Basic Information | |
---|---|
Family ID | F060716 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 43 residues |
Representative Sequence | LYMSGITDPKVLANAFIAGLIGPLLKAVQPNEKQFGIGAK |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 3.17 % |
% of genes near scaffold ends (potentially truncated) | 87.12 % |
% of genes from short scaffolds (< 2000 bps) | 86.36 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (76.515 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (26.515 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.818 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF01464 | SLT | 3.79 |
PF00145 | DNA_methylase | 2.27 |
PF13392 | HNH_3 | 1.52 |
PF01844 | HNH | 1.52 |
PF01555 | N6_N4_Mtase | 0.76 |
PF00196 | GerE | 0.76 |
PF13539 | Peptidase_M15_4 | 0.76 |
PF12537 | GPHR_N | 0.76 |
PF12728 | HTH_17 | 0.76 |
PF05869 | Dam | 0.76 |
PF14279 | HNH_5 | 0.76 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.27 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.76 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.76 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.06 % |
Unclassified | root | N/A | 18.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10148527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300001282|B570J14230_10164362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300003493|JGI25923J51411_1072561 | Not Available | 594 | Open in IMG/M |
3300003499|JGI25930J51415_1015989 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
3300004096|Ga0066177_10026401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1917 | Open in IMG/M |
3300004124|Ga0066178_10133957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300004126|Ga0066179_10130091 | Not Available | 668 | Open in IMG/M |
3300005525|Ga0068877_10572255 | Not Available | 617 | Open in IMG/M |
3300005581|Ga0049081_10257709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300005581|Ga0049081_10288445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300005583|Ga0049085_10272188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300005662|Ga0078894_10881031 | Not Available | 778 | Open in IMG/M |
3300005662|Ga0078894_10993064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300006005|Ga0073910_1006966 | Not Available | 734 | Open in IMG/M |
3300006802|Ga0070749_10738622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300006803|Ga0075467_10691470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300006920|Ga0070748_1270068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300007346|Ga0070753_1024205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2660 | Open in IMG/M |
3300007539|Ga0099849_1308955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300007559|Ga0102828_1052171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
3300008055|Ga0108970_10006959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300008258|Ga0114840_1052497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300008450|Ga0114880_1163494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300008450|Ga0114880_1163839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300008450|Ga0114880_1253876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300008450|Ga0114880_1268445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300009026|Ga0102829_1165757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
3300009026|Ga0102829_1274788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300009158|Ga0114977_10144700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300009181|Ga0114969_10431677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300009181|Ga0114969_10486465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300010157|Ga0114964_10279498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300010354|Ga0129333_10635781 | Not Available | 923 | Open in IMG/M |
3300010354|Ga0129333_10655992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300010370|Ga0129336_10034968 | Not Available | 3032 | Open in IMG/M |
3300010370|Ga0129336_10561114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300011009|Ga0129318_10260280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300012013|Ga0153805_1040607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300012013|Ga0153805_1056994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300012013|Ga0153805_1086529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300012666|Ga0157498_1041644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300013005|Ga0164292_10701419 | Not Available | 646 | Open in IMG/M |
3300013088|Ga0163200_1274047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300013092|Ga0163199_1119886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1075431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1322 | Open in IMG/M |
3300013372|Ga0177922_10676780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300017716|Ga0181350_1062298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300017761|Ga0181356_1112163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300017761|Ga0181356_1156675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300017761|Ga0181356_1227276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300017774|Ga0181358_1278349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300017777|Ga0181357_1338633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017778|Ga0181349_1168414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300017780|Ga0181346_1192502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300017780|Ga0181346_1199694 | Not Available | 722 | Open in IMG/M |
3300017784|Ga0181348_1064092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
3300017785|Ga0181355_1381956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300017785|Ga0181355_1387228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300019784|Ga0181359_1026961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2206 | Open in IMG/M |
3300020160|Ga0211733_11106655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1183 | Open in IMG/M |
3300020162|Ga0211735_11427232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300020172|Ga0211729_10726476 | Not Available | 1449 | Open in IMG/M |
3300020172|Ga0211729_11387710 | Not Available | 1286 | Open in IMG/M |
3300020548|Ga0208856_1015911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
3300020571|Ga0208723_1060593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300021962|Ga0222713_10066355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2687 | Open in IMG/M |
3300021962|Ga0222713_10272681 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
3300021963|Ga0222712_10669513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300022190|Ga0181354_1143633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300022198|Ga0196905_1083488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300022407|Ga0181351_1119090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
3300023184|Ga0214919_10571171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300023184|Ga0214919_10676519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300024346|Ga0244775_10527038 | Not Available | 963 | Open in IMG/M |
3300024533|Ga0256299_1070134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300025075|Ga0209615_100559 | All Organisms → Viruses → Predicted Viral | 3324 | Open in IMG/M |
3300025645|Ga0208643_1027613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1906 | Open in IMG/M |
3300027193|Ga0208800_1010503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
3300027486|Ga0255086_1014375 | All Organisms → Viruses → Predicted Viral | 1560 | Open in IMG/M |
3300027529|Ga0255077_1033764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300027578|Ga0255075_1004029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3245 | Open in IMG/M |
3300027581|Ga0209651_1082785 | Not Available | 918 | Open in IMG/M |
3300027631|Ga0208133_1141413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300027644|Ga0209356_1035207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1622 | Open in IMG/M |
3300027656|Ga0209357_1010539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3437 | Open in IMG/M |
3300027659|Ga0208975_1008028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3732 | Open in IMG/M |
3300027659|Ga0208975_1173945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300027688|Ga0209553_1133422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300027697|Ga0209033_1046194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1585 | Open in IMG/M |
3300027797|Ga0209107_10384404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300027808|Ga0209354_10029597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2188 | Open in IMG/M |
3300027963|Ga0209400_1221959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300028025|Ga0247723_1141674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300031857|Ga0315909_10235254 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
3300031951|Ga0315904_11452584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300031963|Ga0315901_10105799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2590 | Open in IMG/M |
3300031999|Ga0315274_11113768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300033980|Ga0334981_0460248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300033996|Ga0334979_0148336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300033996|Ga0334979_0521278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300034020|Ga0335002_0620192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034021|Ga0335004_0459772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300034021|Ga0335004_0716734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300034051|Ga0335024_0602516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300034061|Ga0334987_0547032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300034061|Ga0334987_0760766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300034062|Ga0334995_0518546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300034064|Ga0335001_0558412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300034066|Ga0335019_0716669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300034071|Ga0335028_0710197 | Not Available | 525 | Open in IMG/M |
3300034101|Ga0335027_0030338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4518 | Open in IMG/M |
3300034101|Ga0335027_0325318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300034102|Ga0335029_0508995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300034103|Ga0335030_0470305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300034106|Ga0335036_0427206 | Not Available | 844 | Open in IMG/M |
3300034106|Ga0335036_0855996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 520 | Open in IMG/M |
3300034108|Ga0335050_0330104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300034116|Ga0335068_0587867 | Not Available | 503 | Open in IMG/M |
3300034118|Ga0335053_0456364 | Not Available | 763 | Open in IMG/M |
3300034119|Ga0335054_0574393 | Not Available | 621 | Open in IMG/M |
3300034120|Ga0335056_0339699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300034120|Ga0335056_0658823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300034122|Ga0335060_0492526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300034272|Ga0335049_0066393 | Not Available | 2659 | Open in IMG/M |
3300034283|Ga0335007_0678430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300034356|Ga0335048_0169699 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 26.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.30% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.30% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.79% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.79% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.03% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.03% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.03% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.27% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 2.27% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.27% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.52% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.76% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.76% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.76% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.76% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.76% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.76% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.76% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013088 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200m | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_101485271 | 3300001282 | Freshwater | YMSGITDPKVLANAFIAGLIGPLLKALQPSEGQFGVTK* |
B570J14230_101643623 | 3300001282 | Freshwater | LYMSGITDPKVLANAFIAGLIGPLLKALQPSEGQFGVTK* |
JGI25926J51410_10440021 | 3300003490 | Freshwater Lake | LRASAAAAGALYMSGISDPKVLANAFVAGLVGPVCKALQPNEKEYGVGSGGGKSHQVA* |
JGI25923J51411_10725611 | 3300003493 | Freshwater Lake | ASAVALYISGITDPKVLLNAFLAGLLGPLVKALQPNQKDYGVNSK* |
JGI25930J51415_10159894 | 3300003499 | Freshwater Lake | LASVAALYISGITDPKVLANAFLAGLIGPLVKALQPNEKQYGIGAK* |
Ga0066177_100264011 | 3300004096 | Freshwater Lake | YMSGIQDPKVLANAFLAGLIGPLLRASSPKDDKFGVGAK* |
Ga0066178_101339573 | 3300004124 | Freshwater Lake | LFMSGITDPKVLANAFIAGLVGPLLKAIAPNEKQFGINSTSTTKKGK* |
Ga0066179_101300911 | 3300004126 | Freshwater Lake | VLYMSGISDPKVLANAFIAGLVGPLLKAIAPNEKQFGINSTFTTKKGK* |
Ga0068877_105722551 | 3300005525 | Freshwater Lake | ALASVAALYLAGITDPKVLANAFIAAFIGPVLKAVQPNEKQYGIGAK* |
Ga0049081_102577091 | 3300005581 | Freshwater Lentic | SGITDPKILANAFIAGLIGPLVKALQPNEKQFGIGAK* |
Ga0049081_102884451 | 3300005581 | Freshwater Lentic | TDPKTLANAFIAGLVGPLLKALSPSEKQFGVGAN* |
Ga0049085_102721883 | 3300005583 | Freshwater Lentic | AALYMSGISDPKVLANAFIAGLIGPLLRAINPNDAALGLVKK* |
Ga0078894_108810311 | 3300005662 | Freshwater Lake | YISGITDPKVLLNAFLAGIAAPLIKALQPNEKDYGISSK* |
Ga0078894_109930644 | 3300005662 | Freshwater Lake | GITDPKVLANAFIAGLIGPILKALQPSEKQIGIGSK* |
Ga0073910_10069662 | 3300006005 | Sand | ALASVAALYLAGITDPKVLANAFLAGLIGPVLKAVQPNEKQYGIGAK* |
Ga0070749_107386221 | 3300006802 | Aqueous | SGITDPKVLANAFIAGLLGPLVKALQPNEKQYGIGAK* |
Ga0075467_106914702 | 3300006803 | Aqueous | GRAALASVAALYMSGITDPKVLANALVASLIAPLLKGLQPNEQQYGIGAK* |
Ga0070748_12700681 | 3300006920 | Aqueous | ITDPKVLANAFVAGLIGPVLKAIAPNEKQLGIGAK* |
Ga0070753_10242051 | 3300007346 | Aqueous | ALYLSGITDPKVLANAFIAGLLGPLVKALQPNEKQYGIGAK* |
Ga0099849_13089553 | 3300007539 | Aqueous | AALASVAALYISGIIDPKVLANAFLAGLIGPLFKALQPNEPQFGVGAK* |
Ga0102828_10521714 | 3300007559 | Estuarine | YLRAALSCVGALYLSGISDPKVLANAFIAGPIGPLLKAIAPNEKQLGIGAK* |
Ga0108970_100069591 | 3300008055 | Estuary | YLRAALSCVGALYLSGISDPKVLANAFLAGLIGPVLKAVAPNEKQLGIGAK* |
Ga0114840_10524971 | 3300008258 | Freshwater, Plankton | SWARASFASVVALYMSGITDPKVLANAFLAGLLAPLAKALQPNEKEFGVNSK* |
Ga0114880_11634943 | 3300008450 | Freshwater Lake | ALASAAALYMSGITDPKVLANAFIAGLVGPLLKALQPSEKQYGLGSK* |
Ga0114880_11638393 | 3300008450 | Freshwater Lake | ALASAAALYMSGITDPKVLANAFIAGLVGPLLKALQPTEKQYGLGSK* |
Ga0114880_12538763 | 3300008450 | Freshwater Lake | ITDPKVLANAFIAGLIGPLLKAIQPSEKQLGVGAK* |
Ga0114880_12684452 | 3300008450 | Freshwater Lake | GRAALASVAALYLSGITDPKVLANAFIAGLIGPVVKALQPNEKQYGVGAK* |
Ga0102829_11657571 | 3300009026 | Estuarine | ASVAALYMSGITDYKVLANAFIAGLIGPLLKALQPSEKQLGVGAK* |
Ga0102829_12747881 | 3300009026 | Estuarine | ALSCVGALYLSGISDPKVLANAFLAGLIGPVLKAIAPNEKQLGVGAK* |
Ga0114980_1002080810 | 3300009152 | Freshwater Lake | YLSGITDPEILVNAFLAALLAPVMKALTPSEKEFGLKKK* |
Ga0114977_101447005 | 3300009158 | Freshwater Lake | YLRAALSCVGALYLSGISDPKVLANAFLAGLIGPLLKALAPNEKQLGIGAK* |
Ga0114970_101632795 | 3300009163 | Freshwater Lake | LYISGISDPKILANAFLAGLAGPLIKALQPSEKEFGIKK* |
Ga0114969_104316772 | 3300009181 | Freshwater Lake | WLRASAASALALYISGISDPKILANAFLAGLAGPLIKALQPNEKEFGIKK* |
Ga0114969_104864653 | 3300009181 | Freshwater Lake | LRAALSCVGALYLSGISDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK* |
Ga0114964_102794981 | 3300010157 | Freshwater Lake | ALSAAGALYISGITDPKVLANAFIAGLVGPLLKALAPNEKQFGVRSK* |
Ga0129333_106357811 | 3300010354 | Freshwater To Marine Saline Gradient | YISGITDPKVLLNAFLAGIAAPLLKALQPNEKEFGITKK* |
Ga0129333_106559924 | 3300010354 | Freshwater To Marine Saline Gradient | LYISGMTDPKVLLNAFIAGLVGPIIKALQPNEKDYGVGSK* |
Ga0129336_100349687 | 3300010370 | Freshwater To Marine Saline Gradient | AMAQSWARASMASVVALYISGITDPKVLANAFLAGLLGPLAKALQPNEKEFGRNSK* |
Ga0129336_105611143 | 3300010370 | Freshwater To Marine Saline Gradient | AALYISGITDPKVLLNAFVAGLVGPLLKALQPNEKDFGLGSK* |
Ga0129318_102602801 | 3300011009 | Freshwater To Marine Saline Gradient | GITDPKVLANAFIAGLVGPLLKAMQPSEKQYGLGSK* |
Ga0153805_10406073 | 3300012013 | Surface Ice | ASLASAVALYISGITDPKVLLNAFLAGLLGPLVKALQPNQRDYGVNSK* |
Ga0153805_10569943 | 3300012013 | Surface Ice | LASVAALYLAGITDPKVLANAFIAGLIGPIVKALQPNEKQYGIGSKK* |
Ga0153805_10865291 | 3300012013 | Surface Ice | LYLAGITDPKVLANAFLAGLIGPVLKAIQPNEKQYGIGSKK* |
Ga0157498_10416442 | 3300012666 | Freshwater, Surface Ice | SGITDPKVLANAFLAGLAAPALKALQPNEKEFGVKSK* |
Ga0164292_107014191 | 3300013005 | Freshwater | MAGITDPKVLANAFVAALAGPLLKALQPNEKEFGIKK* |
Ga0163200_12740471 | 3300013088 | Freshwater | IRAAASCAGALYLSGITDPKTLANAFLAGLIGPAIKALTPSESAFGLGSK* |
Ga0163199_11198865 | 3300013092 | Freshwater | SGISDPKVLANAFIAGLVGPILKALQPSEKQFGLVKK* |
(restricted) Ga0172374_10754314 | 3300013122 | Freshwater | GITDPKVLANAFIAALIGPLLKAVQPNEKQFGIGAK* |
Ga0177922_106767802 | 3300013372 | Freshwater | ALYLSGITDPKILANAFIAGLIGPLVKALQPNEKQFGLGAK* |
Ga0181350_10622984 | 3300017716 | Freshwater Lake | GITDPKTLANAFIAGLIGPLMKALQPNEKQLGIGAK |
Ga0181356_11121631 | 3300017761 | Freshwater Lake | RAAISCVGALYLSGITDPKVLANAFIAGLLGPLIKALQPGEKSLGIGSK |
Ga0181356_11566754 | 3300017761 | Freshwater Lake | SVAALYLAGITDPKVLANAFIAGLIGPIVKALQPNEKQYGIGSKK |
Ga0181356_12272763 | 3300017761 | Freshwater Lake | LAGITDPKVLANAFLAGLIGPVLKAIQPNEKQYGIGSKK |
Ga0181358_12783491 | 3300017774 | Freshwater Lake | LYMSGITDPKVLANAFIAGLVGPLLKAIAPNEKQFGIGSK |
Ga0181357_13386331 | 3300017777 | Freshwater Lake | YLSGISDPKVLANAFIAGLLGPLIKALQPGEKSLGIGSK |
Ga0181349_11684144 | 3300017778 | Freshwater Lake | LSGITDPKVLVNAFIAGLIGPVLKAIAPNEKQLGIGAK |
Ga0181346_11925023 | 3300017780 | Freshwater Lake | ARASIAAVAALYMSGVTDPKVLANAFIAGLIGPLLKAVQPSEKQYGIGSK |
Ga0181346_11996941 | 3300017780 | Freshwater Lake | ALASVAALYISGITDPKVLANAFIAGLIGPLLKAVQPNEKQFGIGAK |
Ga0181348_10640924 | 3300017784 | Freshwater Lake | MSGITDPKVLANAFIAGLVGRLLKAIAPNKTQFGLGNKSTTNKGK |
Ga0181355_13819561 | 3300017785 | Freshwater Lake | LSCVGALYLSGISDPKVLANAFIAGLIGPLIKALQPGEKSLGIGSK |
Ga0181355_13872281 | 3300017785 | Freshwater Lake | YGRAALASVAALYISGITDPKVLANAFLAGLIGPLVKALQPNEKQFGVGSK |
Ga0181359_10269611 | 3300019784 | Freshwater Lake | VSGITDPKVLANAFIAGLIGPVLKAVAPNEKQLGIGAK |
Ga0211733_111066551 | 3300020160 | Freshwater | ALASAAALYMSGISDPKVLANAFIAGLVGPLLKALQPSEKQYGLGSK |
Ga0211735_114272321 | 3300020162 | Freshwater | ITDPKVLANAFIAGLIGPLLKALQPSEKEIGIGAK |
Ga0211729_107264761 | 3300020172 | Freshwater | VAQSWLRASAAAVLALYISGITDPKILANAFLAGLAAPALKALQPNEKEFGVKSK |
Ga0211729_113877101 | 3300020172 | Freshwater | ITDPKVLVNAFVAGLVGPLVKALQPSEKEFGITKK |
Ga0208856_10159114 | 3300020548 | Freshwater | LASVAALYMSGITDPKVLANAFIAGLVGPLLKAVQPSEKQYGIGSK |
Ga0208723_10605931 | 3300020571 | Freshwater | LSCVGALYLSGISDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0222713_100663551 | 3300021962 | Estuarine Water | VAALYISGITDPKVLANAFIAGLLGPLVKALQPNEKQYGIGAE |
Ga0222713_102726811 | 3300021962 | Estuarine Water | LYMSGITDPKVLANAFIAGLIGPLLKAVQPNEKQFGIGAK |
Ga0222712_106695133 | 3300021963 | Estuarine Water | GRAALASVAALYISGITDPKVLANAFLAGLVGPLFKALQPNEKQFGVGSK |
Ga0181354_11436334 | 3300022190 | Freshwater Lake | LASVAALYLAGITDPKVLANAFIAGLIGPIVKALQPNEKQYGIGSKK |
Ga0181354_12312973 | 3300022190 | Freshwater Lake | YMSGISDPKVLANAFIAGLIGPVLKALDPKDSSIGLGSK |
Ga0196905_10834881 | 3300022198 | Aqueous | ALASVAALYISGITDPKVLANAFLAGLIGPFLKALQPSEKQFGIGAK |
Ga0181351_11190904 | 3300022407 | Freshwater Lake | ITDPKVLANAFIAGLIGPLLKAVAPNEKQFGIGAK |
Ga0214919_105711714 | 3300023184 | Freshwater | GALYISGISDPKILANAFIAAVIAPVLKALAPNEKQYGIGSK |
Ga0214919_106765193 | 3300023184 | Freshwater | RAAISCVGALYLSGISDPKVLANAFIAGLIGPVLKALAPNEKQLGIGSK |
Ga0244775_105270381 | 3300024346 | Estuarine | GITDPKVLANAFVAGLVGPLVKALQPNEKEFGIKK |
Ga0256299_10701343 | 3300024533 | Freshwater | YGRAALASVAALYLAGITDPKVLANAFLAGLIGPVLKAIQPNEKQYGIGSKK |
Ga0209615_10055910 | 3300025075 | Freshwater | ALASAAALYMSGITDPKVLANAFIAGLIGPLLKALQPSESQFGVKK |
Ga0208643_10276131 | 3300025645 | Aqueous | GITEPKVLANAFIAGLLGPLVKALQPNEKQYGIGAK |
Ga0208800_10105031 | 3300027193 | Estuarine | GALYLSGISDPKVLANAFIAGLIGPVLKAIAPTEKQFGVGAK |
Ga0255086_10143751 | 3300027486 | Freshwater | ITDPKVLANAFIAGLIGPIVKALQPNEKQYGIGSKK |
Ga0255077_10337641 | 3300027529 | Freshwater | LRAALSCVGALYLSGISDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0255075_100402910 | 3300027578 | Freshwater | LYLSGITDPKILANAFLAGLIGPVLKAVAPNEKQLGIGSK |
Ga0209651_10827853 | 3300027581 | Freshwater Lake | SYLRASAAAAGALYMSGISDPKVLANAFVAGLVGPVCKALQPNEKEYGVGSGGGKSHQVA |
Ga0208133_11414131 | 3300027631 | Estuarine | YMSGISDPKVLANAFIAGLIGPLLKALQPSEGQFGVKK |
Ga0209356_10352075 | 3300027644 | Freshwater Lake | SGVTDPKTLANAFLAGLIGPLLRALNPSDKSFGVK |
Ga0209357_10105399 | 3300027656 | Freshwater Lake | YLSGITDPKVLANAFIAGLIGPLLKAVAPNEKQFGIGAK |
Ga0208975_100802810 | 3300027659 | Freshwater Lentic | AISCVGALYLSGITDPKTLANAFIAGLVGPLLKALSPSEKQFGVGAN |
Ga0208975_11739451 | 3300027659 | Freshwater Lentic | LYMSGITDPKVLANAFIAGLVGPLLKAIAPNEKQFGVGAK |
Ga0209553_11334221 | 3300027688 | Freshwater Lake | LYLAGITDPKVLANAFLAGLIGPVLKAIQPNEKQYGIGSKK |
Ga0209033_10461944 | 3300027697 | Freshwater Lake | LASVAALYISGITDPKVLANAFLAGLIGPLVKALQPNEKQYGIGAK |
Ga0209442_12799592 | 3300027732 | Freshwater Lake | ALYMSGISDPKVLANAFVAGLVGPVCKALQPNEKEYGVGSGGGKSHQVA |
Ga0209107_103844041 | 3300027797 | Freshwater And Sediment | RSAVACAAALYMSGITDPKVLANAFIAGLIGPLLKAVQPSEGQFGVTK |
Ga0209354_100295978 | 3300027808 | Freshwater Lake | YLSGISDPKILANAFVAGLIGPLLKAITPSDKSFGLGAK |
Ga0209354_102025891 | 3300027808 | Freshwater Lake | LYLSGITDPKTLANAFIAGLLGPLIKALQPGEKQYGIGSK |
Ga0209400_12219591 | 3300027963 | Freshwater Lake | AIYMSGISEPKILANAFIAGLLGPLLKALAPNEKQIGIGSK |
Ga0247723_11416741 | 3300028025 | Deep Subsurface Sediment | SGITDPKTLANAFIAGLVGPILKALAPSEKQFGVGAN |
Ga0315909_102352541 | 3300031857 | Freshwater | YGRAALASVAALYLSGITDPKILANAFIAGLIGPLVKAVQPNEKQYGIGAK |
Ga0315904_114525841 | 3300031951 | Freshwater | VAALYMSGITDPKVLANAFIAGLIGPLLKALQPSEGELGIKK |
Ga0315901_101057991 | 3300031963 | Freshwater | SGITDPKVLANAFIAGLIGPLLKAMQPSEKQLGVGAK |
Ga0315274_111137684 | 3300031999 | Sediment | YLSGISDPKVLANAFIAGLVGPILKALQPSEKQFGLVKK |
Ga0334981_0460248_2_139 | 3300033980 | Freshwater | LASAAALYMSGITDPKVLANAFIAGLIGPLLKALQPSEGQFGVTK |
Ga0334979_0148336_33_149 | 3300033996 | Freshwater | MSGISDPKVLANAFIAGLIGPLLKALQPSEKQLGVGAK |
Ga0334979_0521278_533_640 | 3300033996 | Freshwater | ITDPKVLANAFIAGLVGPLLKALQPSEKQYGLGSK |
Ga0335002_0620192_423_557 | 3300034020 | Freshwater | CVGALYLSGITDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0335004_0459772_571_705 | 3300034021 | Freshwater | CVGALYLSGITDPKVLANAFLAGLIGPVLKALAPNEKQLGIGAK |
Ga0335004_0716734_45_167 | 3300034021 | Freshwater | LYLAGITDPKVLANAFIAAFIGPVLKAVQPNEKQYGIGAK |
Ga0335024_0602516_409_525 | 3300034051 | Freshwater | LSGISDPKVLANAFLAGLIGPVLKAIAPNEKQLGVGAK |
Ga0334987_0547032_63_179 | 3300034061 | Freshwater | MSGITDPKVLANAFIAGLVGPLLKAVQPSEKQYGLGSK |
Ga0334987_0760766_2_109 | 3300034061 | Freshwater | SGVTDPKTLANAFIAGLIGPLLRGLNHSDKTFGIK |
Ga0334995_0518546_543_659 | 3300034062 | Freshwater | MSGITDPKVLANAFIAGLVGPLLKAVQPSEKQYGIGSK |
Ga0335001_0558412_306_437 | 3300034064 | Freshwater | VGALYLSGITDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0335019_0716669_439_573 | 3300034066 | Freshwater | SAAALYMSGITDPKVLANAFIAGLVGPLLKAVQPSEKQYGLGAK |
Ga0335028_0710197_45_164 | 3300034071 | Freshwater | MYMAGITDPKVLANAFVAALAGPLLKALQPNEKEFGIKK |
Ga0335027_0030338_4389_4517 | 3300034101 | Freshwater | GALYLSGISDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0335027_0325318_3_152 | 3300034101 | Freshwater | RAALACVGALYLSGITDPKVLANAFLAGLIGPVLKAVAPNEKQLGIGAK |
Ga0335029_0508995_2_121 | 3300034102 | Freshwater | YLSGILDPKVLANAFLAGLIGPLLKAIQPSEKQLGVGAK |
Ga0335030_0470305_3_122 | 3300034103 | Freshwater | YISGITDPKILLNAFLAGIAAPLLKALQPNEKDYGIGSK |
Ga0335036_0427206_697_843 | 3300034106 | Freshwater | AALASVAALYMSGIQDPKVLANAFIAGLVGPLMKAVQPNEKQYGIGSK |
Ga0335036_0855996_2_139 | 3300034106 | Freshwater | ASVAALYMSGIQDPKVLANAFIAGLVGPLMKAIQPNEKQYGIGSK |
Ga0335050_0330104_575_712 | 3300034108 | Freshwater | ACVGALYLSGITDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0335068_0587867_384_500 | 3300034116 | Freshwater | MAGITDPKVLANAFLAALAGPLLKALQPNEKEFGITKK |
Ga0335053_0456364_8_175 | 3300034118 | Freshwater | MAQSWARASASAVLALYISGITDPKVLANAFLAGLAAPALKALQSNEKEFGRNSK |
Ga0335054_0574393_490_621 | 3300034119 | Freshwater | VLALYISGITDPKILLNAFLAGIAAPLLKALQPNEKDYGIGSN |
Ga0335056_0339699_674_790 | 3300034120 | Freshwater | MSGITDPKILANAFIAGLVGPLLKAVQPSEKQYGLGSK |
Ga0335056_0658823_3_143 | 3300034120 | Freshwater | LACVGALYLSGITDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0335060_0492526_14_130 | 3300034122 | Freshwater | MSGITDPKVLANAFIAGLIGPLLKALQPSEKQYGLGSK |
Ga0335049_0066393_2551_2658 | 3300034272 | Freshwater | ITDPKVLANAFLAGLLGPLAKALQPNEKEFGRNSK |
Ga0335007_0678430_2_157 | 3300034283 | Freshwater | YLRAALSCVGALYLSGITDPKVLANAFLAGLIGPVLKAIAPNEKQLGIGAK |
Ga0335048_0169699_21_137 | 3300034356 | Freshwater | MSGITDPKVLANAFIAGLIGPLVKAVQPNEKQYGIGAK |
⦗Top⦘ |