| Basic Information | |
|---|---|
| Family ID | F060723 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDEVTHKQIYERLLAVESKVDEIDKNTKGLVEAIKALDGAF |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.47 % |
| % of genes near scaffold ends (potentially truncated) | 96.97 % |
| % of genes from short scaffolds (< 2000 bps) | 78.03 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (38.636 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.030 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.970 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF16778 | Phage_tail_APC | 20.45 |
| PF13884 | Peptidase_S74 | 7.58 |
| PF13392 | HNH_3 | 1.52 |
| PF07460 | NUMOD3 | 0.76 |
| PF07484 | Collar | 0.76 |
| PF13385 | Laminin_G_3 | 0.76 |
| PF03819 | MazG | 0.76 |
| PF06739 | SBBP | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.36 % |
| Unclassified | root | N/A | 38.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002447|JGI24768J34885_10167488 | Not Available | 743 | Open in IMG/M |
| 3300003804|Ga0007817_1001841 | Not Available | 1747 | Open in IMG/M |
| 3300003812|Ga0007861_1017006 | Not Available | 630 | Open in IMG/M |
| 3300004096|Ga0066177_10287076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 695 | Open in IMG/M |
| 3300004124|Ga0066178_10008021 | All Organisms → Viruses → Predicted Viral | 2145 | Open in IMG/M |
| 3300004240|Ga0007787_10703563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300004686|Ga0065173_1088160 | Not Available | 558 | Open in IMG/M |
| 3300004686|Ga0065173_1093868 | Not Available | 539 | Open in IMG/M |
| 3300004763|Ga0007746_1338058 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300004796|Ga0007763_11340182 | Not Available | 587 | Open in IMG/M |
| 3300005581|Ga0049081_10014821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2949 | Open in IMG/M |
| 3300005582|Ga0049080_10039152 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300005582|Ga0049080_10220663 | Not Available | 623 | Open in IMG/M |
| 3300005662|Ga0078894_10521336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1065 | Open in IMG/M |
| 3300005805|Ga0079957_1077811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
| 3300006033|Ga0075012_10531912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300006118|Ga0007859_1023724 | Not Available | 1341 | Open in IMG/M |
| 3300006802|Ga0070749_10095324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1764 | Open in IMG/M |
| 3300006802|Ga0070749_10690855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300006920|Ga0070748_1196645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300007548|Ga0102877_1155286 | Not Available | 647 | Open in IMG/M |
| 3300007708|Ga0102859_1010153 | All Organisms → Viruses → Predicted Viral | 2320 | Open in IMG/M |
| 3300008119|Ga0114354_1184706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300008259|Ga0114841_1224739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300008266|Ga0114363_1024825 | All Organisms → Viruses → Predicted Viral | 2595 | Open in IMG/M |
| 3300008266|Ga0114363_1047833 | All Organisms → Viruses → Predicted Viral | 1716 | Open in IMG/M |
| 3300008266|Ga0114363_1227314 | Not Available | 547 | Open in IMG/M |
| 3300008448|Ga0114876_1158838 | Not Available | 814 | Open in IMG/M |
| 3300008448|Ga0114876_1218149 | Not Available | 626 | Open in IMG/M |
| 3300008450|Ga0114880_1018003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3330 | Open in IMG/M |
| 3300008450|Ga0114880_1031644 | All Organisms → Viruses → Predicted Viral | 2359 | Open in IMG/M |
| 3300008450|Ga0114880_1112497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300008450|Ga0114880_1187650 | Not Available | 707 | Open in IMG/M |
| 3300008450|Ga0114880_1190589 | Not Available | 698 | Open in IMG/M |
| 3300008450|Ga0114880_1222697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300008450|Ga0114880_1222892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300009068|Ga0114973_10060036 | All Organisms → Viruses → Predicted Viral | 2222 | Open in IMG/M |
| 3300009154|Ga0114963_10345037 | Not Available | 819 | Open in IMG/M |
| 3300009155|Ga0114968_10000480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30028 | Open in IMG/M |
| 3300009155|Ga0114968_10080180 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
| 3300009155|Ga0114968_10121508 | Not Available | 1576 | Open in IMG/M |
| 3300009155|Ga0114968_10557386 | Not Available | 610 | Open in IMG/M |
| 3300009155|Ga0114968_10700718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300009160|Ga0114981_10177785 | Not Available | 1170 | Open in IMG/M |
| 3300009180|Ga0114979_10390340 | Not Available | 816 | Open in IMG/M |
| 3300009181|Ga0114969_10104105 | Not Available | 1825 | Open in IMG/M |
| 3300009183|Ga0114974_10620183 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009184|Ga0114976_10505263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300009184|Ga0114976_10634907 | Not Available | 540 | Open in IMG/M |
| 3300010157|Ga0114964_10500610 | Not Available | 571 | Open in IMG/M |
| 3300010885|Ga0133913_10183934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5576 | Open in IMG/M |
| 3300010885|Ga0133913_10310176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4180 | Open in IMG/M |
| 3300010885|Ga0133913_10536245 | Not Available | 3079 | Open in IMG/M |
| 3300010885|Ga0133913_12655718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
| 3300010885|Ga0133913_12693348 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300011010|Ga0139557_1001383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5610 | Open in IMG/M |
| 3300011010|Ga0139557_1073401 | Not Available | 571 | Open in IMG/M |
| 3300012017|Ga0153801_1076694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300012348|Ga0157140_10000533 | All Organisms → Viruses → Predicted Viral | 4669 | Open in IMG/M |
| 3300013372|Ga0177922_10442025 | Not Available | 1237 | Open in IMG/M |
| 3300017707|Ga0181363_1003029 | All Organisms → Viruses → Predicted Viral | 3797 | Open in IMG/M |
| 3300017707|Ga0181363_1094241 | Not Available | 506 | Open in IMG/M |
| 3300017722|Ga0181347_1122297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 727 | Open in IMG/M |
| 3300017722|Ga0181347_1173969 | Not Available | 578 | Open in IMG/M |
| 3300017736|Ga0181365_1050769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1036 | Open in IMG/M |
| 3300017747|Ga0181352_1015549 | All Organisms → Viruses → Predicted Viral | 2408 | Open in IMG/M |
| 3300017747|Ga0181352_1154735 | Not Available | 605 | Open in IMG/M |
| 3300017761|Ga0181356_1017882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2622 | Open in IMG/M |
| 3300017761|Ga0181356_1143270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300017766|Ga0181343_1138318 | Not Available | 681 | Open in IMG/M |
| 3300017766|Ga0181343_1214119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 525 | Open in IMG/M |
| 3300017766|Ga0181343_1220568 | Not Available | 516 | Open in IMG/M |
| 3300017777|Ga0181357_1212751 | Not Available | 685 | Open in IMG/M |
| 3300017778|Ga0181349_1008546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4284 | Open in IMG/M |
| 3300017778|Ga0181349_1127780 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 931 | Open in IMG/M |
| 3300017785|Ga0181355_1104426 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300017785|Ga0181355_1229004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Quisquiliibacterium → Quisquiliibacterium transsilvanicum | 720 | Open in IMG/M |
| 3300019784|Ga0181359_1018752 | All Organisms → Viruses → Predicted Viral | 2599 | Open in IMG/M |
| 3300019784|Ga0181359_1050470 | Not Available | 1605 | Open in IMG/M |
| 3300019784|Ga0181359_1076483 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
| 3300019784|Ga0181359_1144409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300019784|Ga0181359_1170137 | Not Available | 729 | Open in IMG/M |
| 3300019784|Ga0181359_1223183 | Not Available | 591 | Open in IMG/M |
| 3300020205|Ga0211731_10345878 | Not Available | 975 | Open in IMG/M |
| 3300020549|Ga0207942_1011797 | Not Available | 1156 | Open in IMG/M |
| 3300020686|Ga0214194_106729 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300021519|Ga0194048_10375043 | Not Available | 505 | Open in IMG/M |
| 3300021961|Ga0222714_10655906 | Not Available | 517 | Open in IMG/M |
| 3300022179|Ga0181353_1024803 | Not Available | 1585 | Open in IMG/M |
| 3300022190|Ga0181354_1011698 | All Organisms → Viruses → Predicted Viral | 2610 | Open in IMG/M |
| 3300022190|Ga0181354_1023708 | All Organisms → Viruses → Predicted Viral | 1968 | Open in IMG/M |
| 3300022190|Ga0181354_1107760 | Not Available | 903 | Open in IMG/M |
| 3300022407|Ga0181351_1042196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1924 | Open in IMG/M |
| 3300022407|Ga0181351_1066916 | Not Available | 1464 | Open in IMG/M |
| 3300025401|Ga0207955_1038259 | Not Available | 812 | Open in IMG/M |
| 3300025410|Ga0208875_1034378 | Not Available | 826 | Open in IMG/M |
| 3300025466|Ga0208497_1107314 | Not Available | 507 | Open in IMG/M |
| 3300025778|Ga0208388_1032412 | Not Available | 790 | Open in IMG/M |
| 3300025889|Ga0208644_1357219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300027659|Ga0208975_1013832 | All Organisms → Viruses → Predicted Viral | 2730 | Open in IMG/M |
| 3300027697|Ga0209033_1237076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027732|Ga0209442_1094182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1215 | Open in IMG/M |
| 3300027973|Ga0209298_10232471 | Not Available | 741 | Open in IMG/M |
| 3300031758|Ga0315907_10066440 | All Organisms → Viruses → Predicted Viral | 3134 | Open in IMG/M |
| 3300031758|Ga0315907_10305005 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300031784|Ga0315899_11665283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 526 | Open in IMG/M |
| 3300031786|Ga0315908_10297850 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300031857|Ga0315909_10431990 | Not Available | 932 | Open in IMG/M |
| 3300031857|Ga0315909_10675176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300031857|Ga0315909_10758055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300031951|Ga0315904_10089640 | All Organisms → Viruses → Predicted Viral | 3264 | Open in IMG/M |
| 3300031951|Ga0315904_10501742 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
| 3300031963|Ga0315901_10078323 | All Organisms → Viruses → Predicted Viral | 3119 | Open in IMG/M |
| 3300032050|Ga0315906_10210087 | All Organisms → Viruses → Predicted Viral | 1823 | Open in IMG/M |
| 3300032050|Ga0315906_11001199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300032092|Ga0315905_10072239 | All Organisms → Viruses → Predicted Viral | 3494 | Open in IMG/M |
| 3300032092|Ga0315905_10867011 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300032092|Ga0315905_10893369 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300032092|Ga0315905_11015080 | Not Available | 696 | Open in IMG/M |
| 3300032116|Ga0315903_10847547 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 661 | Open in IMG/M |
| 3300032753|Ga0316224_1014755 | Not Available | 4125 | Open in IMG/M |
| 3300033981|Ga0334982_0515708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300033993|Ga0334994_0029873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3537 | Open in IMG/M |
| 3300033993|Ga0334994_0292956 | Not Available | 830 | Open in IMG/M |
| 3300033995|Ga0335003_0354373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300034062|Ga0334995_0269091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1135 | Open in IMG/M |
| 3300034082|Ga0335020_0064570 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
| 3300034092|Ga0335010_0620803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300034093|Ga0335012_0242280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300034117|Ga0335033_0013678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5498 | Open in IMG/M |
| 3300034118|Ga0335053_0693398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.03% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.58% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.82% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.79% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.03% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.52% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.52% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.76% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.76% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.76% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.76% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.76% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24768J34885_101674883 | 3300002447 | Freshwater And Sediment | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAIDWLQLNLR* |
| Ga0007817_10018412 | 3300003804 | Freshwater | MESVTHEQIYERLVSLEAKVDEIDINTKGMVEAFNNVQGAFKVLGWIAKLVWLNL* |
| Ga0007861_10170063 | 3300003812 | Freshwater | MENTTTVSHEQIYERLIKVEAKVDAIEKNTKELIEAFSALKGALKVLDWIASLAKPIG |
| Ga0066177_102870762 | 3300004096 | Freshwater Lake | MENEVTHKQIYDRLIEVENKVDSIDKNTKGLVEAIKALDGAFKVL |
| Ga0066178_100080215 | 3300004124 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDTIDKNTSGLVEAIDAMQGAIK |
| Ga0007787_107035631 | 3300004240 | Freshwater Lake | MKDVSHEQIYERLLAVEAKVDEIDKNTKDLVTAIDAAKGAVKVLNWIASIAQ |
| Ga0065173_10881601 | 3300004686 | Freshwater | MENTTTVSHEQIYERLIKVEAKVDAIEKNTKELIEAFSALKGALKVLDWIASLAKPIGII |
| Ga0065173_10938681 | 3300004686 | Freshwater | MENVTHEQIYERLVSLEAKVDDIDINTKGMVEAFNNVQGAFKVLGWIANVAKPIIIVV |
| Ga0007746_13380581 | 3300004763 | Freshwater Lake | MENEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAIKALDGAFKVLGW |
| Ga0007763_113401821 | 3300004796 | Freshwater Lake | MEDQVTHSQIYERLLAVESKVDSIDKNTKGLVEAFDALQGAFKVLGW |
| Ga0049081_100148211 | 3300005581 | Freshwater Lentic | MKDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIASIAQPVLWIG |
| Ga0049080_100391521 | 3300005582 | Freshwater Lentic | MDEVTHKQIYERLLAVESKVDEIDKNTKGLVEAIKALDGAF |
| Ga0049080_102206631 | 3300005582 | Freshwater Lentic | MTEVTHEQIYERLLAVETKVDTIDKNTSGLVEAIKAA |
| Ga0078894_105213363 | 3300005662 | Freshwater Lake | MTQEVTHEQIYDRLVEVEAKVDSIDKNTKGLVEAINALDGAF |
| Ga0079957_10778113 | 3300005805 | Lake | MQEVSHKQIYDRLVAVEKKVDHIDQNTAGMVVAFQAAAGAFTVLN |
| Ga0075012_105319121 | 3300006033 | Watersheds | MNDVSHEQIYERLIAVESKVDRIDNNTKGLVEAIDAAQG |
| Ga0007859_10237241 | 3300006118 | Freshwater | MEVTHEQIYERLKAVEEKVDRIDKNTVGLIDAFNAVQGAFKVLGWIAWLAKP |
| Ga0070749_100953243 | 3300006802 | Aqueous | MSDVSHEQIYERLVAVEGKVDRIDNNTKGLVEAID |
| Ga0070749_106908551 | 3300006802 | Aqueous | MEEVTHAQIYSRLVEVEAKVDSIDKNTKGIVEAMDALQGAFKVLGWVASAAKPILY |
| Ga0070748_11966453 | 3300006920 | Aqueous | MSDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIAS |
| Ga0102877_11552863 | 3300007548 | Estuarine | MEEVTHTQIYNRLVVVENKVDEIDKNTKVLVEAFDAVQGAFK |
| Ga0102859_10101531 | 3300007708 | Estuarine | MTQEVTHAQIYERLLEVETKVDTIDKNTSGLVEAIKALD |
| Ga0114354_11847061 | 3300008119 | Freshwater, Plankton | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVDAIDAAK |
| Ga0114841_12247391 | 3300008259 | Freshwater, Plankton | MENEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAMK |
| Ga0114363_10248256 | 3300008266 | Freshwater, Plankton | MSDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIASI |
| Ga0114363_10478334 | 3300008266 | Freshwater, Plankton | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIASI |
| Ga0114363_12273142 | 3300008266 | Freshwater, Plankton | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKG |
| Ga0114876_11588381 | 3300008448 | Freshwater Lake | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAMKALDGAFKVLGWIASAAK |
| Ga0114876_12181491 | 3300008448 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDSIDQNTKGLVEAMKALDG |
| Ga0114880_10180031 | 3300008450 | Freshwater Lake | MKDVSHEQIYERLLAVEAKVDEIDKNTKDLVTAIDAAKGAVKVLNWIASIAQPVLWI |
| Ga0114880_10316441 | 3300008450 | Freshwater Lake | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGA |
| Ga0114880_11124973 | 3300008450 | Freshwater Lake | MTNKVTHEQIYERLIAVEAKVDSIDKNTSGLVEALKALDGAFKVLG |
| Ga0114880_11876504 | 3300008450 | Freshwater Lake | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLN |
| Ga0114880_11905891 | 3300008450 | Freshwater Lake | MEDQVTHSQIYERLLAVESKVDNIDQNTKGLVEAMKALDGAFKVLGW |
| Ga0114880_12226973 | 3300008450 | Freshwater Lake | MTQEVTHEQIYNRLVEVEAKVDSIDKNTKGLVEAINALDGAF |
| Ga0114880_12228923 | 3300008450 | Freshwater Lake | MTQEITHEQIYNRLVEVEAKVDSIDKNTKGLVEAINALDGAF |
| Ga0114973_100600364 | 3300009068 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDSIDKNTKGLVEAFDALQGAFKVLGWI |
| Ga0114963_103450372 | 3300009154 | Freshwater Lake | METSPISHQQIYDRLVAVEGKVDTIDKNTKALVEGFNAVQGAFKVFG |
| Ga0114968_100004801 | 3300009155 | Freshwater Lake | MSEVTHKQIYDRLVEVESKVDSIDKNTKGLVEAFDALQGAFKVLGWVASAAKPIL |
| Ga0114968_100801801 | 3300009155 | Freshwater Lake | MDEVTHKQIYDRLVLVESKVDSIDKNTKGLVEAFDALQGAFKVLGWVASAAKPIL |
| Ga0114968_101215082 | 3300009155 | Freshwater Lake | MDEKVTHEQIYDRLLAVETKVDSIDKNTRGLVEAINAL |
| Ga0114968_105573863 | 3300009155 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDSIDKNTKGLVEAFDALHGA* |
| Ga0114968_107007181 | 3300009155 | Freshwater Lake | MSEVSHEQIYERLIAVEQKVDRIDNNTKGLVEAVDAAQGAVKVLGWIA |
| Ga0114981_101777851 | 3300009160 | Freshwater Lake | MDEVTHKQIYDRLVEVESKVDSIDKNTKGLVEAFDALQGAFK |
| Ga0114979_103903404 | 3300009180 | Freshwater Lake | MENEVTHKQIYDRLIEVEAKVDSIDKNTKGLVEAFDALQG |
| Ga0114969_101041051 | 3300009181 | Freshwater Lake | MSEVTHEQIYNRLIEVETKVDNIDKNTKGLVDAINALDG |
| Ga0114974_106201831 | 3300009183 | Freshwater Lake | MSDVSHEQIYERLLAVEAKVDEIDKNTKDLVTAIDAAKGAVKVLNWIASIAQ |
| Ga0114976_105052634 | 3300009184 | Freshwater Lake | MDEVTHKQIYDRLVEVETKVDSIDKNTKGLVEAFD |
| Ga0114976_106349073 | 3300009184 | Freshwater Lake | MDEVTHKQIYDRLVEVESKVDSIDKNTKGLVEAFDALQGAFKVLGW |
| Ga0114964_105006102 | 3300010157 | Freshwater Lake | METVTHQQIYDRLIAVESKVDEIDKNTKDLVEGFKAVK |
| Ga0133913_101839341 | 3300010885 | Freshwater Lake | MAEVTHEQIYNRLIEVETKVDSIDKNTKGLVEAINALDGA |
| Ga0133913_103101765 | 3300010885 | Freshwater Lake | MDEKVTHEQIYERLLEVESKVDNIDKNTKGLVEAFDA |
| Ga0133913_105362451 | 3300010885 | Freshwater Lake | MDEKVTHEQIYARLLEVESKVDNIDKNTKGLVEAFDALQGAFKVLGWI |
| Ga0133913_126557184 | 3300010885 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDSIDKNTKGLVEAFDALQGAFKVLGWIASAAKPI |
| Ga0133913_126933481 | 3300010885 | Freshwater Lake | MSEVSHEQIYERLIAVEQKVDRIDNNTKGLVEAIDAA |
| Ga0139557_10013836 | 3300011010 | Freshwater | MENEVTHKQIYDRLVEVESKVDNIDQNTKGLVEAIKALDGAFKVLGW |
| Ga0139557_10734012 | 3300011010 | Freshwater | MTDVSHEQIYERLLAVEAKVDSIDQNTKGLVEAIKALDGAFKVLGW |
| Ga0153801_10766942 | 3300012017 | Freshwater | MENEVTHKQIYDRLVEVESKVDSIDKNTKGLVEAINALDGAFK |
| Ga0157140_100005331 | 3300012348 | Freshwater | MSEQVTHEQIYSRLLAVEAKVDDIDKNTKDLVDAINAAKGAVKVLNWIASI |
| Ga0177922_104420252 | 3300013372 | Freshwater | MENEVTHKQIYDRLVEVETKVDSIDQNTKGLVEAI |
| Ga0134315_10580362 | 3300014962 | Surface Water | MENVTHAQIYERLVAVEAKVDHIDKNTKDLVDGFKAVQGAFP |
| Ga0181363_10030291 | 3300017707 | Freshwater Lake | MENVSHEQIYERLIAVEGKVDRIDNNTKGLVDAIDAMQGAIKV |
| Ga0181363_10942412 | 3300017707 | Freshwater Lake | MSEVSHAQIYERLIAVENKVDSIDKNTKGLVEAINA |
| Ga0181347_11222973 | 3300017722 | Freshwater Lake | MTQEVTHEQIYERLLAVENKVDSIDQNTKGLVEAIKAL |
| Ga0181347_11739691 | 3300017722 | Freshwater Lake | MTQEVTHEQIYERLLAVENKVDSIDKNTSGLVEAIKALDGAFKVLGWIASAAKPILC |
| Ga0181365_10507694 | 3300017736 | Freshwater Lake | MTQEVTHEQIYERLLAVENKVDSIDQNTKGLVEAM |
| Ga0181352_10155491 | 3300017747 | Freshwater Lake | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAMKALDGAFKVLGWL |
| Ga0181352_11547351 | 3300017747 | Freshwater Lake | MQEVTHAQIYERLVAVESKVDHIDKNTKDLVDGFNAVQGA |
| Ga0181356_10178821 | 3300017761 | Freshwater Lake | MTTEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAMKALDGAFKVLGWIASAAKPI |
| Ga0181356_11432701 | 3300017761 | Freshwater Lake | MENEVTHKQIYDRLIEVEAKVDSIDKNTKGLVEAFDALHGAFK |
| Ga0181343_11383181 | 3300017766 | Freshwater Lake | MENEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAIKAL |
| Ga0181343_12141192 | 3300017766 | Freshwater Lake | MEDQVTHSQIYERLLAVESKVDEIDKNTKGLVEAIKALDGAFKVLGWVASAAK |
| Ga0181343_12205683 | 3300017766 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDNIDQNTKGLVEAMKALDGAFKVLG |
| Ga0181357_12127512 | 3300017777 | Freshwater Lake | MSEVSHAQIYERLVKVEEKVDRIDNNTRGLVEAIQAAQGAVKVLNWIASFAK |
| Ga0181349_10085468 | 3300017778 | Freshwater Lake | MTQEVTHEQIYERLLAVESKVDSIDKNTSGLVEAI |
| Ga0181349_11277801 | 3300017778 | Freshwater Lake | MQEEVTHKQIYDRLVEVESKVDTIDKNTNGLVEAIKALDGAFKVLN |
| Ga0181355_11044261 | 3300017785 | Freshwater Lake | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVDAIDAAKGAVQVLNWIASIAQPVLWIGG |
| Ga0181355_12290043 | 3300017785 | Freshwater Lake | MTNVSHEQIYERLLAVEAKVDEIDKNTKDLVTAIDAAKGAVKVLNWIASIAQ |
| Ga0181359_10187523 | 3300019784 | Freshwater Lake | MTQEVTHEQIYERLLAVETKVDSIDKNTSGLVEAIKA |
| Ga0181359_10504704 | 3300019784 | Freshwater Lake | MENVSHEQIYERLIAVEGKVDRIDNNTKGLVEAIDAMQGAIKVLGW |
| Ga0181359_10764831 | 3300019784 | Freshwater Lake | MENEVTHKQIYDRLVEVEAKVDNIDQNTKGLVEAIKALDGA |
| Ga0181359_11444091 | 3300019784 | Freshwater Lake | MSDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIASIAQPVLC |
| Ga0181359_11701373 | 3300019784 | Freshwater Lake | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAMKALDGAFKVLG |
| Ga0181359_12231831 | 3300019784 | Freshwater Lake | MSEVSHEQIYNRLLAVEVKVDEIDKNTKDLVGAIQAAQGA |
| Ga0211731_103458784 | 3300020205 | Freshwater | MEDQVTHSQIYARLLEVEAKVDSIDQNTKGLVEAIKALDG |
| Ga0207942_10117971 | 3300020549 | Freshwater | MENEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAIKALDGAFKVLGWIASAA |
| Ga0214194_1067291 | 3300020686 | Freshwater | MLILPNLDDAVTHEQIYLRLLEVEAKVDAIDASTKQLVEAFEALQGALKVLNWIASLAKP |
| Ga0194048_103750432 | 3300021519 | Anoxic Zone Freshwater | MIEVSHEQIYERLVAVEQKVDRIDNNTKGLVEAID |
| Ga0222714_106559061 | 3300021961 | Estuarine Water | MENVTHEQIYARLLEVESKVDKIDNNTKGLVDAIDAMQG |
| Ga0181353_10248034 | 3300022179 | Freshwater Lake | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAMK |
| Ga0181354_10116981 | 3300022190 | Freshwater Lake | MENEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAI |
| Ga0181354_10237081 | 3300022190 | Freshwater Lake | MEDQVTHKQIYDRLVEVETKVDSIDKNTKGLVEAINALD |
| Ga0181354_11077601 | 3300022190 | Freshwater Lake | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAMKALDGAFKVLGW |
| Ga0181351_10421961 | 3300022407 | Freshwater Lake | MENEVTHKQIYDRLVEVESKVDNIDQNTKGLVEAIKALDGAFKVLGWIAS |
| Ga0181351_10669164 | 3300022407 | Freshwater Lake | MENVSHEQIYERLIAVEGKVDRIDNNTKGLVEAIDAMQGAIKVLGWVASAAK |
| Ga0207955_10382591 | 3300025401 | Freshwater | MESVTHEQIYERLVSLEAKVDEIDINTKGMVEAFNNVQGAFKVLGWIASVAKPIIIVV |
| Ga0208875_10343781 | 3300025410 | Freshwater | MENVTHEQIYERLVSLEAKVDDIDINTKGMVEAFNNLQGAFKVLGWIA |
| Ga0208497_11073142 | 3300025466 | Freshwater | MEVVTHEQIYNRLISLETKVDSIDHNTKDMVQAFHNLQGAFKVLGWIASIAKPIIVV |
| Ga0208388_10324122 | 3300025778 | Freshwater | MEVTHEQIYERLKAVEEKVDRIDKNTIGLIDAFNAVQGAFKVLGWIAWLAKPV |
| Ga0208644_13572191 | 3300025889 | Aqueous | MSNVSHEQIYERLVAVEGKVDRIDNNTKGLVEAIDAAQGAIKVLGWI |
| Ga0208975_10138321 | 3300027659 | Freshwater Lentic | MEDQVTHSQIYERLLAVESKVDSIDQNTKGLVEAMKALDGAFKVLGWVASAAKPI |
| Ga0209033_12370761 | 3300027697 | Freshwater Lake | MKDVSHEQIYERLLAVEAKVDEIDKNTKDLVTAIDAA |
| Ga0209442_10941821 | 3300027732 | Freshwater Lake | MTEVTHEQIYERLLAVESKIDSIDKNTKGLVEAFDALQGAFKVLGW |
| Ga0209298_102324712 | 3300027973 | Freshwater Lake | MAEVTHEQIYERLIEVETKVDSIDKNTKGLVEAIN |
| Ga0315907_100664401 | 3300031758 | Freshwater | MKDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNW |
| Ga0315907_103050053 | 3300031758 | Freshwater | MSDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIASIAQPVLWIGG |
| Ga0315899_116652831 | 3300031784 | Freshwater | MTQEVTHEQIYERLLAVENKVDSIDKNTKDLVEAIDAAKGAVKVLNWIASIAQPV |
| Ga0315908_102978501 | 3300031786 | Freshwater | MTNEVTHEQIYERLCAVEAKVDQLDKNTKDLVEAIDAAKGAVKVLNWIASIAQPVL |
| Ga0315909_104319901 | 3300031857 | Freshwater | MEDQVTHSQIYARLLAVEAKVDSIDQNTKGLVEAMKALDGAFKVLGWI |
| Ga0315909_106751762 | 3300031857 | Freshwater | MSDVSHEQIYERLLAVEAKVDEIDKNTTDLVEAIDAAKGAVKVLNWIASIAQPVLWIGG |
| Ga0315909_107580552 | 3300031857 | Freshwater | MKDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAIDAAKGAVKVLNWIASIAQPVLWIGG |
| Ga0315904_100896407 | 3300031951 | Freshwater | MEDQVTHSQIYERLLAVESKVDSIDQNTKGLVEAMKALDGAFKVLGWIASA |
| Ga0315904_105017424 | 3300031951 | Freshwater | MENEVTHKQIYDRLVEVEAKVDSIDQNTKGLVEAMKALDGAFKVL |
| Ga0315901_100783238 | 3300031963 | Freshwater | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVDAIDA |
| Ga0315906_102100871 | 3300032050 | Freshwater | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVDAIDAAKGAVKVLNWIASI |
| Ga0315906_110011993 | 3300032050 | Freshwater | MSDVSHEQIYERLLAVEAKVDEIDKNTKDLVTAIDAAK |
| Ga0315905_100722395 | 3300032092 | Freshwater | MTDVSHEQIYERLLAVEAKVDEIDKNTKDLVEAID |
| Ga0315905_108670112 | 3300032092 | Freshwater | MTQEVTHEQIYERLLAVETKVDDIDKNTKGLVEAINALD |
| Ga0315905_108933692 | 3300032092 | Freshwater | MTQEVTHEQIYERLLAVETKVDDIDKNTKGLVEAINA |
| Ga0315905_110150804 | 3300032092 | Freshwater | MENEVTHKQIYDRLVEVEAKVDSIDQNTKGLVEAIKALDGAF |
| Ga0315903_108475471 | 3300032116 | Freshwater | MSNVSHEQIYERLLAVEAKVDEIDKNTKGLVEAINAAHGAVKVLNWIASIAQPVLWI |
| Ga0316224_10147555 | 3300032753 | Freshwater | MENVTHEQIYERLVSLEAKVDDIDINTKGMVEAFNNVQGAFKVLGWIASAAKPIIAI |
| Ga0334982_0515708_364_525 | 3300033981 | Freshwater | MQEVTHAQIYERLVAVEAKVDTIDKNTSDLVGAIEAAKGAVKVLNWIASIAQPV |
| Ga0334994_0029873_3423_3536 | 3300033993 | Freshwater | MENEVTHKQIYDRLVEVETKVDSIDQNTKGLVEAIKAL |
| Ga0334994_0292956_709_828 | 3300033993 | Freshwater | MSEVSHEQIYERLIAVEQKVDRIDNNTKGLVEAIDAAQGA |
| Ga0335003_0354373_480_641 | 3300033995 | Freshwater | MSDISHEQIYERLLAVELKVDEIDKNTKGLVDAINALDGAFKVLGWVASAAKPI |
| Ga0334995_0269091_971_1135 | 3300034062 | Freshwater | MSEVSHEQIYERLIAVEQKVDRIDNNTKGLVEAIDAAQGAVKVLGWIASLAKPML |
| Ga0335020_0064570_2_109 | 3300034082 | Freshwater | MTQEVTHEQIYERLLAVETKVDTIDKNTSGLVEAIK |
| Ga0335010_0620803_2_121 | 3300034092 | Freshwater | MKSEVSHEQIYERLLAVELKVDEIDKNTKGLVGAIDALDG |
| Ga0335012_0242280_3_143 | 3300034093 | Freshwater | MTQEVTHEQIYERLLAVENKVDSIDKNTSGLVDALKALDGAFKVLGW |
| Ga0335033_0013678_2_133 | 3300034117 | Freshwater | MQEVTHKQIYDRLIEVESKVDEIDKNTKGLVEAIDALQGAFKVL |
| Ga0335053_0693398_3_149 | 3300034118 | Freshwater | MENEVTHKQIYDRLVEVESKVDSIDQNTKGLVEAMKALDGAFKVLGWIA |
| ⦗Top⦘ |