| Basic Information | |
|---|---|
| Family ID | F060665 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MYDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.77 % |
| % of genes near scaffold ends (potentially truncated) | 96.97 % |
| % of genes from short scaffolds (< 2000 bps) | 92.42 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.576 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF13248 | zf-ribbon_3 | 51.52 |
| PF00561 | Abhydrolase_1 | 8.33 |
| PF02604 | PhdYeFM_antitox | 6.06 |
| PF12910 | PHD_like | 2.27 |
| PF12697 | Abhydrolase_6 | 2.27 |
| PF01850 | PIN | 2.27 |
| PF00275 | EPSP_synthase | 1.52 |
| PF04024 | PspC | 1.52 |
| PF00903 | Glyoxalase | 0.76 |
| PF12681 | Glyoxalase_2 | 0.76 |
| PF00691 | OmpA | 0.76 |
| PF08544 | GHMP_kinases_C | 0.76 |
| PF00196 | GerE | 0.76 |
| PF16640 | Big_3_5 | 0.76 |
| PF13470 | PIN_3 | 0.76 |
| PF08323 | Glyco_transf_5 | 0.76 |
| PF00072 | Response_reg | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 6.06 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 6.06 |
| COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 0.76 |
| COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10263169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 550 | Open in IMG/M |
| 3300001174|JGI12679J13547_1011620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 555 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101748323 | Not Available | 522 | Open in IMG/M |
| 3300004091|Ga0062387_100034691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2270 | Open in IMG/M |
| 3300004091|Ga0062387_100055740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1921 | Open in IMG/M |
| 3300005338|Ga0068868_102207945 | Not Available | 524 | Open in IMG/M |
| 3300005436|Ga0070713_100717466 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005436|Ga0070713_101564611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 640 | Open in IMG/M |
| 3300005445|Ga0070708_100603184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1035 | Open in IMG/M |
| 3300005530|Ga0070679_101216418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 699 | Open in IMG/M |
| 3300005533|Ga0070734_10333371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 867 | Open in IMG/M |
| 3300005537|Ga0070730_10776387 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005559|Ga0066700_10659253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 723 | Open in IMG/M |
| 3300005560|Ga0066670_10183996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1246 | Open in IMG/M |
| 3300005598|Ga0066706_10618955 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005712|Ga0070764_10380868 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005764|Ga0066903_103080566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 902 | Open in IMG/M |
| 3300005921|Ga0070766_11243808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006050|Ga0075028_100375087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 808 | Open in IMG/M |
| 3300006102|Ga0075015_100843345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 553 | Open in IMG/M |
| 3300006854|Ga0075425_102131423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300009521|Ga0116222_1251954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300009623|Ga0116133_1017892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1753 | Open in IMG/M |
| 3300009624|Ga0116105_1192205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300009698|Ga0116216_10280408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300009698|Ga0116216_10525726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300009700|Ga0116217_10468229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300009760|Ga0116131_1064077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300010359|Ga0126376_12975907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010366|Ga0126379_11756027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300010366|Ga0126379_12243703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300010366|Ga0126379_13578865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300011120|Ga0150983_14571790 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300011271|Ga0137393_11074681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300012189|Ga0137388_11987657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300012207|Ga0137381_10532863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300012951|Ga0164300_10172144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300012957|Ga0164303_10128349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1306 | Open in IMG/M |
| 3300012984|Ga0164309_11969336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300013100|Ga0157373_10571131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 821 | Open in IMG/M |
| 3300013307|Ga0157372_10233850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2131 | Open in IMG/M |
| 3300014501|Ga0182024_10882570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1080 | Open in IMG/M |
| 3300015241|Ga0137418_10511018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300016705|Ga0181507_1034726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300017822|Ga0187802_10314627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300017940|Ga0187853_10547672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300017961|Ga0187778_11284283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300017970|Ga0187783_10312976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300017972|Ga0187781_11143966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300017975|Ga0187782_10656713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300017975|Ga0187782_10854923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300017995|Ga0187816_10357586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300018002|Ga0187868_1086782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1237 | Open in IMG/M |
| 3300018017|Ga0187872_10265827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300018033|Ga0187867_10000961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25232 | Open in IMG/M |
| 3300018038|Ga0187855_10812424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300018060|Ga0187765_10677109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300018085|Ga0187772_10453626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 899 | Open in IMG/M |
| 3300018086|Ga0187769_10413016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1015 | Open in IMG/M |
| 3300018088|Ga0187771_11293537 | Not Available | 619 | Open in IMG/M |
| 3300018090|Ga0187770_10144996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1806 | Open in IMG/M |
| 3300020579|Ga0210407_10865003 | Not Available | 695 | Open in IMG/M |
| 3300021170|Ga0210400_10052852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3165 | Open in IMG/M |
| 3300021180|Ga0210396_10220132 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300021180|Ga0210396_11269602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300021181|Ga0210388_10161926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1948 | Open in IMG/M |
| 3300021181|Ga0210388_10331556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1338 | Open in IMG/M |
| 3300021181|Ga0210388_11077411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300021402|Ga0210385_10028178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3619 | Open in IMG/M |
| 3300021402|Ga0210385_11559488 | Not Available | 504 | Open in IMG/M |
| 3300021407|Ga0210383_10858527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 775 | Open in IMG/M |
| 3300021407|Ga0210383_10958028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300021407|Ga0210383_11727426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300021474|Ga0210390_10155505 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300021477|Ga0210398_11231488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300021477|Ga0210398_11377571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300021478|Ga0210402_10806516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300021479|Ga0210410_11116867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300021560|Ga0126371_11994836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300022531|Ga0242660_1156653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300022557|Ga0212123_10328945 | Not Available | 1055 | Open in IMG/M |
| 3300023056|Ga0233357_1053675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300025898|Ga0207692_10637953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300025939|Ga0207665_10733279 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300025945|Ga0207679_11463672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300026467|Ga0257154_1042064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300026548|Ga0209161_10455744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300027168|Ga0208239_1020798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300027432|Ga0209421_1083951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300027516|Ga0207761_1037370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300027698|Ga0209446_1168559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300027737|Ga0209038_10274285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300027825|Ga0209039_10336572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
| 3300027867|Ga0209167_10829532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027874|Ga0209465_10642275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300027884|Ga0209275_10556876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300027895|Ga0209624_10000999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23637 | Open in IMG/M |
| 3300027895|Ga0209624_10948463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300027895|Ga0209624_11000197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300028016|Ga0265354_1008001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1029 | Open in IMG/M |
| 3300028017|Ga0265356_1007460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300028798|Ga0302222_10053104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1642 | Open in IMG/M |
| 3300028806|Ga0302221_10131295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1105 | Open in IMG/M |
| 3300028808|Ga0302228_10185548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 950 | Open in IMG/M |
| 3300030043|Ga0302306_10248742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300030507|Ga0302192_10456189 | Not Available | 519 | Open in IMG/M |
| 3300030707|Ga0310038_10287598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300031022|Ga0138301_1842468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300031231|Ga0170824_116269621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300031715|Ga0307476_10232990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1342 | Open in IMG/M |
| 3300031715|Ga0307476_10430567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300031715|Ga0307476_11093556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300031718|Ga0307474_10095239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2224 | Open in IMG/M |
| 3300031720|Ga0307469_10396755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1176 | Open in IMG/M |
| 3300031720|Ga0307469_11570624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300031753|Ga0307477_10882500 | Not Available | 591 | Open in IMG/M |
| 3300031823|Ga0307478_10601888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 919 | Open in IMG/M |
| 3300031962|Ga0307479_10214254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1898 | Open in IMG/M |
| 3300031962|Ga0307479_11868776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300032063|Ga0318504_10622285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300032261|Ga0306920_101223708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300032515|Ga0348332_12010560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 655 | Open in IMG/M |
| 3300032515|Ga0348332_12701543 | Not Available | 501 | Open in IMG/M |
| 3300032770|Ga0335085_10294987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 1924 | Open in IMG/M |
| 3300032828|Ga0335080_11094898 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300032892|Ga0335081_11903114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300032897|Ga0335071_10012603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8649 | Open in IMG/M |
| 3300033289|Ga0310914_10814303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300033545|Ga0316214_1050629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300034091|Ga0326724_0485814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.18% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.52% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.76% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.76% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102631692 | 3300000567 | Peatlands Soil | EMYDLLQKRDLAMKKYETVLAGNANTGSADQARRYIKEAYRE* |
| JGI12679J13547_10116202 | 3300001174 | Forest Soil | DLLQKRDLAMKKYQTVLAGNANTGPADEARRYIKEAYRE* |
| JGIcombinedJ26739_1017483232 | 3300002245 | Forest Soil | EMYDLLQKRDLAMKKYEIVLAENGSTAPAEQARKHIREAYRE* |
| Ga0062387_1000346911 | 3300004091 | Bog Forest Soil | YDLLQKRDLAMKKYQTVVAENGSTPRAEKAREHIREAYRE* |
| Ga0062387_1000557401 | 3300004091 | Bog Forest Soil | YDLLQKRDLAMKKYETVLAQNGSTPPAERARKHIRDAYRE* |
| Ga0068868_1022079452 | 3300005338 | Miscanthus Rhizosphere | AAGQMYDLMDKRELAMKSYQIVLTGNANTGPADLARRYIKEAYRE* |
| Ga0070713_1007174661 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MYDLLQKRDQAMKSYQAVLAGRTDSGQADLARRYIREAYRE* |
| Ga0070713_1015646111 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAGEMYDLLQKRDLAMKKYQTVLAGNGNTGPADQARHYIKEAYRE* |
| Ga0070708_1006031841 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYDLLQKRDRAMKKYEMVLAMNSNTPPAEQARKHLKEAYRE* |
| Ga0070679_1012164181 | 3300005530 | Corn Rhizosphere | NLAAGEMYDLMQKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE* |
| Ga0070734_103333711 | 3300005533 | Surface Soil | AAGEMYDLMQKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE* |
| Ga0070730_107763871 | 3300005537 | Surface Soil | MYDLLQKRDLAMKKYETVLAGNANTGPADQARRYIKEAYRE* |
| Ga0066700_106592531 | 3300005559 | Soil | DLLQKRELAMKKYQTVLAENSGTPLAEEARKHIKEAYRE* |
| Ga0066670_101839961 | 3300005560 | Soil | GEMYDLLQKRDLAMRKYEIVLAQNSSTPPAEQARKHIREAYRE* |
| Ga0066706_106189553 | 3300005598 | Soil | MYDLLQKRDLAMKAYEAVLTGRADSGQADQARRHMKEAYRE* |
| Ga0070764_103808683 | 3300005712 | Soil | GEMYDLLQKRDLAMKKYETVLAGNANTPPADQARRYIKEAYRE* |
| Ga0066903_1030805662 | 3300005764 | Tropical Forest Soil | QMYDLMQKRDLAMRAYAAVLTGRPDSGQADMARRYLKDAYRE* |
| Ga0070766_112438082 | 3300005921 | Soil | RDLAMKKYETVLAENGATPPAEKAREHLREAYRE* |
| Ga0075028_1003750871 | 3300006050 | Watersheds | YDLLQKRDLAMKKYETVLAGNANTGPADAARRYIKEAYRE* |
| Ga0075015_1008433451 | 3300006102 | Watersheds | AAGEMYDLLQKRDLAMKRYQTVLAGNANTGPADQARRYIREAYRE* |
| Ga0075425_1021314232 | 3300006854 | Populus Rhizosphere | KRDLAMKSYETVLEGRADSGQADLARRYIKEAYRE* |
| Ga0116222_12519541 | 3300009521 | Peatlands Soil | MYDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE* |
| Ga0116133_10178921 | 3300009623 | Peatland | MYDLMQKRDLALQKYQTVLAGNANTTPADLARRYLKEAYRE* |
| Ga0116105_11922052 | 3300009624 | Peatland | QKRDLAMKKYQTVLAENGSTPPAEKARAHIREAYRE* |
| Ga0116216_102804083 | 3300009698 | Peatlands Soil | LQKRDLAMKKYETVLAENGGTPFAEKARAHIREAHRE* |
| Ga0116216_105257263 | 3300009698 | Peatlands Soil | GEMYDLLQKRDLAMKRYQTVLAGNANTGPADQARRYIKEAYRE* |
| Ga0116217_104682292 | 3300009700 | Peatlands Soil | LLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE* |
| Ga0116131_10640773 | 3300009760 | Peatland | YDLLQKRDLAMKKYQTVLAENASTPPAEQARKHIKEAYRE* |
| Ga0126376_129759072 | 3300010359 | Tropical Forest Soil | MYDLMQKRDLAMRAYAAVLTGRPDSGQADMARRYLKDAYRE* |
| Ga0126379_117560272 | 3300010366 | Tropical Forest Soil | YDLMQKRELAMRAYEAVLTGRPDSGQADQARRYLKDAYRE* |
| Ga0126379_122437032 | 3300010366 | Tropical Forest Soil | LQKRDLAMKKYQTVLAENGTTPPADEARKHIREAYRE* |
| Ga0126379_135788651 | 3300010366 | Tropical Forest Soil | DLLQERDLAMKSYETLLAGNANTGQADQARRYIKEAYRE* |
| Ga0150983_145717901 | 3300011120 | Forest Soil | DMLQKRDLAMKKYQTVLAENAGTPPAEKAREYIREAYRE* |
| Ga0137393_110746813 | 3300011271 | Vadose Zone Soil | LMQKRDLAMKKYEIVLAQNGSTPPAELARKHIREAYRE* |
| Ga0137388_119876571 | 3300012189 | Vadose Zone Soil | MYDLLQKRDLAMKKYQIVLAENAATPPAEQARKHIREAYRE* |
| Ga0137381_105328631 | 3300012207 | Vadose Zone Soil | GQMYDLLDKRELAMKRYQTVLAGNANTTPADQARRYIKEAYRE* |
| Ga0164300_101721441 | 3300012951 | Soil | LLQKRDQAMKAYEAVLTGRADSGQADQARRHMKEAYRE* |
| Ga0164303_101283491 | 3300012957 | Soil | RDLAMKRYETVLAGNANTGPADQARRYIREAYRE* |
| Ga0164309_119693362 | 3300012984 | Soil | GEMYDLLQKRDLAMKAYEAVLTGRADSGQADLARRHMKEAYRE* |
| Ga0157373_105711311 | 3300013100 | Corn Rhizosphere | QKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE* |
| Ga0157372_102338501 | 3300013307 | Corn Rhizosphere | GEMYDLMQQRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE* |
| Ga0182024_108825701 | 3300014501 | Permafrost | QKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE* |
| Ga0137418_105110183 | 3300015241 | Vadose Zone Soil | GEMYDLLQKRDLAMKKYQSVLAENSSSPPAEQARKHIREAYRE* |
| Ga0181507_10347263 | 3300016705 | Peatland | NLAAGEMYDLLLRRDLAMKKYETVLAENASTAFAEKAREYIKEAYRE |
| Ga0187802_103146271 | 3300017822 | Freshwater Sediment | KRDLAMKAYQTVLAGNANTGPADQARRYIKEAYRE |
| Ga0187853_105476721 | 3300017940 | Peatland | QRDLAMKKYQTVLAENASTPPAEQARKHIKEAYRE |
| Ga0187778_112842831 | 3300017961 | Tropical Peatland | KANLAAGEVYDLLQKRDLAMKRYQTVLAGNANTGPADQARRYIREAYRE |
| Ga0187783_103129761 | 3300017970 | Tropical Peatland | MYDLMQKRDLAMKHYETVLAGNANTGPADQARRYIKEAYRE |
| Ga0187781_111439662 | 3300017972 | Tropical Peatland | LQKRDLAMKRYETVLAGNANTGPADLARRYIKEAYRE |
| Ga0187782_106567133 | 3300017975 | Tropical Peatland | QKRDLAMKRYETVLAGNANTGPADLARRYIKEAYRE |
| Ga0187782_108549232 | 3300017975 | Tropical Peatland | LAAGEMYDLLQKRDLAMKKYESVVAENASTPPAEKARQYMKEAYRE |
| Ga0187816_103575862 | 3300017995 | Freshwater Sediment | YDLLQKRDLAMKRYETVLAGNANTGSADQARRYIKEAYRE |
| Ga0187868_10867823 | 3300018002 | Peatland | QKRDLAMKHYQIVLAGNANTGPADQARRYIREAYRE |
| Ga0187872_102658271 | 3300018017 | Peatland | QKRDLAMKKYQTVLAENASTPPAEQARKHIKEAYRE |
| Ga0187867_100009611 | 3300018033 | Peatland | MYDLLQKRDLAMKKYETVLAENAGTPPAEQARKHIKEAYRE |
| Ga0187855_108124242 | 3300018038 | Peatland | EMYDLLQNRDLAMKKYQIVLAENGSTPFAEKARAHIREAYRE |
| Ga0187765_106771093 | 3300018060 | Tropical Peatland | AAGEMYDLLQKRDMAMKAYEAVLTGRADSGQADQARRYIKAAYRE |
| Ga0187772_104536261 | 3300018085 | Tropical Peatland | AGEMYDLLQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE |
| Ga0187769_104130161 | 3300018086 | Tropical Peatland | ANLAAGEMYDLLQKRDLAMKHYQTVLAGNANTGPADKARQYIKEAYRE |
| Ga0187771_112935371 | 3300018088 | Tropical Peatland | GEMYDLLQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE |
| Ga0187770_101449964 | 3300018090 | Tropical Peatland | YDLLQKRDLAMKHYQTVLAGNANPGPADKARQYIKEAYRE |
| Ga0210407_108650032 | 3300020579 | Soil | LLQKRDLAMKKYQTVLAGNANTGPADQARRYIREAYRE |
| Ga0210400_100528526 | 3300021170 | Soil | APGEMYDLLDKRDLAMKKYQTVLAGNANTTPADQARRYIKEAYRE |
| Ga0210396_102201325 | 3300021180 | Soil | AAGEMYDLLDKRDLAMKKYQTVLAGNANTGPADQARRYIKDAYRE |
| Ga0210396_112696022 | 3300021180 | Soil | YDLLDKRDLAMKKYQTVLAGNANTTPADQARRYIKEAYRE |
| Ga0210388_101619261 | 3300021181 | Soil | GEMYDLLQKRDLAMKKYQSVLAENASTPPADQARKHIREAYRE |
| Ga0210388_103315563 | 3300021181 | Soil | LQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE |
| Ga0210388_110774111 | 3300021181 | Soil | AAGEMYDLLQKRDLAMKSYQTVLAGNANTGPADLARRYIREAYKE |
| Ga0210385_100281781 | 3300021402 | Soil | ANLAAGEMYDLMQKRDLAMKSYQMVLAGNANTGPADQARRYIREAYRE |
| Ga0210385_115594881 | 3300021402 | Soil | QQRELAVKKYQTVLAESNSTPLAEQARRHIKQAYRE |
| Ga0210383_108585271 | 3300021407 | Soil | EMYDLLQKRDLAMKKYETVLAENSSTPRAEKAREHIREAYRE |
| Ga0210383_109580282 | 3300021407 | Soil | MYDLLQRRDLAMKKYETVLAENASTPPAEKAREHIKEAYRE |
| Ga0210383_117274261 | 3300021407 | Soil | GEMYDMLQQRDLAMKKYQTVLAENAATAPAEKARSHIKDAYRE |
| Ga0210390_101555054 | 3300021474 | Soil | QKRDLAMKKYETVLAENSSTPRAEKAREHIREAYRE |
| Ga0210390_116094782 | 3300021474 | Soil | MYDLLQKRDLAVKKYEIVLAENAGTAPAEMARKHIREAYRE |
| Ga0210398_112314881 | 3300021477 | Soil | KRDLAMKKYQSVVAENAGTPPAEQARKHLREAYRE |
| Ga0210398_113775712 | 3300021477 | Soil | NLAAGEMYDLLQKRDLAMKKYETVLAGNANTTPADQARRYIKEAYRE |
| Ga0210402_108065161 | 3300021478 | Soil | EMYDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE |
| Ga0210410_111168671 | 3300021479 | Soil | ANLAAGEMYDLLDKRDLAMKKYQTVLAGNANTTPADQARRYIKEAYRE |
| Ga0126371_119948362 | 3300021560 | Tropical Forest Soil | AGEMYDLLQKRDLAMKAYHTVLAGNANTGPADLARRYIKEAYRE |
| Ga0242660_11566532 | 3300022531 | Soil | EMYDLLQKRDLAMKKYQTVLAENGSTPPAEQARRHIREAYRE |
| Ga0212123_103289452 | 3300022557 | Iron-Sulfur Acid Spring | YDLLKKRDLAMQKYQTVLAGNANTGPADQARRYIKEAYRE |
| Ga0233357_10536751 | 3300023056 | Soil | AGQMYDLLQKRDLAMQKYQIVLAGNANTGPADQARRYIKEAYRE |
| Ga0207692_106379532 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MYDLLQKRDLAMKSYETVLEGRADSGQADQARRYIKEAYRE |
| Ga0207665_107332791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QKRDLAMKAYEAVLTGRADSGQADLARRHMKEAYRE |
| Ga0207679_114636721 | 3300025945 | Corn Rhizosphere | QKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE |
| Ga0257154_10420641 | 3300026467 | Soil | QQRELAVKKYQTVLAESDSTPLAERARKHIKQAYRE |
| Ga0209161_104557443 | 3300026548 | Soil | MYDLLQKRDLAMKAYEAVLTGRADSGQADQARRHMKEAYRE |
| Ga0208239_10207981 | 3300027168 | Forest Soil | QKRDMALQKYQTVLAGNANTTPADLARRYLKEAYRE |
| Ga0208983_10600361 | 3300027381 | Forest Soil | DLMQKRDLALMKYRTVLAQNSSTPPAEAARKHMREAYRE |
| Ga0209421_10839511 | 3300027432 | Forest Soil | QKRDLAMKKYETVLAGNANSGPADQARHYIKEAYRE |
| Ga0207761_10373701 | 3300027516 | Tropical Forest Soil | AAGEVYDLQQKRELAMKAYEAVLTGRADSGQADQARRYLKEAYRE |
| Ga0209446_11685593 | 3300027698 | Bog Forest Soil | KRDLAMKSYETVLAGNANTGPADLARRYIREAYKE |
| Ga0209038_102742851 | 3300027737 | Bog Forest Soil | AGEMYDLLQKRDLAMKKYQTVVAENGSTPRAEKAREHIREAYRE |
| Ga0209039_103365721 | 3300027825 | Bog Forest Soil | NLAAGEMYDLLQKRDLAMKKYQTVLAENSATPRAEKAREHIREAYRE |
| Ga0209167_108295321 | 3300027867 | Surface Soil | AAGEMYDLMQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE |
| Ga0209465_106422752 | 3300027874 | Tropical Forest Soil | KRDLAMKAYEAVLTGRADSGQADQARRYIREAYRE |
| Ga0209275_105568761 | 3300027884 | Soil | GEMYDLLQKRDLAVKKYEIVLAENAGTAPAEMARKHIREAYRE |
| Ga0209624_100009991 | 3300027895 | Forest Soil | DLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE |
| Ga0209624_109484631 | 3300027895 | Forest Soil | EMYDLMQKRDLAMKKYQSVLAENASSPPAEKARQYIREAYRE |
| Ga0209624_110001971 | 3300027895 | Forest Soil | EMYDILQQRELAVKKYQTVLAESDSTPLAEQARKHIKQAYRE |
| Ga0265354_10080014 | 3300028016 | Rhizosphere | DLLQKRELAMKKYQSVLAENASTPPAEKAREYIREAYRE |
| Ga0265356_10074604 | 3300028017 | Rhizosphere | AGEMYDLLQKRDLAMKKYQSVLAENASTPPAEKARQYIREAYRE |
| Ga0302222_100531043 | 3300028798 | Palsa | KRDLAMEKYETVLAENGSTAPAEQARKHIREAYRE |
| Ga0302221_101312953 | 3300028806 | Palsa | DLLQKRDLAMQKYQTVLAGNANTTPADQARRYIKEAYRE |
| Ga0302228_101855483 | 3300028808 | Palsa | MYDLLQKRDLAMQKYQTVLAGNANTTPADQARRYIKEAYRE |
| Ga0302306_102487421 | 3300030043 | Palsa | EMYDLLQKRDLAMQKYQTVLAGNANTTPADQARRYIKEAYRE |
| Ga0302192_104561891 | 3300030507 | Bog | LQKRELAMKKYQTVLAENASTPPAEKARQYIREAYRE |
| Ga0310038_102875981 | 3300030707 | Peatlands Soil | LLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE |
| Ga0138301_18424682 | 3300031022 | Soil | LLQKRELAMKKYQTVLAENGSTPPAEQARKHIREAYRE |
| Ga0170824_1162696211 | 3300031231 | Forest Soil | DLLDKRDLAMKRYETVLAGNANTTPADLARRYIKDAYRE |
| Ga0307476_102329901 | 3300031715 | Hardwood Forest Soil | AGEMYDLLQKRDLAMKKYQIVLAENGSTPPAEQARKHIREAYRE |
| Ga0307476_104305671 | 3300031715 | Hardwood Forest Soil | LAAGEMYDLLQKRDLAMKKYQIVLAENASTPPAEQARKHIREAYRE |
| Ga0307476_110935562 | 3300031715 | Hardwood Forest Soil | DLMQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE |
| Ga0307474_100952391 | 3300031718 | Hardwood Forest Soil | LAAGEMYDLLQKRDLAMKKYQIVLAENGSTPPAEQARKHIREAYRE |
| Ga0307469_103967553 | 3300031720 | Hardwood Forest Soil | LAAGEMYDLMQKRDLAMKKYQTVLAENGSTPPAERARQHIREAYRE |
| Ga0307469_115706241 | 3300031720 | Hardwood Forest Soil | MYDLLQKRDLAMKAYEAVLTGRADSGQADLARRHMKEAYRE |
| Ga0307477_108825002 | 3300031753 | Hardwood Forest Soil | KRDLAMKKYQTVLAQNGSTPPAEEARRHLKDAYRE |
| Ga0307478_106018881 | 3300031823 | Hardwood Forest Soil | KRDLAMKKYQIVLAENGSTPCAEEARKHIRDAYRE |
| Ga0307479_102142541 | 3300031962 | Hardwood Forest Soil | LAAGEMYDLLQKRDLAMKKYQTVLAENGSTPPAERARKHIREAYRE |
| Ga0307479_118687761 | 3300031962 | Hardwood Forest Soil | EMYDLLQKRDLAMKKYQIVLAQNGSTPPAEQARKHIREAYRE |
| Ga0318504_106222852 | 3300032063 | Soil | MYDLMQKRELAMRAYEAVLTGRPDSGQADQARRYLKDAYRE |
| Ga0306920_1012237081 | 3300032261 | Soil | EVYDLQQKRDLAMKAYEAVLTGRADSGQADQARRYLKDAYRE |
| Ga0348332_120105601 | 3300032515 | Plant Litter | LQKRDLAMKKYQTVLAENASTPPAEKAREHIREAYRE |
| Ga0348332_127015431 | 3300032515 | Plant Litter | EMYDLLQKRDLAMKKYQTVLAGNASTGPADQARRYIKEAYRE |
| Ga0335085_102949874 | 3300032770 | Soil | ANLAAGEVYDLLQKRDLAMKSYETVLEGRADSGQADLARRYIKEAYRE |
| Ga0335080_110948983 | 3300032828 | Soil | NLAAGEMYDLLQKRDLAMKKYETVLAGNANTGPADQARRYIREAYRE |
| Ga0335081_119031141 | 3300032892 | Soil | MQKRDQAMKSYQTVLAGRPDTGPADLARRYIKDAYRE |
| Ga0335071_1001260310 | 3300032897 | Soil | QKRDLAMKSYETVLEGRADSGQADLARRYIKEAYRE |
| Ga0310914_108143032 | 3300033289 | Soil | NLAAGEMYDLLQKRDMAMKAYEAVLTGRADSGQADQARRYIKEAYRE |
| Ga0316214_10506293 | 3300033545 | Roots | LYDLMQKRDLAMKSYQMVLAGNANTGPADQARRYIREAYRE |
| Ga0326724_0485814_506_631 | 3300034091 | Peat Soil | MYDLMQKRDLAMKKYEIVVAQNANTGPADQARRYIKEAFRE |
| ⦗Top⦘ |