0126369_117169813 | 3300012971 | Tropical Forest Soil | TTIRRWQALTGGSARHAASGSSFDDLAREAEAVNVA* |
| Ga0126369_120338063 | 3300012971 | Tropical Forest Soil | VDTIVRRWQKRTAGSARHAVSDRGFDDLAREAGVANAA* |
| Ga0164306_106621071 | 3300012988 | Soil | YVDTSVRRWQKLTGGSARHAASGRSFDDLAREAEVANAA* |
| Ga0182036_112657511 | 3300016270 | Soil | IIRRWQGLTGGRAYHATSGRGFDDLSQEVEAANAG |
| Ga0182040_117193922 | 3300016387 | Soil | GYVDTAIRRWQTLTGDKARHAVTGCYFDDLVREGEAANAA |
| Ga0182039_108139341 | 3300016422 | Soil | TAIRRWQTLTGDKARHAATVRSFDDLVCEAEAANAA |
| Ga0187804_105073982 | 3300018006 | Freshwater Sediment | VDTIIRRWQIFTGDAAIHAMTGKRFDDLAREAEARHD |
| Ga0066662_101801011 | 3300018468 | Grasslands Soil | DPGYVDTIVRRWQKLSGGSALHGMSGRSFDERARDAEVANAA |
| Ga0210407_108334273 | 3300020579 | Soil | AISRWQALTGGKARHAASGRSFDDLAGEAEVVDVV |
| Ga0210403_110336412 | 3300020580 | Soil | VDTIVRRWQTLTGGSARHAASGRTFDDLTREPEPADAR |
| Ga0210399_102147902 | 3300020581 | Soil | VGVDTIIRRWQALTGASARHVASSRDFVDLAREAEVANAA |
| Ga0210399_104376813 | 3300020581 | Soil | DAGYVDTTVRRWQALTGEKARHAISGRSFDDLADEAEAADAAR |
| Ga0210399_105380093 | 3300020581 | Soil | YVDTIVRRWQALTGGSAHHAASGGNFDDLAREAEATNAT |
| Ga0210404_108469732 | 3300021088 | Soil | IDTAIRRWQGLTGGTARHAANGRSFDDLAREAEAANAV |
| Ga0210400_109616851 | 3300021170 | Soil | GLARIRRWQAPAGASGRHVASSRDFVDLARDAEVANAA |
| Ga0210408_112776622 | 3300021178 | Soil | PAYVDTILRRWQALTGGSARHAASGRSFDDLTREAEVANAA |
| Ga0210387_117576792 | 3300021405 | Soil | VTGFEIGEIRRWQTLTGDQARHAATGRSFDDLVREAEAANAAG |
| Ga0210384_116564121 | 3300021432 | Soil | VDTAIRRWQTLTGDKARQADTGRYFDDLASTVEATNAV |
| Ga0213879_101878091 | 3300021439 | Bulk Soil | GYVDTIIRRWQVLTGGNACHAASGRRFDDLACEAEGANAA |
| Ga0210402_103981181 | 3300021478 | Soil | TAIRRWQALTGGKAHYAAGGRLFDDLAGEAEATDGV |
| Ga0210402_115726701 | 3300021478 | Soil | VDTIIRRWQALTGASARHVASSRDFVDLAREAEVANAA |
| Ga0210409_114024783 | 3300021559 | Soil | AIRRWQTLTGGNARHVASDRSFDDLADEAEAADAG |
| Ga0207692_102773931 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GYVDTIVRRWQKLSGGSALHGISGRSFDDLAREAEVANAA |
| Ga0207685_107674272 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | DTIVRRWQALTGGSAHHAASGCNFDDLAREAEATNAT |
| Ga0207693_105161564 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TSVRRWQKLTGGSARHAASGRSFDDLAREAEVADAA |
| Ga0257163_10425241 | 3300026359 | Soil | YVDTSVRRWQKLTGGRARHATSGRSFDDLAREAEAANAA |
| Ga0209059_13094941 | 3300026527 | Soil | AYVDTSVRRWQKLTGGSARHAASGRSFDDLAREAEVANAA |
| Ga0208860_10293563 | 3300027076 | Forest Soil | DTIVRRWQALTGGSARHSASGRSFDDLACEAEAGDAD |
| Ga0209731_10051932 | 3300027326 | Forest Soil | AAYVDTIIRRWQAQIGRSARHATNGRSFDDLAREAEAPDAA |
| Ga0208983_10556042 | 3300027381 | Forest Soil | DTIIRRWQKLTGNVARHAETGRAFDDLAGEAEVANAA |
| Ga0209622_10624663 | 3300027502 | Forest Soil | AIRRWQTLTGDQARHAATGRSFDDLVREAEAANAA |
| Ga0209527_10830043 | 3300027583 | Forest Soil | TIVCRWQKLSGGSALNAISGRRFDDLAREAEVANAA |
| Ga0209076_11047991 | 3300027643 | Vadose Zone Soil | DTIVRRWQKLSGGSALHGISGRSFDDLAREAEVANAA |
| Ga0209217_10554873 | 3300027651 | Forest Soil | VYVDTAIRRWQALTGEKARQAASGSYFDDLADEAEAANAA |
| Ga0209447_100740201 | 3300027701 | Bog Forest Soil | GYVDTIIRRWQKLTGGSALHSESGRNFDDLADDMEAADAAA |
| Ga0209656_103855093 | 3300027812 | Bog Forest Soil | DAIIRRWQALTGGTARHAVNGRAFDDLAGDMEVGDAA |
| Ga0209465_100189995 | 3300027874 | Tropical Forest Soil | TIVRRWQKLTGGSARHAVSDRGFDDLAREAGVADAA |
| Ga0209488_110111091 | 3300027903 | Vadose Zone Soil | VDTIIRRWQKLTGGTARHAEHGRTFDNLASEAEVRDAA |
| Ga0209006_113952581 | 3300027908 | Forest Soil | WLDVDTIIRRWQAQTGGRACHAASGRSFDDLAAEAEAANAR |
| Ga0170834_1016118192 | 3300031057 | Forest Soil | DTVVRRWQALTGGSALHAISGRSFDDLAREAEVADAA |
| Ga0170822_132885464 | 3300031122 | Forest Soil | LDTTIRRWQKLTGGSARHAATSRIYDDLAREAEVTNAA |
| Ga0170823_128804193 | 3300031128 | Forest Soil | YVDTSVRRWQALTGEKARHAISGSRFDDLADQAEAADAAR |
| Ga0318541_107178372 | 3300031545 | Soil | DTTVRRWQTLTGGRARYATSGRSFDDLAREAEAANAP |
| Ga0318528_104676711 | 3300031561 | Soil | VDATVRRWQTLSGRSALHRVSGRSFDDLTREAEVAHAA |
| Ga0310915_105267053 | 3300031573 | Soil | TTIRRWQALTGGSARHAASGSSFDDLAREVEAGNVA |
| Ga0318574_103164172 | 3300031680 | Soil | VDTAIRRWQALTGESALHAASARSFADLAREAEVADVA |
| Ga0318560_104423593 | 3300031682 | Soil | TVRRWQALTGEKARHAISGRSFDDLADEAEAADAVR |
| Ga0318500_102362301 | 3300031724 | Soil | GYVDTAIRRWQTLTGDKARHAATGRYFDDLVREAEAANAV |
| Ga0306918_103091573 | 3300031744 | Soil | VDTIIRRWQGLTGGSADHAASGRGFDDLAREAEAANG |
| Ga0318492_101627093 | 3300031748 | Soil | VYVDTIIRRWQKLSGGSAVHGISGRSFDDLARQAEVANAA |
| Ga0318492_104834782 | 3300031748 | Soil | AVRRWQALTGDEARHAANGRSFDDLAAEAEVAHAVR |
| Ga0318494_103080441 | 3300031751 | Soil | AVRRWQSLTGDEARHAANGRSFDDLAAEAEVAHAAR |
| Ga0318521_102717091 | 3300031770 | Soil | TIIRRWQGLTGGSADHAASGRGFDDLAREAEAANG |
| Ga0318521_103301163 | 3300031770 | Soil | VDTILRRWQALTGGSARHAVSGRSFDDLVREAEAANGI |
| Ga0318546_103713111 | 3300031771 | Soil | YVDATVRRWQTLSGRSALHGVSGRSFDDLTREAEVAHAA |
| Ga0318546_105324661 | 3300031771 | Soil | DTIIRRWQGLTGGSADHAMSGRGFDDLAREAEAANG |
| Ga0318550_105873002 | 3300031797 | Soil | PGHTDTAVRRWQSLTGDEARHAANGRSFDDLAAEAEVAHAAR |
| Ga0318523_106558742 | 3300031798 | Soil | VDTVIRRWQGLTGGSARHATNGRNFDDLAREAEAANAV |
| Ga0318499_103639482 | 3300031832 | Soil | TDTAVRRWQALTGDEARHAANGRSFDDLAAEAEVAHAVR |
| Ga0318517_101835191 | 3300031835 | Soil | AYVDTAIRRWQVLTGESALHATSDRSFADLAREAEVADVA |
| Ga0306921_119628363 | 3300031912 | Soil | YVDTAIRRWQALTGESARNAATGRLFDDLAREAEVADAV |
| Ga0310912_109039631 | 3300031941 | Soil | GYVDTAIRRWQTLTGDQAQHAATGRSFDDLVPEAEAANAA |
| Ga0310916_101977281 | 3300031942 | Soil | AIRRWQALTGGKARHAESGRSFDDLAAEAEAANAG |
| Ga0310910_102790773 | 3300031946 | Soil | LDAGYVDTTVRRWQALTGEKARHAISGRSFDDLADEAEAADAAR |
| Ga0310910_109107941 | 3300031946 | Soil | YADTVIRRWQTLTGGSARHAASGRNFADLTREAEATNAV |
| Ga0310910_112584672 | 3300031946 | Soil | RYVDTAIRRWQTLTGEVAHHGVSGRSFDDLAREAEVVDAA |
| Ga0307479_112757841 | 3300031962 | Hardwood Forest Soil | YVDTAIRRWQVLTGGKARHAASGRLFDDLAGEAEAANAV |
| Ga0318559_102062383 | 3300032039 | Soil | PGYVDTAIRRWQTLTGDKARHGATGHYFDDLVREAEAANAV |
| Ga0318549_101694701 | 3300032041 | Soil | TTIRRWQALTGGSARHAASGSSFDDLAREAEAGNVA |
| Ga0318532_103491732 | 3300032051 | Soil | DTIVRRWQALTSGSARHATNGRNFGDLARKPEAASAA |
| Ga0318533_107575773 | 3300032059 | Soil | ILRRWQALTGGSARHAVSGRSFDDLVREAEAANGI |
| Ga0318553_107211501 | 3300032068 | Soil | DTTIRRWQALTGGSACHAESGRSFDDLAGETEAADVR |
| Ga0306924_101428601 | 3300032076 | Soil | VDTAIRRWQALTGESVLHAANGRSFADLAREAEVADVA |
| Ga0306924_113743323 | 3300032076 | Soil | VDTAIRRWQALTGESARNAATGRLFDDLAREAEVADAV |
| Ga0306920_1002939371 | 3300032261 | Soil | LDPTHVDAISRRWETLTGGSARHAASGRSLDDLAREVEAANAA |
| Ga0306920_1036447811 | 3300032261 | Soil | YVDTIIRRWQKLSGGSAVHGISGRSFDDLARQAEVANAA |
| Ga0310914_100922893 | 3300033289 | Soil | DTAIRRWQTLTGDKARHAATGCYFDDLVREAEAANAAG |
| ⦗Top⦘ |