| Basic Information | |
|---|---|
| Family ID | F060795 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AILGSIVVGLTSWLASAFVGGSGRIERYRRIEVTGRRLD |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 96.97 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.152 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.485 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.576 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF04241 | DUF423 | 26.52 |
| PF09594 | GT87 | 21.21 |
| PF01168 | Ala_racemase_N | 10.61 |
| PF14031 | D-ser_dehydrat | 6.06 |
| PF13489 | Methyltransf_23 | 3.79 |
| PF13430 | DUF4112 | 1.52 |
| PF00557 | Peptidase_M24 | 1.52 |
| PF00563 | EAL | 0.76 |
| PF04020 | Phage_holin_4_2 | 0.76 |
| PF11075 | DUF2780 | 0.76 |
| PF02743 | dCache_1 | 0.76 |
| PF07021 | MetW | 0.76 |
| PF01264 | Chorismate_synt | 0.76 |
| PF13429 | TPR_15 | 0.76 |
| PF11141 | DUF2914 | 0.76 |
| PF02223 | Thymidylate_kin | 0.76 |
| PF00106 | adh_short | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 26.52 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.76 |
| COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.76 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.76 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.76 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.76 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.76 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.76 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.15 % |
| Unclassified | root | N/A | 9.09 % |
| Polyangium | genus | Polyangium | 0.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10513173 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300002562|JGI25382J37095_10057794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1476 | Open in IMG/M |
| 3300002907|JGI25613J43889_10040776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1315 | Open in IMG/M |
| 3300002911|JGI25390J43892_10015845 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300002911|JGI25390J43892_10022792 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300002911|JGI25390J43892_10049990 | Not Available | 988 | Open in IMG/M |
| 3300005171|Ga0066677_10609977 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005179|Ga0066684_10845730 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005187|Ga0066675_11396119 | Not Available | 513 | Open in IMG/M |
| 3300005437|Ga0070710_10430937 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005445|Ga0070708_100966860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
| 3300005445|Ga0070708_101518353 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005446|Ga0066686_10028774 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
| 3300005446|Ga0066686_10966684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. AP07 | 555 | Open in IMG/M |
| 3300005446|Ga0066686_11104101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300005450|Ga0066682_10902585 | Not Available | 526 | Open in IMG/M |
| 3300005451|Ga0066681_10045426 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
| 3300005536|Ga0070697_100924026 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005536|Ga0070697_101591291 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005549|Ga0070704_102281176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300005555|Ga0066692_10914481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
| 3300005557|Ga0066704_10017658 | All Organisms → cellular organisms → Bacteria | 4140 | Open in IMG/M |
| 3300005558|Ga0066698_10547493 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005576|Ga0066708_10046417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2413 | Open in IMG/M |
| 3300005576|Ga0066708_10114101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1622 | Open in IMG/M |
| 3300005576|Ga0066708_10421544 | Not Available | 856 | Open in IMG/M |
| 3300005598|Ga0066706_10093405 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
| 3300005598|Ga0066706_11532914 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
| 3300006032|Ga0066696_10485868 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006034|Ga0066656_10012405 | All Organisms → cellular organisms → Bacteria | 4352 | Open in IMG/M |
| 3300006046|Ga0066652_100266973 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300006755|Ga0079222_10993140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 720 | Open in IMG/M |
| 3300006796|Ga0066665_10789235 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300006797|Ga0066659_10016336 | All Organisms → cellular organisms → Bacteria | 4136 | Open in IMG/M |
| 3300006797|Ga0066659_10824741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 769 | Open in IMG/M |
| 3300006797|Ga0066659_11073631 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300006804|Ga0079221_10877171 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006852|Ga0075433_11454290 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006871|Ga0075434_100006027 | All Organisms → cellular organisms → Bacteria | 11090 | Open in IMG/M |
| 3300006904|Ga0075424_100700493 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300006918|Ga0079216_10085782 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300006954|Ga0079219_11882678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 564 | Open in IMG/M |
| 3300007255|Ga0099791_10392809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 667 | Open in IMG/M |
| 3300007258|Ga0099793_10004774 | All Organisms → cellular organisms → Bacteria | 4844 | Open in IMG/M |
| 3300009012|Ga0066710_101280327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1137 | Open in IMG/M |
| 3300009090|Ga0099827_11597179 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300009137|Ga0066709_100798116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1367 | Open in IMG/M |
| 3300009137|Ga0066709_102588174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 680 | Open in IMG/M |
| 3300009137|Ga0066709_103751194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300009143|Ga0099792_10148428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1289 | Open in IMG/M |
| 3300009147|Ga0114129_10418757 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300009162|Ga0075423_10406509 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300009822|Ga0105066_1099596 | Not Available | 641 | Open in IMG/M |
| 3300010128|Ga0127486_1174344 | Not Available | 521 | Open in IMG/M |
| 3300010304|Ga0134088_10625290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300010325|Ga0134064_10445440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
| 3300010329|Ga0134111_10503389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 532 | Open in IMG/M |
| 3300010333|Ga0134080_10151977 | Not Available | 982 | Open in IMG/M |
| 3300010335|Ga0134063_10196358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 949 | Open in IMG/M |
| 3300010335|Ga0134063_10454871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 635 | Open in IMG/M |
| 3300010337|Ga0134062_10350823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 711 | Open in IMG/M |
| 3300010337|Ga0134062_10521792 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 600 | Open in IMG/M |
| 3300010401|Ga0134121_12880516 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300010403|Ga0134123_11208486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 786 | Open in IMG/M |
| 3300012159|Ga0137344_1041231 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012198|Ga0137364_10544166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 874 | Open in IMG/M |
| 3300012203|Ga0137399_10122871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2042 | Open in IMG/M |
| 3300012203|Ga0137399_10174799 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1730 | Open in IMG/M |
| 3300012203|Ga0137399_10679408 | Not Available | 867 | Open in IMG/M |
| 3300012211|Ga0137377_10983839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 775 | Open in IMG/M |
| 3300012285|Ga0137370_10288641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 978 | Open in IMG/M |
| 3300012350|Ga0137372_10300559 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300012351|Ga0137386_10836924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 661 | Open in IMG/M |
| 3300012356|Ga0137371_10411405 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300012356|Ga0137371_10435549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1015 | Open in IMG/M |
| 3300012357|Ga0137384_11025584 | All Organisms → cellular organisms → Bacteria → FCB group | 663 | Open in IMG/M |
| 3300012362|Ga0137361_10728220 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300012683|Ga0137398_11058013 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012683|Ga0137398_11236406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 509 | Open in IMG/M |
| 3300012924|Ga0137413_11564613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300012929|Ga0137404_11201644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300012930|Ga0137407_11296422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 692 | Open in IMG/M |
| 3300012972|Ga0134077_10467178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 554 | Open in IMG/M |
| 3300012975|Ga0134110_10192415 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 854 | Open in IMG/M |
| 3300015052|Ga0137411_1217278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 995 | Open in IMG/M |
| 3300015264|Ga0137403_10869993 | Polyangium → Polyangium fumosum | 752 | Open in IMG/M |
| 3300015358|Ga0134089_10041354 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1658 | Open in IMG/M |
| 3300017654|Ga0134069_1020501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1981 | Open in IMG/M |
| 3300017659|Ga0134083_10604485 | All Organisms → cellular organisms → Bacteria → FCB group | 502 | Open in IMG/M |
| 3300018027|Ga0184605_10491747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 535 | Open in IMG/M |
| 3300018054|Ga0184621_10194737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300018431|Ga0066655_11253178 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300018433|Ga0066667_10227799 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300018482|Ga0066669_11081124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 724 | Open in IMG/M |
| 3300019879|Ga0193723_1000250 | All Organisms → cellular organisms → Bacteria | 20205 | Open in IMG/M |
| 3300019883|Ga0193725_1000137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 24082 | Open in IMG/M |
| 3300019998|Ga0193710_1021720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 659 | Open in IMG/M |
| 3300020004|Ga0193755_1195973 | Not Available | 580 | Open in IMG/M |
| 3300021510|Ga0222621_1002939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2758 | Open in IMG/M |
| 3300024330|Ga0137417_1498617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4008 | Open in IMG/M |
| 3300025403|Ga0208745_1051095 | Not Available | 617 | Open in IMG/M |
| 3300026295|Ga0209234_1041817 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300026296|Ga0209235_1171755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 816 | Open in IMG/M |
| 3300026298|Ga0209236_1169728 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300026306|Ga0209468_1200746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 506 | Open in IMG/M |
| 3300026308|Ga0209265_1032624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1610 | Open in IMG/M |
| 3300026309|Ga0209055_1126583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 954 | Open in IMG/M |
| 3300026310|Ga0209239_1031860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2500 | Open in IMG/M |
| 3300026313|Ga0209761_1048389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2398 | Open in IMG/M |
| 3300026314|Ga0209268_1149085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 574 | Open in IMG/M |
| 3300026326|Ga0209801_1025329 | All Organisms → cellular organisms → Bacteria | 2862 | Open in IMG/M |
| 3300026328|Ga0209802_1114067 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300026328|Ga0209802_1250755 | All Organisms → cellular organisms → Bacteria → FCB group | 608 | Open in IMG/M |
| 3300026530|Ga0209807_1274327 | Not Available | 569 | Open in IMG/M |
| 3300026530|Ga0209807_1311563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 534 | Open in IMG/M |
| 3300026537|Ga0209157_1212006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 805 | Open in IMG/M |
| 3300026538|Ga0209056_10138026 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300027573|Ga0208454_1134872 | Not Available | 578 | Open in IMG/M |
| 3300027633|Ga0208988_1117706 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300027725|Ga0209178_1061636 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300027882|Ga0209590_10266565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1095 | Open in IMG/M |
| 3300028536|Ga0137415_10623210 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300028536|Ga0137415_11429077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 514 | Open in IMG/M |
| 3300028719|Ga0307301_10152362 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300028884|Ga0307308_10213360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 925 | Open in IMG/M |
| 3300031199|Ga0307495_10119225 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031226|Ga0307497_10079855 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300032829|Ga0335070_10128376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2610 | Open in IMG/M |
| 3300033407|Ga0214472_10690757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300033806|Ga0314865_152272 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300034090|Ga0326723_0370203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 648 | Open in IMG/M |
| 3300034178|Ga0364934_0397479 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.76% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025403 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_105131733 | 3300001593 | Forest Soil | LAATVGAIIVGLTGWLGSAFVGGSGRIERIQRVEVTGRRLDG* |
| JGI25382J37095_100577943 | 3300002562 | Grasslands Soil | LSGLGSAILASIVVGLTSWVASAFVGGSGRIERYRRIEVTGRRLD* |
| JGI25613J43889_100407761 | 3300002907 | Grasslands Soil | PATLGAVIVSLTSWVASAFVGGSGRLERMKRVEVTGRRIDG* |
| JGI25390J43892_100158451 | 3300002911 | Grasslands Soil | SGLGAAVLGSIVVGLTGWCASAFVGGSGKIERYRRVEVTGRHLA* |
| JGI25390J43892_100227921 | 3300002911 | Grasslands Soil | AVLGSIVVGLTSWFASTFIGGSGRIEHIRRIEVTGRRID* |
| JGI25390J43892_100499901 | 3300002911 | Grasslands Soil | SATWGAIIVSLTSWVASHFVGGSGRIERLKRVEVTGRRIDG* |
| Ga0066677_106099773 | 3300005171 | Soil | AVLGSIVVGLTGWFASAFVGGSGRIERYRRIEVTGRQLD* |
| Ga0066684_108457302 | 3300005179 | Soil | SVSGLGAAVLGSIVVGLTGWFASAFVGGSGRIERYRRIEVTGRQLD* |
| Ga0066675_113961192 | 3300005187 | Soil | SGLGAAVLGSIVVGLTGWCASAFVGGSGKIERYRRVEVTGRHLD* |
| Ga0070710_104309373 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | FTLSGLGSAILGSVIVGLTSWCASTFVGGSGRIERYRRRIEVTGGSRRLD* |
| Ga0070708_1009668603 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PAILGSVIVGLTSWFASTFVGGSGRIERYRRRIEVTGGSRRLD* |
| Ga0070708_1015183532 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSATLGACVVGLTSWFASAFVGGSGRIERIRRVEVSGRQIE* |
| Ga0066686_100287741 | 3300005446 | Soil | GFVVSGLGSATLGAIIVGLTSWAASHFIGGSGRIERMKRVEVSGRRIDG* |
| Ga0066686_109666842 | 3300005446 | Soil | VIPAFTISGLGAAILGSIVVGLTSWLGSAFVGGSGRIERYRRIEVSGRRLD* |
| Ga0066686_111041011 | 3300005446 | Soil | GSATLGAIIVGLTSWAASHFIGGSGRIERMKRVEASGRRIDA* |
| Ga0066682_109025852 | 3300005450 | Soil | GFSLAGLWAAILTSIVVGLTSWCASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0066681_100454263 | 3300005451 | Soil | GLVPAVLGSIVVGLTGWFASTFVGGSGRIERIRHIAVTGRRLD* |
| Ga0070697_1009240261 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGMWAAILASIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0070697_1015912911 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PGFTLSGLGSAILGSIIVGLTSWFASTFVGGSGRIERYRRIEVTGRRVD* |
| Ga0070704_1022811762 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLWSATLGAIIVGLTGWAASAFIGGSGKIERMRRIETTGRRLD* |
| Ga0066692_109144812 | 3300005555 | Soil | AAILGSIVVGVTGWFGSMFVGSAGRFERIKRVEVTGRRLE* |
| Ga0066704_100176585 | 3300005557 | Soil | LGPAILGSIIVGLTSWFASTFVGGSGRIERYRRIEVTGRRLD* |
| Ga0066698_105474931 | 3300005558 | Soil | LSGLGAAILGSIVVGLTSWFGSAFVGGSGRIERYRRIEVKGRRLD* |
| Ga0066708_100464173 | 3300005576 | Soil | LGSAILGSIVVGLIGWFASAFVGGSGRIERYRHIEVTGRRID* |
| Ga0066708_101141014 | 3300005576 | Soil | VLGSIVVGVTGWFASAFVGGSGKIERYRRIEVTGRRLD* |
| Ga0066708_104215441 | 3300005576 | Soil | LGSAILGSIVVGLIGWFASAFVGGSGRIERYRHIEVTGRRLD* |
| Ga0066706_100934051 | 3300005598 | Soil | WGAIIVSLTSWVASHFVGGSGRIERLKRVEVTGRRIDG* |
| Ga0066706_115329142 | 3300005598 | Soil | ATWGAIIVSLTSWVASHFVGGSGRIERLKRVEVTGRRIDG* |
| Ga0066696_104858681 | 3300006032 | Soil | IVVGLTGWCASAFVGGSGKIERYRRVEVTGRQLD* |
| Ga0066656_100124056 | 3300006034 | Soil | GFVVSGLGSATLGAIIVGLTSWAASHFIGGSGRIERMKRVEASGRRIDA* |
| Ga0066652_1002669733 | 3300006046 | Soil | GAIIVGLTSWAASHFIGGSGRIERMQRVEVTGRRIDG* |
| Ga0079222_109931402 | 3300006755 | Agricultural Soil | AAILGSIVVGLTSWFASAFVGGSGRIERYRRIEVPGRRLD* |
| Ga0066665_107892352 | 3300006796 | Soil | ALSGLGAAILGSIVVGLTSWFASSFVGGSGRIERYRRIEVKGRRLD* |
| Ga0066659_100163361 | 3300006797 | Soil | PGFHVVSLGSATLGAVIVSLTSWVTSSFIGGTGRIERMHRVEVTGRRIDE* |
| Ga0066659_108247411 | 3300006797 | Soil | IVVGVTGWFGSMFVGSAGRFERIKRVEVTGRRLE* |
| Ga0066659_110736313 | 3300006797 | Soil | IVVGLTGWFASAFVGGSGRIERYRRIEVRGRRVD* |
| Ga0079221_108771713 | 3300006804 | Agricultural Soil | LMPGFELGGLWAAILTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0075433_114542901 | 3300006852 | Populus Rhizosphere | TLGAVVVGLTSWLASAFVGGSGRIERLRHVEVTGRRVDG* |
| Ga0075434_1000060271 | 3300006871 | Populus Rhizosphere | GFHITGLWSATLGAVIVSLTSWVASAFVGGSGRIERMKRVEVTGRRIDE* |
| Ga0075424_1007004931 | 3300006904 | Populus Rhizosphere | FHVAGLWSATGGAIIVSLTSWVASHFIGGSGKIERLNRVEVTGRRIDG* |
| Ga0079216_100857821 | 3300006918 | Agricultural Soil | ATLGAIIVGLTSWAASAFIGSSGRIERMKRVEVTGRRIDG* |
| Ga0079219_118826782 | 3300006954 | Agricultural Soil | AAILASIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0099791_103928091 | 3300007255 | Vadose Zone Soil | LLAATLGACVVGLTGWFASSFVGGSGRIERIRRVEVSGRQID* |
| Ga0099793_100047741 | 3300007258 | Vadose Zone Soil | VLASIVVGLTGWFASTFVGGSGRIEHIRHIEVTGRRLD* |
| Ga0066710_1012803271 | 3300009012 | Grasslands Soil | LSGLGAAILASIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0099827_115971792 | 3300009090 | Vadose Zone Soil | FTLSGLGAAILGSIVVGLTSWLASAFVGGSGRIERFRRIEVPGRRIDE* |
| Ga0066709_1007981161 | 3300009137 | Grasslands Soil | GLWAAILTSIVVGLTSWLASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0066709_1025881742 | 3300009137 | Grasslands Soil | FGAAILGSIVVGLTGWFASMFVGSAGRIERIRRVEVSGRRQE* |
| Ga0066709_1037511942 | 3300009137 | Grasslands Soil | FGAAILGSIVVGLTGWFASMFVGSAGRIERIRRVEVSGRRPE* |
| Ga0099792_101484281 | 3300009143 | Vadose Zone Soil | LTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0114129_104187571 | 3300009147 | Populus Rhizosphere | VPGFHLAGLFAATLAACVVGITSWFASTFVGGSGRIERIRRVEVSGRQVEP* |
| Ga0075423_104065091 | 3300009162 | Populus Rhizosphere | GLFSATLGAIIVSLVSWAASAFVGGSGRIERMHRVEVTGRRVDG* |
| Ga0105066_10995962 | 3300009822 | Groundwater Sand | GSIVVGLTGWLSSAFVGSSGRIERIRRVEVTGRRID* |
| Ga0127486_11743442 | 3300010128 | Grasslands Soil | SLTGLWAAILTSIVVGLTSWVASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0134088_106252901 | 3300010304 | Grasslands Soil | AVLGSIVVGLTGWFASTFVGGSGRIEHIRHIEVTGRRLD* |
| Ga0134064_104454401 | 3300010325 | Grasslands Soil | LVPAVLGSIVVGLTSWFASTFVGGSGRIERIRHVEVTGRRLD* |
| Ga0134111_105033891 | 3300010329 | Grasslands Soil | HVAGLVPAMLGSIVVGLTGWLASTFVGSSGRIEHIRRIEVTGRRLD* |
| Ga0134080_101519772 | 3300010333 | Grasslands Soil | VSGFHVAGLWSATLGAIIVSLTSWVASHFVGGSGRIERMRRVEVTGRRIDG* |
| Ga0134063_101963581 | 3300010335 | Grasslands Soil | SVAGLVPAVLGSIVVGLTGWFASTFVGGSGRIERIRHIEVTGRRLD* |
| Ga0134063_104548711 | 3300010335 | Grasslands Soil | ILGSIIVGLTSWFASTFVGGSGRIERYRRIEVTGRRLD* |
| Ga0134062_103508233 | 3300010337 | Grasslands Soil | AILGSIVVGLTSWLASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0134062_105217922 | 3300010337 | Grasslands Soil | AGLVPAMLGSIVVGLTGWLASTFVGSSGRIEHIRRIEVTGRRLD* |
| Ga0134121_128805162 | 3300010401 | Terrestrial Soil | DLAGLLSATLGACVVGHPSWFASAFVGGSGRIERIRRVEVSGRQIE* |
| Ga0134123_112084861 | 3300010403 | Terrestrial Soil | AIIVGLTGWAASAFIGGSGKIERMQRIETTGRRLD* |
| Ga0137344_10412312 | 3300012159 | Soil | GACVVGLTSWFASAFVGGSGRIERIRRVEVSGRQIE* |
| Ga0137364_105441661 | 3300012198 | Vadose Zone Soil | TLGAVVVGLTSWFASAFVGGSGRIERMRRVEVTGRRIDH* |
| Ga0137399_101228714 | 3300012203 | Vadose Zone Soil | VPGFWVSGLGSATVGALIVGLTSWVASAFIGSSGRIERMKRVEVTGRRLDG* |
| Ga0137399_101747993 | 3300012203 | Vadose Zone Soil | AWLMPGFSLSGLGAAILASIVVGLTSWCASAFVGGSGQIERYRRIEVTGRRPD* |
| Ga0137399_106794082 | 3300012203 | Vadose Zone Soil | SATVGAIIVGLTSWGASAFIGGSGRIERLKRVEVTGRRIDA* |
| Ga0137377_109838392 | 3300012211 | Vadose Zone Soil | IVVGLTGWFASTFVGGSGRIERIRHIEVTGRRLD* |
| Ga0137370_102886411 | 3300012285 | Vadose Zone Soil | TGLWAAILTSIVVGLTSWVASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0137372_103005592 | 3300012350 | Vadose Zone Soil | VVGLTGWLASAFVGGSGRIEHIRRVEVTGRRLDG* |
| Ga0137386_108369243 | 3300012351 | Vadose Zone Soil | GLGAAILGSVVVGLTSWLASTFIGSSGRLEHIRRVEVRGRRVD* |
| Ga0137371_104114053 | 3300012356 | Vadose Zone Soil | WLVPGFHIAGLRPATLGAIIVGFTSWAASAFVGGSGRIERMKRVEVTGRRIEE* |
| Ga0137371_104355492 | 3300012356 | Vadose Zone Soil | LGAAILASIVVGLTSWLASAFVGGSGRIERYRRIEVKGRRVD* |
| Ga0137384_110255842 | 3300012357 | Vadose Zone Soil | GLWAAILTSIVVGLTSWVASAFVGGSGRIERYRRIEVTGRRVD* |
| Ga0137361_107282202 | 3300012362 | Vadose Zone Soil | PGFTLSGLWAAILASIVVGLTSWCASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0137398_110580131 | 3300012683 | Vadose Zone Soil | LGAIIVGLTSWAASHFIGGSGRIERMKRVEVTGRRLDG* |
| Ga0137398_112364061 | 3300012683 | Vadose Zone Soil | GLWAAILTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRPD* |
| Ga0137413_115646132 | 3300012924 | Vadose Zone Soil | GLWAAILTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0137404_112016442 | 3300012929 | Vadose Zone Soil | AILTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0137407_112964221 | 3300012930 | Vadose Zone Soil | GFSLSGLGAAILASIVVGLTSWIASAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0134077_104671782 | 3300012972 | Grasslands Soil | LGAIIVGLTSWAASHFIGGSGRIERMKRVEVTGRRIDG* |
| Ga0134110_101924152 | 3300012975 | Grasslands Soil | VAGLVPAVLGSIVVGLTGWFASTFVGGSGRIERIRHIEVTGRRLD* |
| Ga0137411_12172781 | 3300015052 | Vadose Zone Soil | MPGFTLSGLWAAIVASIVVGLTSWFGSAFVGGSGRIERYRRIEVTGRRLD* |
| Ga0137403_108699933 | 3300015264 | Vadose Zone Soil | MNLASATLGAIIVGLTSWAASAFVGGSGKIERMKRVEVSDRRL |
| Ga0134089_100413543 | 3300015358 | Grasslands Soil | IVVGLTGWFASMFVGSAGRLERIKRVEVTGRRLE* |
| Ga0134069_10205014 | 3300017654 | Grasslands Soil | GAVIVGLTSWAASAFVGGSGRIERMRRVEVTGRRIE |
| Ga0134083_106044851 | 3300017659 | Grasslands Soil | LVAWLMPGFTLSGLGAAILGSVVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0184605_104917471 | 3300018027 | Groundwater Sediment | TIGAIIVWLTSWAASAFIGGSGRIERMKRVEVTGRRIDG |
| Ga0184621_101947372 | 3300018054 | Groundwater Sediment | VPGFHLAGLWSATLGACVVGITSWFASSFVGGSGRIERIRRVEGSGRQIE |
| Ga0066655_112531782 | 3300018431 | Grasslands Soil | GFSLAGLWAAILTSIVVGLTSWCASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0066667_102277993 | 3300018433 | Grasslands Soil | VLGSIVVGLTGWFASTFVGGSGRIERIRHIEVTGRRLD |
| Ga0066669_110811241 | 3300018482 | Grasslands Soil | GSIVVGLTGWFASAFVGGSGRLERYRRIEVTGRQLD |
| Ga0193723_10002501 | 3300019879 | Soil | ATLGACVVGITSWFASSFVGGSGRIERIRRVEVSGRQIE |
| Ga0193725_10001371 | 3300019883 | Soil | GFHLASLWSATLGAVIVGLTSWAASAFVGGSGRIERMKRVEVTGRRIDG |
| Ga0193710_10217202 | 3300019998 | Soil | LVPGFHLAGLWSATLGACVVGITSWFASSFVGGSGRIERIRRVEVSGRQIE |
| Ga0193755_11959731 | 3300020004 | Soil | LGAVIVGLTSWAASAFVGGSGRIERMKRVEVTGRRIDG |
| Ga0222621_10029395 | 3300021510 | Groundwater Sediment | LVPGFHLAGLFSATLGACVVGITSWFASSFVGGSGRIERIRRVEVSGRQIE |
| Ga0137417_14986174 | 3300024330 | Vadose Zone Soil | MAGFALAGLWAAILTSVVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0208745_10510951 | 3300025403 | Freshwater | VPALLGSIVVGLTSFIGNAFIGRHGRVERYRRLDE |
| Ga0209234_10418174 | 3300026295 | Grasslands Soil | ILTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0209235_11717551 | 3300026296 | Grasslands Soil | GLVPAILGSIVVGLTGWFASTFVGSSGRIEHIRRIEVTGRRLD |
| Ga0209236_11697281 | 3300026298 | Grasslands Soil | ILGAIVVGLTGWFASAFVGGSGRIERYRRIEVRGRRLD |
| Ga0209468_12007462 | 3300026306 | Soil | LGAIIVSLVSWAASAFVGGSGRIERIHRVEVTGRRIDG |
| Ga0209265_10326242 | 3300026308 | Soil | IAGLVPAMLGSIVVGVTGWLASTFVGSSGRIEHIRRIEVTGRRLD |
| Ga0209055_11265833 | 3300026309 | Soil | GAAILGSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRVD |
| Ga0209239_10318605 | 3300026310 | Grasslands Soil | GLHVAGLWSATWGAIIVSLTSWVASHFVGGSGRIERLKRVEVTGRRIDG |
| Ga0209761_10483891 | 3300026313 | Grasslands Soil | ASATLGAIIVGLTSWVASAFVGGSGRIERMKRVEVSGRRIDG |
| Ga0209268_11490852 | 3300026314 | Soil | GSIVVGLIGWFASAFVGGSGRIERYRHIEVTGRRID |
| Ga0209801_10253294 | 3300026326 | Soil | LGSIVVGLTSWFASAFVGGSGRIERYRRIEVKGRRLD |
| Ga0209802_11140671 | 3300026328 | Soil | VAWLMPGFTLSGLGSAILGSVIVGLTSWFASTFVGGSGRIERYRRRIEVTGGSRRLD |
| Ga0209802_12507552 | 3300026328 | Soil | SIVVGLTSWLASAFVGGSGRIERYRRIEVTGRRVD |
| Ga0209807_12743271 | 3300026530 | Soil | AVLGSVVVGLTGWFASTFVGGSGRIERIRHIEVTGRRLD |
| Ga0209807_13115632 | 3300026530 | Soil | IGGLWSATLGAVIVSVTSWVASAFVGGSGRIERMKRVEVTGRRIDG |
| Ga0209157_12120061 | 3300026537 | Soil | LTGLWAAILTSIVVGLTSWFASAFVGGSGRIERYRRIEVKGRRLD |
| Ga0209056_101380264 | 3300026538 | Soil | LSGLWAAILTSIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0208454_11348722 | 3300027573 | Soil | AGLWSATLGAIIVGLTGWAASAFVGGSGRIERMHKIETTGRRVDS |
| Ga0208988_11177061 | 3300027633 | Forest Soil | GLGAAILASIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0209178_10616361 | 3300027725 | Agricultural Soil | TLSGLGSAILGSIIVGLTSWFASTFVGGSGRIERYRRIEVTGRRLD |
| Ga0209590_102665651 | 3300027882 | Vadose Zone Soil | VLGAIVVGLTSWFASAFVDGSGRIERFRHIEVTGRRVDE |
| Ga0137415_106232103 | 3300028536 | Vadose Zone Soil | WWATLGAVVVGLTSWAASAFVGGSGRIERMKRVEVTGRRIDG |
| Ga0137415_114290772 | 3300028536 | Vadose Zone Soil | GAAILASIVVGLTSWFASAFVGGSGRIERYRRIEVTGRRLD |
| Ga0307301_101523622 | 3300028719 | Soil | AGLWSATLGAVIVGLTSWAASAFVGGSGRIERMKRVEVTGRRIDG |
| Ga0307308_102133603 | 3300028884 | Soil | LGSIVVGLTSWIGSAFVGGSGRIERYRRIEVTGRRID |
| Ga0307495_101192252 | 3300031199 | Soil | VSGGLGSATVGALIVGLISWVASAFIGSSGRIERMKRVEVTGRRIDG |
| Ga0307497_100798551 | 3300031226 | Soil | SGLGAAILGSIVVGLTGWVASAFVGSSGRIEHINRVETTGRRVD |
| Ga0335070_101283761 | 3300032829 | Soil | GLGSAILGSIVVGITGWFASTFVGSSGRIEHIRRIEVRGRRID |
| Ga0214472_106907571 | 3300033407 | Soil | FHLAGLLSATLGACVVGITGWFASAFVGGSGRIEPIRRVEVSGRQID |
| Ga0314865_152272_2_157 | 3300033806 | Peatland | LIPGVSVSGLWSATLGALVVTITSWFANSFIGNSGRVERWHRVEVRGRRLD |
| Ga0326723_0370203_475_627 | 3300034090 | Peat Soil | MPGFALTGLGAAILGSIVVGLTSWFASAFVGNTGRIERIKRIETTGRRLD |
| Ga0364934_0397479_387_521 | 3300034178 | Sediment | SGLWSATLGAIVVGLTSWFANAFVGNSGRLEHYRALEVGGRRID |
| ⦗Top⦘ |