| Basic Information | |
|---|---|
| Family ID | F060736 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRSPLAESQRAALIEAMLPDVPFDGWSRAALRAAARRIGIP |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.76 % |
| % of genes near scaffold ends (potentially truncated) | 98.48 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.121 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.788 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.303 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.970 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF01327 | Pep_deformylase | 83.33 |
| PF01165 | Ribosomal_S21 | 6.82 |
| PF02233 | PNTB | 5.30 |
| PF12769 | PNTB_4TM | 1.52 |
| PF02803 | Thiolase_C | 0.76 |
| PF04389 | Peptidase_M28 | 0.76 |
| PF00005 | ABC_tran | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 83.33 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 6.82 |
| COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 5.30 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.48 % |
| Unclassified | root | N/A | 26.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101470711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10104737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1127 | Open in IMG/M |
| 3300004152|Ga0062386_101288771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 608 | Open in IMG/M |
| 3300005176|Ga0066679_10815450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 594 | Open in IMG/M |
| 3300005458|Ga0070681_10175949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2062 | Open in IMG/M |
| 3300005526|Ga0073909_10117212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1074 | Open in IMG/M |
| 3300005542|Ga0070732_10728909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300005556|Ga0066707_10815752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300005575|Ga0066702_10555058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 694 | Open in IMG/M |
| 3300005575|Ga0066702_10875181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300005587|Ga0066654_10909255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 506 | Open in IMG/M |
| 3300006797|Ga0066659_11353402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300006854|Ga0075425_101592932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 736 | Open in IMG/M |
| 3300006876|Ga0079217_11051339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 602 | Open in IMG/M |
| 3300009012|Ga0066710_104178290 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 540 | Open in IMG/M |
| 3300009088|Ga0099830_10847295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300009088|Ga0099830_11093738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 661 | Open in IMG/M |
| 3300009137|Ga0066709_102054711 | Not Available | 791 | Open in IMG/M |
| 3300009137|Ga0066709_103038934 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 615 | Open in IMG/M |
| 3300009553|Ga0105249_11899071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 668 | Open in IMG/M |
| 3300010046|Ga0126384_11039747 | Not Available | 748 | Open in IMG/M |
| 3300010046|Ga0126384_11712464 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 595 | Open in IMG/M |
| 3300010048|Ga0126373_12255212 | Not Available | 605 | Open in IMG/M |
| 3300010303|Ga0134082_10141415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 969 | Open in IMG/M |
| 3300010341|Ga0074045_10748409 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 619 | Open in IMG/M |
| 3300010360|Ga0126372_10417633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1231 | Open in IMG/M |
| 3300010361|Ga0126378_10324367 | Not Available | 1647 | Open in IMG/M |
| 3300010361|Ga0126378_12185802 | Not Available | 631 | Open in IMG/M |
| 3300010371|Ga0134125_12905294 | Not Available | 520 | Open in IMG/M |
| 3300010396|Ga0134126_12961073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300011120|Ga0150983_12951765 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 544 | Open in IMG/M |
| 3300012212|Ga0150985_103614255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
| 3300012212|Ga0150985_107831721 | Not Available | 656 | Open in IMG/M |
| 3300012212|Ga0150985_108861336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300012212|Ga0150985_121842758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300012285|Ga0137370_10825577 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 575 | Open in IMG/M |
| 3300012357|Ga0137384_11323122 | Not Available | 568 | Open in IMG/M |
| 3300012361|Ga0137360_10847364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300012361|Ga0137360_11095356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300012469|Ga0150984_103457837 | Not Available | 641 | Open in IMG/M |
| 3300012469|Ga0150984_105162441 | Not Available | 573 | Open in IMG/M |
| 3300012917|Ga0137395_11254423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012971|Ga0126369_10305131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1595 | Open in IMG/M |
| 3300012977|Ga0134087_10480015 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 621 | Open in IMG/M |
| 3300014501|Ga0182024_11344513 | Not Available | 826 | Open in IMG/M |
| 3300015051|Ga0137414_1197172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2094 | Open in IMG/M |
| 3300015080|Ga0167639_1044074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300015241|Ga0137418_10721592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300016319|Ga0182033_10066422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2520 | Open in IMG/M |
| 3300016357|Ga0182032_10052682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2649 | Open in IMG/M |
| 3300016404|Ga0182037_10713536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300016404|Ga0182037_11727798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300016422|Ga0182039_10120310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1979 | Open in IMG/M |
| 3300016445|Ga0182038_11752499 | Not Available | 560 | Open in IMG/M |
| 3300017970|Ga0187783_11051845 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 586 | Open in IMG/M |
| 3300017973|Ga0187780_11431887 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 510 | Open in IMG/M |
| 3300018007|Ga0187805_10157548 | Not Available | 1033 | Open in IMG/M |
| 3300018007|Ga0187805_10548884 | Not Available | 544 | Open in IMG/M |
| 3300018090|Ga0187770_11522168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300020580|Ga0210403_10279809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1368 | Open in IMG/M |
| 3300020582|Ga0210395_11221123 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 552 | Open in IMG/M |
| 3300021170|Ga0210400_10460662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1049 | Open in IMG/M |
| 3300021178|Ga0210408_10064454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2863 | Open in IMG/M |
| 3300021358|Ga0213873_10319570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300021372|Ga0213877_10252813 | Not Available | 586 | Open in IMG/M |
| 3300021384|Ga0213876_10461143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300021403|Ga0210397_10506163 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300021441|Ga0213871_10129039 | Not Available | 758 | Open in IMG/M |
| 3300021560|Ga0126371_10836883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1066 | Open in IMG/M |
| 3300022528|Ga0242669_1065818 | Not Available | 648 | Open in IMG/M |
| 3300022532|Ga0242655_10127894 | Not Available | 725 | Open in IMG/M |
| 3300022533|Ga0242662_10265212 | Not Available | 562 | Open in IMG/M |
| 3300022557|Ga0212123_10346752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1017 | Open in IMG/M |
| 3300025916|Ga0207663_10642916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300025918|Ga0207662_10004492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7344 | Open in IMG/M |
| 3300025944|Ga0207661_11847685 | Not Available | 550 | Open in IMG/M |
| 3300025961|Ga0207712_11463898 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 611 | Open in IMG/M |
| 3300026319|Ga0209647_1214370 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 656 | Open in IMG/M |
| 3300026333|Ga0209158_1341493 | Not Available | 519 | Open in IMG/M |
| 3300026548|Ga0209161_10574137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 504 | Open in IMG/M |
| 3300027643|Ga0209076_1128376 | Not Available | 714 | Open in IMG/M |
| 3300027706|Ga0209581_1204835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300027775|Ga0209177_10057576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1122 | Open in IMG/M |
| 3300027812|Ga0209656_10300501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300027826|Ga0209060_10297862 | Not Available | 737 | Open in IMG/M |
| 3300027835|Ga0209515_10351939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300027869|Ga0209579_10383176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 761 | Open in IMG/M |
| 3300027884|Ga0209275_10927173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300030988|Ga0308183_1100296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031023|Ga0073998_11584312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300031057|Ga0170834_107087857 | Not Available | 546 | Open in IMG/M |
| 3300031128|Ga0170823_11845156 | Not Available | 653 | Open in IMG/M |
| 3300031469|Ga0170819_11653727 | Not Available | 510 | Open in IMG/M |
| 3300031543|Ga0318516_10858481 | Not Available | 512 | Open in IMG/M |
| 3300031640|Ga0318555_10145055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1269 | Open in IMG/M |
| 3300031682|Ga0318560_10570082 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 613 | Open in IMG/M |
| 3300031708|Ga0310686_110303417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1302 | Open in IMG/M |
| 3300031715|Ga0307476_10219208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1384 | Open in IMG/M |
| 3300031719|Ga0306917_10265858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1318 | Open in IMG/M |
| 3300031719|Ga0306917_10811705 | Not Available | 733 | Open in IMG/M |
| 3300031724|Ga0318500_10482862 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 622 | Open in IMG/M |
| 3300031747|Ga0318502_10459047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300031751|Ga0318494_10211392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1107 | Open in IMG/M |
| 3300031751|Ga0318494_10874546 | Not Available | 527 | Open in IMG/M |
| 3300031754|Ga0307475_10887602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300031770|Ga0318521_10193423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1172 | Open in IMG/M |
| 3300031771|Ga0318546_10321475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1074 | Open in IMG/M |
| 3300031782|Ga0318552_10717981 | Not Available | 510 | Open in IMG/M |
| 3300031793|Ga0318548_10003688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5335 | Open in IMG/M |
| 3300031799|Ga0318565_10263562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300031805|Ga0318497_10326798 | Not Available | 855 | Open in IMG/M |
| 3300031819|Ga0318568_10145884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1444 | Open in IMG/M |
| 3300031823|Ga0307478_11327427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300031845|Ga0318511_10148353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| 3300031845|Ga0318511_10449992 | Not Available | 593 | Open in IMG/M |
| 3300031859|Ga0318527_10105412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300031897|Ga0318520_10024960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2910 | Open in IMG/M |
| 3300031910|Ga0306923_10440314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1479 | Open in IMG/M |
| 3300031912|Ga0306921_12347097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 558 | Open in IMG/M |
| 3300031941|Ga0310912_11168404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300031946|Ga0310910_10042423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3166 | Open in IMG/M |
| 3300031954|Ga0306926_11568054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300032010|Ga0318569_10409846 | Not Available | 632 | Open in IMG/M |
| 3300032025|Ga0318507_10100202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1207 | Open in IMG/M |
| 3300032035|Ga0310911_10035654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2514 | Open in IMG/M |
| 3300032051|Ga0318532_10330093 | Not Available | 541 | Open in IMG/M |
| 3300032055|Ga0318575_10555851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300032059|Ga0318533_10059188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2569 | Open in IMG/M |
| 3300032060|Ga0318505_10029936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2210 | Open in IMG/M |
| 3300032060|Ga0318505_10153519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1068 | Open in IMG/M |
| 3300033134|Ga0335073_11878500 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens | 555 | Open in IMG/M |
| 3300033289|Ga0310914_11013906 | Not Available | 730 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.06% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.03% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.27% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.52% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.76% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.76% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.76% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.76% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1014707111 | 3300002245 | Forest Soil | VKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIGVPA |
| JGIcombinedJ51221_101047372 | 3300003505 | Forest Soil | MKSPLAXSQRDALIEAMLPDVPFDGWSRAALRAAARRVGV |
| Ga0062386_1012887711 | 3300004152 | Bog Forest Soil | MKSPLAESQRAALIKTILPEVPFDGWSRLALRAAARRCDIGP |
| Ga0066679_108154502 | 3300005176 | Soil | MKSPLADAERDRLIAAMLPDVPFDGWSQHALRLAAERIGMPVAEAR |
| Ga0070681_101759491 | 3300005458 | Corn Rhizosphere | MKSPLAERQREQLVTAMLPDVAFDGWSRRALRIAGQRVDISMPEALA |
| Ga0073909_101172123 | 3300005526 | Surface Soil | MRSPYAERETERLIAAMLPDVAFDGWTRHALRNAARRA |
| Ga0070732_107289092 | 3300005542 | Surface Soil | MKSPLAEHDRGRLIEAMLPDVAFDGWSHAALRVAARQLGMP |
| Ga0066707_108157521 | 3300005556 | Soil | MRSPLAESQRTALIEAMLPEVAFDGWSRPALRAAARR |
| Ga0066702_105550582 | 3300005575 | Soil | MRSPFAERERDRLIEAVLPDVAFDGWSRRALRVAAQRIGIPAGEAEAL |
| Ga0066702_108751812 | 3300005575 | Soil | MKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIGV |
| Ga0066654_109092551 | 3300005587 | Soil | MRSPFAERERDRLIEAVLPDVAFDGWSRRALRVAAQRVGIP |
| Ga0066659_113534021 | 3300006797 | Soil | MKSLLADAERDRLIAAILPDVPFDGWSQHALRVAAERIGVPVAEARA |
| Ga0075425_1015929322 | 3300006854 | Populus Rhizosphere | MRSPLAERQRAGLIESMLPDVPFDGWSRAALRAAA |
| Ga0079217_110513391 | 3300006876 | Agricultural Soil | MRSPLAEAETERLIAAILPDVAFDGWTAHALRNAS |
| Ga0066710_1041782901 | 3300009012 | Grasslands Soil | MNSPFAERERERLSAAILPDVAFDGWSRHAGRPAAR |
| Ga0099830_108472952 | 3300009088 | Vadose Zone Soil | MRSPLAERETERLIAAMLPDVAFDGWSRLALRAAAHRAGMPADAAMALFP |
| Ga0099830_110937382 | 3300009088 | Vadose Zone Soil | MRSPFAEREQDRLIAAILPDVAFDGWSYHCLRIAARRLGIAPGEAMALGR* |
| Ga0066709_1020547112 | 3300009137 | Grasslands Soil | MNSPFAERERERLIGAILPDVAFDGWSRHAVRNAARRADMP |
| Ga0066709_1030389342 | 3300009137 | Grasslands Soil | MRSPFAERERDRLIEAVLPDIAFDGWSRRALRVAAQRIGIPAGEA |
| Ga0105249_118990712 | 3300009553 | Switchgrass Rhizosphere | MRSPFAEAERERLIAAILPDVPFDGWTSRALHHAA |
| Ga0126384_110397472 | 3300010046 | Tropical Forest Soil | MKSPLAESQRAALIEAMLPAVAFDGWSRPALRAAARRIGMPVGEAV |
| Ga0126384_117124642 | 3300010046 | Tropical Forest Soil | MKSPLAESQRAALIEAMLPDVPFDGWSRAALRGAARRIGLPP |
| Ga0126373_122552121 | 3300010048 | Tropical Forest Soil | MRSPLAENQREALIEAMLPDVAFDGWSRATLRAAARRIGMPV |
| Ga0134082_101414151 | 3300010303 | Grasslands Soil | MKSPLADAERDRLIAAMLPDVPFDGWSQHALRVAAERIGVPVAEA |
| Ga0074045_107484092 | 3300010341 | Bog Forest Soil | MKSPLAETQRAALIEAMLPEVPFDGWSRAALRTAA |
| Ga0126372_104176331 | 3300010360 | Tropical Forest Soil | MRSPLAESQRVALVEAMLPEVAFDGWSRPALRAAARR |
| Ga0126378_103243674 | 3300010361 | Tropical Forest Soil | MKSPLAEHERDRLIEAMLPDVAFDGWSRAALRVAARQMDMPPAE |
| Ga0126378_121858022 | 3300010361 | Tropical Forest Soil | MKSPFAESERAALIEAVLPDVPFDGWSRAALRAAARRLNI |
| Ga0134125_129052941 | 3300010371 | Terrestrial Soil | MRSPLAERDRGRLIEAMLPDVAFDGWSHAALRIAARS |
| Ga0134126_129610731 | 3300010396 | Terrestrial Soil | MRSPLAEAQRERLVEAILPDVAFDGWTRAALRHAARRAGVPFAEAMAL |
| Ga0150983_129517652 | 3300011120 | Forest Soil | MRSPLAESQRDTLIEAMLPDVPFDGWSRAALRGAAR |
| Ga0150985_1036142551 | 3300012212 | Avena Fatua Rhizosphere | MKSLLADAERDRLIAAMLPDVPFDGWSQHALRVAAERIG |
| Ga0150985_1078317212 | 3300012212 | Avena Fatua Rhizosphere | MRSPLAESQRAALIEAMLPDVAFDGWTRAALRAAARQ |
| Ga0150985_1088613361 | 3300012212 | Avena Fatua Rhizosphere | VKSPLAESQRDALIEAMLPEVPFDGWSRAALRAAARRIG |
| Ga0150985_1218427582 | 3300012212 | Avena Fatua Rhizosphere | MRSPFADAERERLIAAILPDVPFDGWSLRALRSTSRPLISRS |
| Ga0137370_108255772 | 3300012285 | Vadose Zone Soil | MRSPLADSERDRLIAAILPDVAFDGWSQHALRLAA |
| Ga0137384_113231221 | 3300012357 | Vadose Zone Soil | MRSPLAERETERLIAAMLPDVAFDGWSRHALRNAARRADIPVGEAM |
| Ga0137360_108473641 | 3300012361 | Vadose Zone Soil | MKSPLAESQRAALIEAILPDVPFDGWSRPALRAAGRRIGVPLG |
| Ga0137360_110953561 | 3300012361 | Vadose Zone Soil | MRSPFAERETERLIAAMLPDVAFDGWSRHALRNAARRADIPVGEAM |
| Ga0150984_1034578372 | 3300012469 | Avena Fatua Rhizosphere | MRSALAESQRAALIGAMLPDVAFDGWTGAALRTGARR |
| Ga0150984_1051624412 | 3300012469 | Avena Fatua Rhizosphere | MRSPFADSERERLIQAMLPDVPFDGWSGRALRGAARRTGITYP |
| Ga0137395_112544232 | 3300012917 | Vadose Zone Soil | VRSPFAERETERLIWALLPDVAFDGWSRVALRAAARRAGVPPEAAIAMF |
| Ga0126369_103051311 | 3300012971 | Tropical Forest Soil | MRSPLADSERDRLIAAMLPDVPFDGWSQHALRLAAE |
| Ga0134087_104800152 | 3300012977 | Grasslands Soil | MRSPLADSERDRLIMAMLPDVAFDEWSQHALRLAADRIGIPTGE |
| Ga0182024_113445133 | 3300014501 | Permafrost | MKSPMAAGERDRLIEAMLPDIAFDGWSRQTLCAAA |
| Ga0137414_11971721 | 3300015051 | Vadose Zone Soil | MKSPLADSERDRLIAAMLPDVAFDGWSRHALRLAAGRIGMPVGEAMALFRAARR |
| Ga0167639_10440741 | 3300015080 | Glacier Forefield Soil | MKSPLAERDRDRLIEAMLPDVAFDGWSHAAVRLAA |
| Ga0137418_107215921 | 3300015241 | Vadose Zone Soil | MRSPLAESQRDTLIEAMLPDVPFDGWSRAALRAAARRIGV |
| Ga0182033_100664221 | 3300016319 | Soil | VKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMPA |
| Ga0182032_100526825 | 3300016357 | Soil | MKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARRVGLSAGEA |
| Ga0182037_107135361 | 3300016404 | Soil | MRSPLAETQREALIEAMLPDVVFDGWSRAALRAGARRIGIPTE |
| Ga0182037_117277982 | 3300016404 | Soil | MKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARR |
| Ga0182039_101203101 | 3300016422 | Soil | MRSPLAESQRSALIEGMLPDVPFDGWSRAALRAAARRIGI |
| Ga0182038_117524991 | 3300016445 | Soil | MKSPFAESQRDALIEAMLPDVPFDGWSRAALRTAARRIGVSA |
| Ga0187783_110518452 | 3300017970 | Tropical Peatland | VKSPLAERDRDRLIEAILPDVPFDGWSYMALRLAARRVGID |
| Ga0187780_114318872 | 3300017973 | Tropical Peatland | MRSPLAESQREALIEAMLPDVAFDGWSRAALRAGAQ |
| Ga0187805_101575481 | 3300018007 | Freshwater Sediment | MKSPLAERDRGRLIEAILPNVAFDGWSHAALRGAAR |
| Ga0187805_105488842 | 3300018007 | Freshwater Sediment | VRSPLADRDRDRLIGAMLPDVAFDGWSHLALRVAARQLG |
| Ga0187770_115221682 | 3300018090 | Tropical Peatland | MKSPLAERDRDRLIEAMLPDVAFEGWSNASLRAAAKRIDMPAAEAL |
| Ga0210403_102798091 | 3300020580 | Soil | MRSPLAENQRAALIEAMLPNVAFDGWSRSAVRAAARCIG |
| Ga0210395_112211231 | 3300020582 | Soil | VKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAAR |
| Ga0210400_104606623 | 3300021170 | Soil | VRSPLAESQREALIEAMLPEVAFDGWSRPALRAAARRIGMPA |
| Ga0210408_100644545 | 3300021178 | Soil | MRSPLAERESEALIEAMLPDVTFDGWSRPALRAAARRIGIPTGETLALFP |
| Ga0213873_103195701 | 3300021358 | Rhizosphere | MKSPLADSERDRLIVAMLPDVPFDGWSQHALRRAADRIGMP |
| Ga0213877_102528131 | 3300021372 | Bulk Soil | MRSPLAETQRAALIEAMLPDVAFDGWSRPALRAGARRI |
| Ga0213876_104611432 | 3300021384 | Plant Roots | MKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRI |
| Ga0210397_105061633 | 3300021403 | Soil | MKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAAR |
| Ga0213871_101290391 | 3300021441 | Rhizosphere | MRSPLAESQREALIEAMLPDVAFDGWSRATLRAAARRIGMPVAAAL |
| Ga0126371_108368831 | 3300021560 | Tropical Forest Soil | MKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARRVGLS |
| Ga0242669_10658181 | 3300022528 | Soil | MKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAAQ |
| Ga0242655_101278942 | 3300022532 | Soil | MRSPLAESQREALIEAMLPEVAFDGWSRPALRAAARRIGMPG |
| Ga0242662_102652121 | 3300022533 | Soil | MRSPLAENQRAALIEAMLPNVAFDGWSRSAVRAAARCIGM |
| Ga0212123_103467521 | 3300022557 | Iron-Sulfur Acid Spring | MRSPFAERERERLIAAMLPDVAFDGWSRHALRNAARRADIPVGEALAL |
| Ga0207663_106429162 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSPLAESQRGVLIEAMLPDVPFDGWSRPALRAAARRIDMP |
| Ga0207662_100044921 | 3300025918 | Switchgrass Rhizosphere | MRSPLADSERDRLIAAMLPDVAFDGWSQHALRLAARRIGVPVGEAT |
| Ga0207661_118476851 | 3300025944 | Corn Rhizosphere | MKSPFADSERERLIQAILPDVPFDGWSTRALRGAARRTGIPFPEA |
| Ga0207712_114638982 | 3300025961 | Switchgrass Rhizosphere | MRSPFAEAERERLIAAILPDVPFDGWTSRALHHAARRIDIPAAE |
| Ga0209647_12143701 | 3300026319 | Grasslands Soil | MKSPLADSERDRLIAAMLPDVAFDGWSRHALRLAAGRIGMPVGEAM |
| Ga0209158_13414932 | 3300026333 | Soil | MKSPLADAERDRLIAAMLPDVPFDGWSQHALRIAAERIGMPVTEA |
| Ga0209161_105741371 | 3300026548 | Soil | MKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIGVPA |
| Ga0209076_11283762 | 3300027643 | Vadose Zone Soil | MRSPLAESQRTALIEAMLPDVAFDGWSRPALRAAARRTGIP |
| Ga0209581_12048352 | 3300027706 | Surface Soil | MKSPLADSEREALVAAMLPEVPFEGWSRAALRAAARRVGIPPGEA |
| Ga0209177_100575763 | 3300027775 | Agricultural Soil | MKSPLAESQREALIEAMLPDVPFDGWSRAALRAAARRIRL |
| Ga0209656_103005011 | 3300027812 | Bog Forest Soil | MKSPLAESQRAALIKTILPEVPFDGWSRLALRAAARRCD |
| Ga0209060_102978622 | 3300027826 | Surface Soil | MRSPLAEAERERLIEAILPDVPFDGWSAVALRQAAE |
| Ga0209515_103519392 | 3300027835 | Groundwater | VRSPLAERERERLIEAILPEIAFDGWSRLALRRAAASAGVP |
| Ga0209579_103831761 | 3300027869 | Surface Soil | MKSPLAERDRDRLIEAALPDVPFDGWSHAALRVAAK |
| Ga0209275_109271732 | 3300027884 | Soil | MKSPLAEHDRDRLIEAILPDVAFDGWSHGALRSAARRLDMPA |
| Ga0308183_11002962 | 3300030988 | Soil | VKSPFADSERERLIQAILPDVPFDGWSTRALRGAARR |
| Ga0073998_115843121 | 3300031023 | Soil | MKSPLADSERDRLIAAMLPDVAFDGWSRHALRLAAGRVGI |
| Ga0170834_1070878572 | 3300031057 | Forest Soil | MRSPLAEEQRAALIEAMLPNVPFDSWSRAALRAAARRIG |
| Ga0170823_118451562 | 3300031128 | Forest Soil | MRSPLAEEQRAALIEAMLANVPFDSWSRAALRAAAR |
| Ga0170819_116537272 | 3300031469 | Forest Soil | MKSPLAEDQRATLIEAMLPNVPFDGWSRPALRAAARHIG |
| Ga0318516_108584811 | 3300031543 | Soil | MRSPLAESQRAALIEAMLPDVPFDGWSRAALRAAARR |
| Ga0318555_101450554 | 3300031640 | Soil | MRSPLAENQRAALVAAMLPNVPFDGWSRPVLRAAARRIGMPADEA |
| Ga0318560_105700821 | 3300031682 | Soil | VKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMPAPEALALF |
| Ga0310686_1103034174 | 3300031708 | Soil | MKSPLSDARREALIEAMLPDAPFDGWTRAGLRKAARRLAVPVGEALALS |
| Ga0307476_102192081 | 3300031715 | Hardwood Forest Soil | VNSPLADAQRAALIEAILPDVPFDGWSRAALRAAARRCDIG |
| Ga0306917_102658584 | 3300031719 | Soil | MRSPLAESQREALIEAMLPDVAFDGWSRAALRAGARRIGIPTEEA |
| Ga0306917_108117051 | 3300031719 | Soil | MRSPLAENQRAALIEAMLPNVAFDGWSRSAVRAAA |
| Ga0318500_104828621 | 3300031724 | Soil | MKSPLAESQREALIEAMLPDVAFDGWSRSALRAAARRIGIPAGE |
| Ga0318502_104590471 | 3300031747 | Soil | VKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMPAPEALALFS |
| Ga0318494_102113921 | 3300031751 | Soil | MRSPLAENQRAALIEAMLPNVAFDGWSRSAVRTAA |
| Ga0318494_108745461 | 3300031751 | Soil | MRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAARRVGMP |
| Ga0307475_108876022 | 3300031754 | Hardwood Forest Soil | MKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRGGVP |
| Ga0318521_101934233 | 3300031770 | Soil | MRSPLAEEQRAALIEAILPTVPFDGWSRPALRAAARRAGIPAD |
| Ga0318546_103214753 | 3300031771 | Soil | MRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAARLV |
| Ga0318552_107179812 | 3300031782 | Soil | MNSPLAEQQRTALIEAILPEVAFDGWSRAALRAAAR |
| Ga0318548_100036888 | 3300031793 | Soil | MRSPLADDQRAALIAAMLPNVAFDGWSRPALRAAARRVG |
| Ga0318565_102635621 | 3300031799 | Soil | MRSPLAENQRAALIEAMLPNVPFDGWSRLALRSAARRVGLS |
| Ga0318497_103267983 | 3300031805 | Soil | MRSPLAEEQRAALIEAILPNVPFDGWSRPALRAAARRAGI |
| Ga0318568_101458841 | 3300031819 | Soil | MRSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIAMPPGEA |
| Ga0307478_113274271 | 3300031823 | Hardwood Forest Soil | MKSPLAERERDRLIEAMLPDIAFDGWSHAALRVAARQL |
| Ga0318511_101483533 | 3300031845 | Soil | MRSPLAENQRAALIEAMLPNVAFDGWSRSAVRTAARC |
| Ga0318511_104499922 | 3300031845 | Soil | MRSPLAEEQRAALIEAILPNVPFDGWSRPALRAGSSSG |
| Ga0318527_101054121 | 3300031859 | Soil | MRSPLAESQRDALIEAMLPDVPFDGWSRAALRTAARRIGIPP |
| Ga0318520_100249605 | 3300031897 | Soil | MKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARRVGLSAGEALAL |
| Ga0306923_104403144 | 3300031910 | Soil | MRSPLAEKQRAALIEAMLPSVPFDGWSRPALRSAARRVGMPAD |
| Ga0306921_123470971 | 3300031912 | Soil | MRSPLAEGQRAALIEAVLPHVPFDGWSRPALRAAARHIGMPA |
| Ga0310912_111684042 | 3300031941 | Soil | MRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAA |
| Ga0310910_100424231 | 3300031946 | Soil | MRSPLADDQRTALIAAMLPNVAFDGWSRPALRAAARRVGMP |
| Ga0306926_115680541 | 3300031954 | Soil | MRSPFAERERDRLIAAMLPDVAFDGWSGHALRATARRID |
| Ga0318569_104098462 | 3300032010 | Soil | MRSPLAESQRGALIEAMLPDVPFDGWSRSALRAAARRT |
| Ga0318507_101002023 | 3300032025 | Soil | VKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMP |
| Ga0310911_100356544 | 3300032035 | Soil | MRSPLAESQRAALIEAMLPDVPFDGWSRAALRAAARRIGIP |
| Ga0318532_103300932 | 3300032051 | Soil | MKSPLAESQREALIEAMLPDVAFDGWSRSALRAAA |
| Ga0318575_105558511 | 3300032055 | Soil | MRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAARRVG |
| Ga0318533_100591881 | 3300032059 | Soil | MRSPLAEEQRAALIEAILPNVPFDGWSRPALRAGSSSGSVS |
| Ga0318505_100299361 | 3300032060 | Soil | MRSPLADDQRAALIAAMLPNVAFDGWSRPALRAAARRDRKY |
| Ga0318505_101535193 | 3300032060 | Soil | MRSPLAESQREALIEAMLPDVAFDGWSRAALRAGARRIGIP |
| Ga0335073_118785001 | 3300033134 | Soil | MKSPLAEQDRDRLIEAMLPDIAFDGWSNAALRVAA |
| Ga0310914_110139061 | 3300033289 | Soil | MKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAA |
| ⦗Top⦘ |