NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060694

Metagenome Family F060694

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060694
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 38 residues
Representative Sequence VRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLIL
Number of Associated Samples 101
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.88 %
% of genes near scaffold ends (potentially truncated) 12.12 %
% of genes from short scaffolds (< 2000 bps) 85.61 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.485 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(19.697 % of family members)
Environment Ontology (ENVO) Unclassified
(29.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.515 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF12773DZR 16.67
PF00334NDK 12.12
PF08245Mur_ligase_M 5.30
PF02545Maf 3.79
PF10458Val_tRNA-synt_C 3.03
PF08241Methyltransf_11 2.27
PF04166PdxA 0.76
PF00119ATP-synt_A 0.76
PF04093MreD 0.76
PF02653BPD_transp_2 0.76
PF12911OppC_N 0.76
PF06723MreB_Mbl 0.76
PF02749QRPTase_N 0.76
PF00144Beta-lactamase 0.76
PF00005ABC_tran 0.76
PF01323DSBA 0.76
PF04280Tim44 0.76
PF08545ACP_syn_III 0.76
PF08397IMD 0.76
PF00583Acetyltransf_1 0.76
PF08264Anticodon_1 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 12.12
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 3.79
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 0.76
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 0.76
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.76
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.76
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.76
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.76
COG19954-hydroxy-L-threonine phosphate dehydrogenase PdxACoenzyme transport and metabolism [H] 0.76
COG2367Beta-lactamase class ADefense mechanisms [V] 0.76
COG2891Cell shape-determining protein MreDCell wall/membrane/envelope biogenesis [M] 0.76
COG4395Predicted lipid-binding transport protein, Tim44 familyLipid transport and metabolism [I] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.48 %
UnclassifiedrootN/A1.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_36906_len_2726_cov_20_373074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2776Open in IMG/M
3300000956|JGI10216J12902_104380859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300001537|A2065W1_10607817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300001686|C688J18823_10945162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300004480|Ga0062592_101814240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300005186|Ga0066676_10068524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2074Open in IMG/M
3300005526|Ga0073909_10209023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300005526|Ga0073909_10306182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300005526|Ga0073909_10348328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300005534|Ga0070735_10014501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5870Open in IMG/M
3300005540|Ga0066697_10216471All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300005552|Ga0066701_10215416All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300005553|Ga0066695_10192592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300005556|Ga0066707_10538427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300005614|Ga0068856_101785695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300005713|Ga0066905_101092280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300005764|Ga0066903_100029049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6191Open in IMG/M
3300005764|Ga0066903_100633769All Organisms → cellular organisms → Bacteria1863Open in IMG/M
3300005764|Ga0066903_101122427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1452Open in IMG/M
3300005764|Ga0066903_102532710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales994Open in IMG/M
3300005844|Ga0068862_101005223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300005844|Ga0068862_102514461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300005985|Ga0081539_10001713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria35164Open in IMG/M
3300006032|Ga0066696_10251370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1142Open in IMG/M
3300006032|Ga0066696_11006220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300006046|Ga0066652_100189031All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300006806|Ga0079220_12117175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300006854|Ga0075425_101744027All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300009012|Ga0066710_101291343All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300009012|Ga0066710_101676773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria969Open in IMG/M
3300009012|Ga0066710_104445600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300009088|Ga0099830_10274081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1341Open in IMG/M
3300009089|Ga0099828_11010077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300009090|Ga0099827_10002177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10733Open in IMG/M
3300009090|Ga0099827_10184748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1726Open in IMG/M
3300009098|Ga0105245_11537668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300009137|Ga0066709_100174819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2786Open in IMG/M
3300009137|Ga0066709_101279970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1077Open in IMG/M
3300009137|Ga0066709_101281291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1076Open in IMG/M
3300009137|Ga0066709_103893085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300009176|Ga0105242_11468450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300009545|Ga0105237_12235915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300009789|Ga0126307_10002936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11599Open in IMG/M
3300009789|Ga0126307_10003674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10526Open in IMG/M
3300009840|Ga0126313_10224952All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300010036|Ga0126305_10473740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300010037|Ga0126304_11077239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300010039|Ga0126309_10579324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300010039|Ga0126309_11061553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300010044|Ga0126310_11416069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300010044|Ga0126310_11517626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300010166|Ga0126306_10779239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300010360|Ga0126372_11221614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300010375|Ga0105239_10981273All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300011119|Ga0105246_11032095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300012011|Ga0120152_1026460All Organisms → cellular organisms → Bacteria2106Open in IMG/M
3300012011|Ga0120152_1030435All Organisms → cellular organisms → Bacteria1915Open in IMG/M
3300012096|Ga0137389_10965379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium731Open in IMG/M
3300012201|Ga0137365_11082379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300012204|Ga0137374_10000925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria32275Open in IMG/M
3300012204|Ga0137374_10008416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12202Open in IMG/M
3300012204|Ga0137374_10030676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5884Open in IMG/M
3300012204|Ga0137374_10697230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300012204|Ga0137374_10928248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300012204|Ga0137374_11054488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300012209|Ga0137379_10748885All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300012210|Ga0137378_10405915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1264Open in IMG/M
3300012212|Ga0150985_106066265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1237Open in IMG/M
3300012212|Ga0150985_122550462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2507Open in IMG/M
3300012285|Ga0137370_10857862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300012349|Ga0137387_10751567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300012350|Ga0137372_10007077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia10859Open in IMG/M
3300012350|Ga0137372_10033238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4712Open in IMG/M
3300012350|Ga0137372_10331021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1171Open in IMG/M
3300012353|Ga0137367_11213456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300012469|Ga0150984_110154786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300012901|Ga0157288_10273055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300012902|Ga0157291_10224385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300012922|Ga0137394_11553165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300012958|Ga0164299_10812479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300012961|Ga0164302_11674356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300012972|Ga0134077_10149104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300012984|Ga0164309_11606217All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300013296|Ga0157374_12134926All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300013501|Ga0120154_1021836All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300015264|Ga0137403_10727866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium851Open in IMG/M
3300015265|Ga0182005_1118127All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300015358|Ga0134089_10445628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300015371|Ga0132258_11329492All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300015371|Ga0132258_12437576All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300015371|Ga0132258_13964316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300015372|Ga0132256_102556098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300015373|Ga0132257_102408107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300015373|Ga0132257_103934563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300015373|Ga0132257_104526749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300018027|Ga0184605_10116958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1185Open in IMG/M
3300018061|Ga0184619_10338896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300018071|Ga0184618_10137028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300018072|Ga0184635_10163021All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300018431|Ga0066655_10948458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300018468|Ga0066662_10525460Not Available1086Open in IMG/M
3300018468|Ga0066662_11151105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300022756|Ga0222622_10143980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1529Open in IMG/M
3300024187|Ga0247672_1046110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria720Open in IMG/M
3300024330|Ga0137417_1410347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2052Open in IMG/M
3300025915|Ga0207693_11475708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300025929|Ga0207664_10823839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300025936|Ga0207670_10968337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300025939|Ga0207665_10502296All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300025986|Ga0207658_11595201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae597Open in IMG/M
3300026075|Ga0207708_10810353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei806Open in IMG/M
3300026313|Ga0209761_1149441All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300026324|Ga0209470_1278391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300026524|Ga0209690_1104852All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300026550|Ga0209474_10632114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300027821|Ga0209811_10305478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300027862|Ga0209701_10208157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1163Open in IMG/M
3300027874|Ga0209465_10669370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300027882|Ga0209590_10001972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei8092Open in IMG/M
3300027882|Ga0209590_10132933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300027986|Ga0209168_10010729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5486Open in IMG/M
3300028744|Ga0307318_10110082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria935Open in IMG/M
3300028824|Ga0307310_10755349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300028828|Ga0307312_10638508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300028878|Ga0307278_10258855All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300028885|Ga0307304_10554915Not Available530Open in IMG/M
3300031543|Ga0318516_10810489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300031548|Ga0307408_101533339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300031890|Ga0306925_11961019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300031938|Ga0308175_100206209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1940Open in IMG/M
3300031996|Ga0308176_12326795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300033004|Ga0335084_10618307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.09%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.58%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil7.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.03%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012011Permafrost microbial communities from Nunavut, Canada - A30_65cm_6MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_009375802088090008SoilVHSWKERLAVFAFALAVITSIVAVAFATGYIIGKLIL
JGI10216J12902_10438085923300000956SoilVQGWGERLAVLGFAAALLAAFVGLSFALGYIIGRLIL*
A2065W1_1060781723300001537PermafrostVHSWKERLAVFAFALAVITGIVAVAFATGYIIGKLIL*
C688J18823_1094516223300001686SoilVQQTWGERLAVFVFALALLAGLIGVTFAAGYIIGRLIL*
Ga0062592_10181424023300004480SoilGKVRQTWGERLAVFTFALALLAGIVGVSFAAGYIIGKLIL*
Ga0066676_1006852423300005186SoilVVQQTWGERLAVFVFALALLAGIIGVTFAAGYIIGRLIL*
Ga0073909_1020902313300005526Surface SoilVRQTWGQRLAVFAFALALLAGIVGASFAAGYIIGKLIL*
Ga0073909_1030618223300005526Surface SoilMHQTWGERLAVFAFAFLLLAGVVGVTFAAGYIIGRLIL*
Ga0073909_1034832823300005526Surface SoilVQSWKERLAVFAFALAFITAIVLGAFAAGYIIGKLIL*
Ga0070735_1001450163300005534Surface SoilMRTTWGERLAVFAFALAVVAAIVGAAFAAGYIIGRLIL*
Ga0066697_1021647123300005540SoilVRQTWGERLAVFVFALALVAGIVGVSFAAGYIIGRLIL*
Ga0066701_1021541613300005552SoilVRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGRLIL*
Ga0066695_1019259213300005553SoilNEKVRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLIL*
Ga0066707_1053842713300005556SoilVRQSWGERLAVLAFALALVGAIVGVAFAAGYIIGRLIL*
Ga0068856_10178569523300005614Corn RhizosphereVQQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL*
Ga0066905_10109228023300005713Tropical Forest SoilMHQTWGERLAVFAFALLLLAGLVGVTFAAGYIIGRLIL*
Ga0066903_10002904943300005764Tropical Forest SoilMHQTWGQRLAVFAFAFAILAGVVGVTFAAGYIIGRLIL*
Ga0066903_10063376943300005764Tropical Forest SoilMHQTWGERLAVFAFALALLAGLVGVTFAAGYIIGRLIL*
Ga0066903_10112242723300005764Tropical Forest SoilMHQTWGERLAVFAFALAILAGLVGVTFAAGYIIGRLIL*
Ga0066903_10253271023300005764Tropical Forest SoilMHQTWGERLAVFGFAFLLLAGVVGVTFAAGYIIGRLIL*
Ga0068862_10100522323300005844Switchgrass RhizosphereVRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL*
Ga0068862_10251446123300005844Switchgrass RhizosphereVHSWKERLSVFAFALAVVAAIVGAAFATGYIIGKLIL*
Ga0081539_10001713263300005985Tabebuia Heterophylla RhizosphereVQDWSERLAVLGFALALLAAFVGLSFAVGYIIGKLIL*
Ga0066696_1025137023300006032SoilMRTTWGERLAVFAFAAAVLAAIVGAAFAAGYIIGKLIL*
Ga0066696_1100622013300006032SoilVRQSWGDRIAVFAFALAVVAAIVGISFAAGYIIGKLIL*
Ga0066652_10018903123300006046SoilVQQTWGERLAVFFFALALLAGLVGVTFAAGYIIGRLIL*
Ga0079220_1211717523300006806Agricultural SoilWGERLAVFGFALALLAGLVGVTFAAGYIIGRLIL*
Ga0075425_10174402723300006854Populus RhizosphereVRQTWGDRLAVFAFGLCVVAAIVGISFAAGYIIGKLIL*
Ga0066710_10129134333300009012Grasslands SoilVRQSWGDRLAVFAFALAVVAAIVGISFAAGYIIGKLIL
Ga0066710_10167677323300009012Grasslands SoilVRQTWGERLAVFVFALALVAGIVGVSFAAGYIIGRLIL
Ga0066710_10444560023300009012Grasslands SoilVRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLIL
Ga0099830_1027408123300009088Vadose Zone SoilVRQSWGERLAVLAFALALVGAIVGVAFAAGYIIGKLIL*
Ga0099828_1101007723300009089Vadose Zone SoilVRQSWGERLAVFVFALAVVAAIVGVAFAAGYIIGKLIL*
Ga0099827_1000217793300009090Vadose Zone SoilVRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGKLIL*
Ga0099827_1018474823300009090Vadose Zone SoilVRQTWGQRLAVFAFALALIAGIVGVSFAAGYIIGRLIL*
Ga0105245_1153766813300009098Miscanthus RhizosphereHVRQTWGQRFAVFAFALALLALIVGASFAAGYIIGRLIL*
Ga0066709_10017481923300009137Grasslands SoilVRQSWGDRLAVFAFALAVVAAIVGISFAAGYIIGKLIL*
Ga0066709_10127997023300009137Grasslands SoilVRQSWGERLAVLAFALALLGAIVGVAFAAGYIIGKLIL*
Ga0066709_10128129123300009137Grasslands SoilMRQRRSRLGVLAFATAALLAIVGLAFAAGYIIGKLVL*
Ga0066709_10389308513300009137Grasslands SoilVESWKERLAVFAFALGVITAIVVVAFAAGYIIGKLIL*
Ga0105242_1146845023300009176Miscanthus RhizosphereVQQTWGERLAVFAFALAILAGLVGVTFAAGYIIGRLIL*
Ga0105237_1223591513300009545Corn RhizosphereNEVVRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL*
Ga0126307_1000293633300009789Serpentine SoilVQTWGERLAVLAFALTLLAAFVGLSFAVGYIIGRLIL*
Ga0126307_1000367483300009789Serpentine SoilVQTWGERLTVLAFALALLVAFVGLSFAAGYIIGRLIL*
Ga0126313_1022495233300009840Serpentine SoilVQQTWGERLAVFVFALAILAGLVGVTFAAGYIIGRLIL*
Ga0126305_1047374013300010036Serpentine SoilVQTWGERLAVLAFALTLLAAFVGLSFAAGYIIGRLIL*
Ga0126304_1107723923300010037Serpentine SoilVQTWGERLTVLAFALALLAAFVGLSFAGGYIIGRLIL*
Ga0126309_1057932423300010039Serpentine SoilVQTWGERLAVLAFALTLLVGFVGLSFAAGYIIGRLIL*
Ga0126309_1106155323300010039Serpentine SoilQTWGQRLAVFTFALALLGGIVGVSFAAGYIIGKLIL*
Ga0126310_1141606923300010044Serpentine SoilVRQTWGQRLAVFTFALALLTGIVGVSFAAGYIIGKLIL*
Ga0126310_1151762623300010044Serpentine SoilVQTWGERLGVLAFAVVLLAAFVGVSFATGYIIGRLIL*
Ga0126306_1077923923300010166Serpentine SoilVQTWGERLAVLAFALALLAAFVGLSFAAGYIIGRLIL*
Ga0126372_1122161413300010360Tropical Forest SoilVRHTWGERIAVFAFAIALVAAIVGASFAAGYIIGRLIL*
Ga0105239_1098127323300010375Corn RhizosphereVHQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL*
Ga0105246_1103209513300011119Miscanthus RhizosphereRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL*
Ga0120152_102646043300012011PermafrostVRQTWRERLAVFMFAVAFIAAIVGISFAAGYIIGKLIL*
Ga0120152_103043523300012011PermafrostVQSWKERLAVFAFALGLITGIVVVAFAAGYIIGKLIL*
Ga0137389_1096537923300012096Vadose Zone SoilVRQSWGERLAVFAFALAVVAAIVGVAFAAGYRIGRLIL*
Ga0137365_1108237923300012201Vadose Zone SoilVQQTWGERLAVFAFALALLAGLVGVTFAAGFLIGRILL*
Ga0137374_10000925213300012204Vadose Zone SoilVHGWGDRLAVLGFALALLAAFVGLSFTVGYIIGKLIL*
Ga0137374_10008416123300012204Vadose Zone SoilMRTTWGERLAVFAFALAVLFAIVGAAFAAGYIIGKLIL*
Ga0137374_1003067643300012204Vadose Zone SoilVQTWGERLGVLAFALVLLGAFVGLSFATGYIIGRLIL*
Ga0137374_1069723023300012204Vadose Zone SoilVRQTWGERLAVFGFALALLAGIVGVSFAAGYIIGKLIL*
Ga0137374_1092824823300012204Vadose Zone SoilVRQTWGERLAVFAFALALLAGIVGVSFAAGYIIGRIIL*
Ga0137374_1105448823300012204Vadose Zone SoilVQTWGERLGVLAFALVLLAAFVGLSFATGYIIGRLIL*
Ga0137379_1074888513300012209Vadose Zone SoilVRQSWGERLAVFAFALAVVAAIVGISFAAGYIIGKLIL*
Ga0137378_1040591533300012210Vadose Zone SoilVESWKERLAVFAFALGLITGIVVVAFAAGYIIGKLIL*
Ga0150985_10606626543300012212Avena Fatua RhizosphereWGERLAVFVFALAILAGLVGVTFAAGYIIGRLIL*
Ga0150985_12255046223300012212Avena Fatua RhizosphereVRQTWGDRLAVFAFALCVVAAIVGISFAAGYIIGKLIL*
Ga0137370_1085786213300012285Vadose Zone SoilAVRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLIL*
Ga0137387_1075156713300012349Vadose Zone SoilVRQTWGQRLAVFAFALALMAGIVGVSFAAGYIIGRLIL*
Ga0137372_1000707793300012350Vadose Zone SoilVRQTWGQRLAVFTFALALLAGIVGVSFAAGYIIGKLIL*
Ga0137372_1003323863300012350Vadose Zone SoilVRQSWGERLAVFAFALAVLAAIVGASFAAGYIIGKLIL*
Ga0137372_1033102123300012350Vadose Zone SoilMRQTWGERVAVFVFALALLAAIVGVSFAAGYIIGKLIL*
Ga0137367_1121345623300012353Vadose Zone SoilVRQSWGERLAVFAFALAVLAAIVGFSFAAGYIIGKLIL*
Ga0150984_11015478613300012469Avena Fatua RhizosphereVRQTWGERLAVFAFALALLAGLVGVTFAAGYIIGRLIL*
Ga0157288_1027305523300012901SoilVRQTWRERLEVFTFGLALLAGIVGVSFAAGYIIGKLIL*
Ga0157291_1022438523300012902SoilVRQTWGDRLVVFAFALGLIAAIVGISFGAGYIIGRLIL*
Ga0137394_1155316523300012922Vadose Zone SoilVQSWKERLAVFGFALAVITAIVVVAFAAGYIIGKLIL*
Ga0164299_1081247913300012958SoilVHGWGERLGVLAFALALLAGLVGLSFAAGYIIGKLIL*
Ga0164302_1167435623300012961SoilVRQTWGERLAVFTFALFLLAAIVGISFAAGYIIGKLIL*
Ga0134077_1014910433300012972Grasslands SoilVVQQTWGERVAVFAFALALLAGIIGVTFAAGYIIGRLIL*
Ga0164309_1160621723300012984SoilVQSWKERLAVFAFALAFITAIVLGAFAAGYIIGKL
Ga0157374_1213492623300013296Miscanthus RhizosphereVRGWSDRLSVLGFAFALVLALVGLSFAVGYIIGKLIL*
Ga0120154_102183623300013501PermafrostVHTWGERLAIFAFALAVVAAIVVAAFAAGYIIGKLIL*
Ga0137403_1072786633300015264Vadose Zone SoilSWKERLAVFAFALAVITAIVVVAFAAGYIIGKLIL*
Ga0182005_111812723300015265RhizosphereVQQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLFL*
Ga0134089_1044562823300015358Grasslands SoilVRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLIL*
Ga0132258_1132949213300015371Arabidopsis RhizosphereVRQTWGDHLVVFAFALGLIAAIVGISSGAGYIIGRLIL*
Ga0132258_1243757643300015371Arabidopsis RhizosphereVRHTWGERVAVFVFAIALVAAIVGASFAAGYIIGRLIL*
Ga0132258_1396431623300015371Arabidopsis RhizosphereVRQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL*
Ga0132256_10255609823300015372Arabidopsis RhizosphereVQQTWGERLAVFAFALAILAGLVGATFAAGYIIGRLIL*
Ga0132257_10240810723300015373Arabidopsis RhizosphereVRQTWGERLAVFTFALFLLAAIVGISFAAGYIIGRLIL*
Ga0132257_10393456323300015373Arabidopsis RhizosphereNPAVQGWSERLAVLAFALALLAAFVGLSFAVGYIIGKLIL*
Ga0132257_10452674923300015373Arabidopsis RhizosphereVRQSWGDRLVVFAFALGVIAAIVGISFGAGYIIGRLIL*
Ga0184605_1011695833300018027Groundwater SedimentVRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLLL
Ga0184619_1033889623300018061Groundwater SedimentVHSWGERLAVLAFALALLGAIVGLFFTAGYIIGKLIL
Ga0184618_1013702833300018071Groundwater SedimentVRQTWGERLAVFAFALALIAGIVGVSFAAGYIIGRLIL
Ga0184635_1016302123300018072Groundwater SedimentVRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGKLIL
Ga0066655_1094845823300018431Grasslands SoilVQQTWGERLAVFVFALALLAGIIGVTFAAGYIIGRLIL
Ga0066662_1052546013300018468Grasslands SoilVRQTWGERLAVFTFALAVVAAIVAISFAAGYIIGKLI
Ga0066662_1115110523300018468Grasslands SoilVRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGRLIL
Ga0222622_1014398023300022756Groundwater SedimentVRQTWGDRLAVFAFGLCVVAAIVGISFAAGYIIGKLIL
Ga0247672_104611023300024187SoilMQQTWGQRLAVFAFAFAILAGVVGVTFAAGYIIGRLIL
Ga0137417_141034733300024330Vadose Zone SoilVQSWKERLAVFGFALGLITAIVVVAFAAGYIIGKLIL
Ga0207693_1147570823300025915Corn, Switchgrass And Miscanthus RhizosphereVQSWKERLAVFAFALAFITAIVLGAFAAGYIIGKLIL
Ga0207664_1082383933300025929Agricultural SoilVRPTWGDRLAVFAFALGVVAAIVGISFGAGYIIGRLIL
Ga0207670_1096833723300025936Switchgrass RhizosphereVRQTWGDRLAVFTFALFLLAAIVGISFAAGYIIGRLIL
Ga0207665_1050229633300025939Corn, Switchgrass And Miscanthus RhizosphereVQQTWGERLAVFAFALALLAGLVGAMFAAGYIIGRLIL
Ga0207658_1159520123300025986Switchgrass RhizosphereVRQTWGERLAVFVFALALLAGLVGVTFAAGYIIGRLIL
Ga0207708_1081035313300026075Corn, Switchgrass And Miscanthus RhizosphereVRQTWGDRLVVFAFALGLIAAIVGISFGAGYIIGRLIL
Ga0209761_114944113300026313Grasslands SoilVRQTWGERLAVFTFALAVVAAIVGISFAAGYIIGKLIL
Ga0209470_127839123300026324SoilVRQTWGQRLAVFAFALALLAGIVGVSFAAGYIIGRLIL
Ga0209690_110485213300026524SoilKVRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGRLIL
Ga0209474_1063211413300026550SoilVRQSWGDRIAVFAFALAVVAAIVGISFAAGYIIGKLIL
Ga0209811_1030547823300027821Surface SoilMHQTWGERLAVFAFAFLLLAGVVGVTFAAGYIIGRLIL
Ga0209701_1020815723300027862Vadose Zone SoilVRQSWGERLAVLAFALALVGAIVGVAFAAGYIIGKLIL
Ga0209465_1066937013300027874Tropical Forest SoilVRPTWGDRLAVFAFALGVVVAIVGISFGAGYIIGRLIL
Ga0209590_1000197243300027882Vadose Zone SoilVRQSWGERLAVFAFALAVVAAIVGVAFAAGYIIGKLIL
Ga0209590_1013293333300027882Vadose Zone SoilVRQTWGQRLAVFAFALALIAGIVGVSFAAGYIIGRLIL
Ga0209168_1001072933300027986Surface SoilMRTTWGERLAVFAFALAVVAAIVGAAFAAGYIIGRLIL
Ga0307318_1011008223300028744SoilVRQTWRDRLAVFAFGLCVVAAIVGISFAAGYIIGKLIL
Ga0307310_1075534913300028824SoilVHSWRERLAIFAFALAVVAAIVGGAFAAGYIIGKLIL
Ga0307312_1063850813300028828SoilVRQTWGQRLAVFAFALALIAGIVGVSFAAGYIIGR
Ga0307278_1025885523300028878SoilVQGWGDRLAVLGFALALLAAFVGLSFTVGYIIGKLIL
Ga0307304_1055491513300028885SoilVRQTWGERLAVFVFALALLAAIVGVSFAAGYIIGRLLL
Ga0318516_1081048923300031543SoilMHQTWGQRLAVFAFALAILAGVVGVTFAAGYIIGRLIL
Ga0307408_10153333923300031548RhizosphereVQTWGERLTVLAFALALLVAFVGLSFAAGYIIGRLIL
Ga0306925_1196101913300031890SoilVRHTWGERVAVFAFAIALVAAIVGASFAAGYIIGRLI
Ga0308175_10020620923300031938SoilVQQTWGERLAVFVFALAILAGLVGVTFAAGYIIGRLIL
Ga0308176_1232679523300031996SoilVRGWGDRLSVLGFALALIGAIVGLSFAAGYIIGKLIL
Ga0335084_1061830733300033004SoilMRTTWGERLSVFAFALLVVAAIVGAAFAAGYIIGRLIL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.