NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060665

Metagenome / Metatranscriptome Family F060665

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060665
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 41 residues
Representative Sequence MYDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE
Number of Associated Samples 111
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.77 %
% of genes near scaffold ends (potentially truncated) 96.97 %
% of genes from short scaffolds (< 2000 bps) 92.42 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(32.576 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(61.364 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.72%    β-sheet: 0.00%    Coil/Unstructured: 49.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF13248zf-ribbon_3 51.52
PF00561Abhydrolase_1 8.33
PF02604PhdYeFM_antitox 6.06
PF12910PHD_like 2.27
PF12697Abhydrolase_6 2.27
PF01850PIN 2.27
PF00275EPSP_synthase 1.52
PF04024PspC 1.52
PF00903Glyoxalase 0.76
PF12681Glyoxalase_2 0.76
PF00691OmpA 0.76
PF08544GHMP_kinases_C 0.76
PF00196GerE 0.76
PF16640Big_3_5 0.76
PF13470PIN_3 0.76
PF08323Glyco_transf_5 0.76
PF00072Response_reg 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 6.06
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 6.06
COG0297Glycogen synthaseCarbohydrate transport and metabolism [G] 0.76
COG0438Glycosyltransferase involved in cell wall bisynthesisCell wall/membrane/envelope biogenesis [M] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.67 %
UnclassifiedrootN/A8.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10263169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes550Open in IMG/M
3300001174|JGI12679J13547_1011620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis555Open in IMG/M
3300002245|JGIcombinedJ26739_101748323Not Available522Open in IMG/M
3300004091|Ga0062387_100034691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2270Open in IMG/M
3300004091|Ga0062387_100055740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1921Open in IMG/M
3300005338|Ga0068868_102207945Not Available524Open in IMG/M
3300005436|Ga0070713_100717466All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300005436|Ga0070713_101564611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter640Open in IMG/M
3300005445|Ga0070708_100603184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1035Open in IMG/M
3300005530|Ga0070679_101216418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter699Open in IMG/M
3300005533|Ga0070734_10333371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter867Open in IMG/M
3300005537|Ga0070730_10776387All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005559|Ga0066700_10659253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter723Open in IMG/M
3300005560|Ga0066670_10183996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1246Open in IMG/M
3300005598|Ga0066706_10618955All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005712|Ga0070764_10380868All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005764|Ga0066903_103080566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae902Open in IMG/M
3300005921|Ga0070766_11243808All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300006050|Ga0075028_100375087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae808Open in IMG/M
3300006102|Ga0075015_100843345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae553Open in IMG/M
3300006854|Ga0075425_102131423All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300009521|Ga0116222_1251954All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300009623|Ga0116133_1017892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1753Open in IMG/M
3300009624|Ga0116105_1192205All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300009698|Ga0116216_10280408All Organisms → cellular organisms → Bacteria → Acidobacteria1017Open in IMG/M
3300009698|Ga0116216_10525726All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300009700|Ga0116217_10468229All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300009760|Ga0116131_1064077All Organisms → cellular organisms → Bacteria → Acidobacteria1154Open in IMG/M
3300010359|Ga0126376_12975907All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300010366|Ga0126379_11756027All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300010366|Ga0126379_12243703All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300010366|Ga0126379_13578865All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300011120|Ga0150983_14571790All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300011271|Ga0137393_11074681All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300012189|Ga0137388_11987657All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300012207|Ga0137381_10532863All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300012951|Ga0164300_10172144All Organisms → cellular organisms → Bacteria → Acidobacteria1035Open in IMG/M
3300012957|Ga0164303_10128349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1306Open in IMG/M
3300012984|Ga0164309_11969336All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300013100|Ga0157373_10571131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae821Open in IMG/M
3300013307|Ga0157372_10233850All Organisms → cellular organisms → Bacteria → Acidobacteria2131Open in IMG/M
3300014501|Ga0182024_10882570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1080Open in IMG/M
3300015241|Ga0137418_10511018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium959Open in IMG/M
3300016705|Ga0181507_1034726All Organisms → cellular organisms → Bacteria → Acidobacteria1007Open in IMG/M
3300017822|Ga0187802_10314627All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300017940|Ga0187853_10547672All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300017961|Ga0187778_11284283All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300017970|Ga0187783_10312976All Organisms → cellular organisms → Bacteria → Acidobacteria1145Open in IMG/M
3300017972|Ga0187781_11143966All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300017975|Ga0187782_10656713All Organisms → cellular organisms → Bacteria → Acidobacteria807Open in IMG/M
3300017975|Ga0187782_10854923All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300017995|Ga0187816_10357586All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300018002|Ga0187868_1086782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae1237Open in IMG/M
3300018017|Ga0187872_10265827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae762Open in IMG/M
3300018033|Ga0187867_10000961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae25232Open in IMG/M
3300018038|Ga0187855_10812424All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300018060|Ga0187765_10677109All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300018085|Ga0187772_10453626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis899Open in IMG/M
3300018086|Ga0187769_10413016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1015Open in IMG/M
3300018088|Ga0187771_11293537Not Available619Open in IMG/M
3300018090|Ga0187770_10144996All Organisms → cellular organisms → Bacteria → Acidobacteria1806Open in IMG/M
3300020579|Ga0210407_10865003Not Available695Open in IMG/M
3300021170|Ga0210400_10052852All Organisms → cellular organisms → Bacteria → Acidobacteria3165Open in IMG/M
3300021180|Ga0210396_10220132All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300021180|Ga0210396_11269602All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300021181|Ga0210388_10161926All Organisms → cellular organisms → Bacteria → Acidobacteria1948Open in IMG/M
3300021181|Ga0210388_10331556All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1338Open in IMG/M
3300021181|Ga0210388_11077411All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300021402|Ga0210385_10028178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3619Open in IMG/M
3300021402|Ga0210385_11559488Not Available504Open in IMG/M
3300021407|Ga0210383_10858527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis775Open in IMG/M
3300021407|Ga0210383_10958028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300021407|Ga0210383_11727426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300021474|Ga0210390_10155505All Organisms → cellular organisms → Bacteria1927Open in IMG/M
3300021477|Ga0210398_11231488All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300021477|Ga0210398_11377571All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300021478|Ga0210402_10806516All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300021479|Ga0210410_11116867All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300021560|Ga0126371_11994836All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300022531|Ga0242660_1156653All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300022557|Ga0212123_10328945Not Available1055Open in IMG/M
3300023056|Ga0233357_1053675All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300025898|Ga0207692_10637953All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300025939|Ga0207665_10733279All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300025945|Ga0207679_11463672All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300026467|Ga0257154_1042064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300026548|Ga0209161_10455744All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300027168|Ga0208239_1020798All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300027432|Ga0209421_1083951All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300027516|Ga0207761_1037370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium952Open in IMG/M
3300027698|Ga0209446_1168559All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300027737|Ga0209038_10274285All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300027825|Ga0209039_10336572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae589Open in IMG/M
3300027867|Ga0209167_10829532All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300027874|Ga0209465_10642275All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300027884|Ga0209275_10556876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300027895|Ga0209624_10000999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae23637Open in IMG/M
3300027895|Ga0209624_10948463All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300027895|Ga0209624_11000197All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300028016|Ga0265354_1008001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1029Open in IMG/M
3300028017|Ga0265356_1007460All Organisms → cellular organisms → Bacteria → Acidobacteria1261Open in IMG/M
3300028798|Ga0302222_10053104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1642Open in IMG/M
3300028806|Ga0302221_10131295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1105Open in IMG/M
3300028808|Ga0302228_10185548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae950Open in IMG/M
3300030043|Ga0302306_10248742All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300030507|Ga0302192_10456189Not Available519Open in IMG/M
3300030707|Ga0310038_10287598All Organisms → cellular organisms → Bacteria → Acidobacteria746Open in IMG/M
3300031022|Ga0138301_1842468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300031231|Ga0170824_116269621All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300031715|Ga0307476_10232990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1342Open in IMG/M
3300031715|Ga0307476_10430567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium975Open in IMG/M
3300031715|Ga0307476_11093556All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300031718|Ga0307474_10095239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2224Open in IMG/M
3300031720|Ga0307469_10396755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1176Open in IMG/M
3300031720|Ga0307469_11570624All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300031753|Ga0307477_10882500Not Available591Open in IMG/M
3300031823|Ga0307478_10601888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis919Open in IMG/M
3300031962|Ga0307479_10214254All Organisms → cellular organisms → Bacteria → Acidobacteria1898Open in IMG/M
3300031962|Ga0307479_11868776All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300032063|Ga0318504_10622285All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300032261|Ga0306920_101223708All Organisms → cellular organisms → Bacteria → Acidobacteria1084Open in IMG/M
3300032515|Ga0348332_12010560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella655Open in IMG/M
3300032515|Ga0348332_12701543Not Available501Open in IMG/M
3300032770|Ga0335085_10294987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense1924Open in IMG/M
3300032828|Ga0335080_11094898All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300032892|Ga0335081_11903114All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300032897|Ga0335071_10012603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8649Open in IMG/M
3300033289|Ga0310914_10814303All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300033545|Ga0316214_1050629All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300034091|Ga0326724_0485814All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.18%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.58%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.55%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.55%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.03%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.27%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.52%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.52%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.76%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033545Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4Host-AssociatedOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1026316923300000567Peatlands SoilEMYDLLQKRDLAMKKYETVLAGNANTGSADQARRYIKEAYRE*
JGI12679J13547_101162023300001174Forest SoilDLLQKRDLAMKKYQTVLAGNANTGPADEARRYIKEAYRE*
JGIcombinedJ26739_10174832323300002245Forest SoilEMYDLLQKRDLAMKKYEIVLAENGSTAPAEQARKHIREAYRE*
Ga0062387_10003469113300004091Bog Forest SoilYDLLQKRDLAMKKYQTVVAENGSTPRAEKAREHIREAYRE*
Ga0062387_10005574013300004091Bog Forest SoilYDLLQKRDLAMKKYETVLAQNGSTPPAERARKHIRDAYRE*
Ga0068868_10220794523300005338Miscanthus RhizosphereAAGQMYDLMDKRELAMKSYQIVLTGNANTGPADLARRYIKEAYRE*
Ga0070713_10071746613300005436Corn, Switchgrass And Miscanthus RhizosphereMYDLLQKRDQAMKSYQAVLAGRTDSGQADLARRYIREAYRE*
Ga0070713_10156461113300005436Corn, Switchgrass And Miscanthus RhizosphereLAAGEMYDLLQKRDLAMKKYQTVLAGNGNTGPADQARHYIKEAYRE*
Ga0070708_10060318413300005445Corn, Switchgrass And Miscanthus RhizosphereMYDLLQKRDRAMKKYEMVLAMNSNTPPAEQARKHLKEAYRE*
Ga0070679_10121641813300005530Corn RhizosphereNLAAGEMYDLMQKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE*
Ga0070734_1033337113300005533Surface SoilAAGEMYDLMQKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE*
Ga0070730_1077638713300005537Surface SoilMYDLLQKRDLAMKKYETVLAGNANTGPADQARRYIKEAYRE*
Ga0066700_1065925313300005559SoilDLLQKRELAMKKYQTVLAENSGTPLAEEARKHIKEAYRE*
Ga0066670_1018399613300005560SoilGEMYDLLQKRDLAMRKYEIVLAQNSSTPPAEQARKHIREAYRE*
Ga0066706_1061895533300005598SoilMYDLLQKRDLAMKAYEAVLTGRADSGQADQARRHMKEAYRE*
Ga0070764_1038086833300005712SoilGEMYDLLQKRDLAMKKYETVLAGNANTPPADQARRYIKEAYRE*
Ga0066903_10308056623300005764Tropical Forest SoilQMYDLMQKRDLAMRAYAAVLTGRPDSGQADMARRYLKDAYRE*
Ga0070766_1124380823300005921SoilRDLAMKKYETVLAENGATPPAEKAREHLREAYRE*
Ga0075028_10037508713300006050WatershedsYDLLQKRDLAMKKYETVLAGNANTGPADAARRYIKEAYRE*
Ga0075015_10084334513300006102WatershedsAAGEMYDLLQKRDLAMKRYQTVLAGNANTGPADQARRYIREAYRE*
Ga0075425_10213142323300006854Populus RhizosphereKRDLAMKSYETVLEGRADSGQADLARRYIKEAYRE*
Ga0116222_125195413300009521Peatlands SoilMYDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE*
Ga0116133_101789213300009623PeatlandMYDLMQKRDLALQKYQTVLAGNANTTPADLARRYLKEAYRE*
Ga0116105_119220523300009624PeatlandQKRDLAMKKYQTVLAENGSTPPAEKARAHIREAYRE*
Ga0116216_1028040833300009698Peatlands SoilLQKRDLAMKKYETVLAENGGTPFAEKARAHIREAHRE*
Ga0116216_1052572633300009698Peatlands SoilGEMYDLLQKRDLAMKRYQTVLAGNANTGPADQARRYIKEAYRE*
Ga0116217_1046822923300009700Peatlands SoilLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE*
Ga0116131_106407733300009760PeatlandYDLLQKRDLAMKKYQTVLAENASTPPAEQARKHIKEAYRE*
Ga0126376_1297590723300010359Tropical Forest SoilMYDLMQKRDLAMRAYAAVLTGRPDSGQADMARRYLKDAYRE*
Ga0126379_1175602723300010366Tropical Forest SoilYDLMQKRELAMRAYEAVLTGRPDSGQADQARRYLKDAYRE*
Ga0126379_1224370323300010366Tropical Forest SoilLQKRDLAMKKYQTVLAENGTTPPADEARKHIREAYRE*
Ga0126379_1357886513300010366Tropical Forest SoilDLLQERDLAMKSYETLLAGNANTGQADQARRYIKEAYRE*
Ga0150983_1457179013300011120Forest SoilDMLQKRDLAMKKYQTVLAENAGTPPAEKAREYIREAYRE*
Ga0137393_1107468133300011271Vadose Zone SoilLMQKRDLAMKKYEIVLAQNGSTPPAELARKHIREAYRE*
Ga0137388_1198765713300012189Vadose Zone SoilMYDLLQKRDLAMKKYQIVLAENAATPPAEQARKHIREAYRE*
Ga0137381_1053286313300012207Vadose Zone SoilGQMYDLLDKRELAMKRYQTVLAGNANTTPADQARRYIKEAYRE*
Ga0164300_1017214413300012951SoilLLQKRDQAMKAYEAVLTGRADSGQADQARRHMKEAYRE*
Ga0164303_1012834913300012957SoilRDLAMKRYETVLAGNANTGPADQARRYIREAYRE*
Ga0164309_1196933623300012984SoilGEMYDLLQKRDLAMKAYEAVLTGRADSGQADLARRHMKEAYRE*
Ga0157373_1057113113300013100Corn RhizosphereQKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE*
Ga0157372_1023385013300013307Corn RhizosphereGEMYDLMQQRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE*
Ga0182024_1088257013300014501PermafrostQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE*
Ga0137418_1051101833300015241Vadose Zone SoilGEMYDLLQKRDLAMKKYQSVLAENSSSPPAEQARKHIREAYRE*
Ga0181507_103472633300016705PeatlandNLAAGEMYDLLLRRDLAMKKYETVLAENASTAFAEKAREYIKEAYRE
Ga0187802_1031462713300017822Freshwater SedimentKRDLAMKAYQTVLAGNANTGPADQARRYIKEAYRE
Ga0187853_1054767213300017940PeatlandQRDLAMKKYQTVLAENASTPPAEQARKHIKEAYRE
Ga0187778_1128428313300017961Tropical PeatlandKANLAAGEVYDLLQKRDLAMKRYQTVLAGNANTGPADQARRYIREAYRE
Ga0187783_1031297613300017970Tropical PeatlandMYDLMQKRDLAMKHYETVLAGNANTGPADQARRYIKEAYRE
Ga0187781_1114396623300017972Tropical PeatlandLQKRDLAMKRYETVLAGNANTGPADLARRYIKEAYRE
Ga0187782_1065671333300017975Tropical PeatlandQKRDLAMKRYETVLAGNANTGPADLARRYIKEAYRE
Ga0187782_1085492323300017975Tropical PeatlandLAAGEMYDLLQKRDLAMKKYESVVAENASTPPAEKARQYMKEAYRE
Ga0187816_1035758623300017995Freshwater SedimentYDLLQKRDLAMKRYETVLAGNANTGSADQARRYIKEAYRE
Ga0187868_108678233300018002PeatlandQKRDLAMKHYQIVLAGNANTGPADQARRYIREAYRE
Ga0187872_1026582713300018017PeatlandQKRDLAMKKYQTVLAENASTPPAEQARKHIKEAYRE
Ga0187867_1000096113300018033PeatlandMYDLLQKRDLAMKKYETVLAENAGTPPAEQARKHIKEAYRE
Ga0187855_1081242423300018038PeatlandEMYDLLQNRDLAMKKYQIVLAENGSTPFAEKARAHIREAYRE
Ga0187765_1067710933300018060Tropical PeatlandAAGEMYDLLQKRDMAMKAYEAVLTGRADSGQADQARRYIKAAYRE
Ga0187772_1045362613300018085Tropical PeatlandAGEMYDLLQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE
Ga0187769_1041301613300018086Tropical PeatlandANLAAGEMYDLLQKRDLAMKHYQTVLAGNANTGPADKARQYIKEAYRE
Ga0187771_1129353713300018088Tropical PeatlandGEMYDLLQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE
Ga0187770_1014499643300018090Tropical PeatlandYDLLQKRDLAMKHYQTVLAGNANPGPADKARQYIKEAYRE
Ga0210407_1086500323300020579SoilLLQKRDLAMKKYQTVLAGNANTGPADQARRYIREAYRE
Ga0210400_1005285263300021170SoilAPGEMYDLLDKRDLAMKKYQTVLAGNANTTPADQARRYIKEAYRE
Ga0210396_1022013253300021180SoilAAGEMYDLLDKRDLAMKKYQTVLAGNANTGPADQARRYIKDAYRE
Ga0210396_1126960223300021180SoilYDLLDKRDLAMKKYQTVLAGNANTTPADQARRYIKEAYRE
Ga0210388_1016192613300021181SoilGEMYDLLQKRDLAMKKYQSVLAENASTPPADQARKHIREAYRE
Ga0210388_1033155633300021181SoilLQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE
Ga0210388_1107741113300021181SoilAAGEMYDLLQKRDLAMKSYQTVLAGNANTGPADLARRYIREAYKE
Ga0210385_1002817813300021402SoilANLAAGEMYDLMQKRDLAMKSYQMVLAGNANTGPADQARRYIREAYRE
Ga0210385_1155948813300021402SoilQQRELAVKKYQTVLAESNSTPLAEQARRHIKQAYRE
Ga0210383_1085852713300021407SoilEMYDLLQKRDLAMKKYETVLAENSSTPRAEKAREHIREAYRE
Ga0210383_1095802823300021407SoilMYDLLQRRDLAMKKYETVLAENASTPPAEKAREHIKEAYRE
Ga0210383_1172742613300021407SoilGEMYDMLQQRDLAMKKYQTVLAENAATAPAEKARSHIKDAYRE
Ga0210390_1015550543300021474SoilQKRDLAMKKYETVLAENSSTPRAEKAREHIREAYRE
Ga0210390_1160947823300021474SoilMYDLLQKRDLAVKKYEIVLAENAGTAPAEMARKHIREAYRE
Ga0210398_1123148813300021477SoilKRDLAMKKYQSVVAENAGTPPAEQARKHLREAYRE
Ga0210398_1137757123300021477SoilNLAAGEMYDLLQKRDLAMKKYETVLAGNANTTPADQARRYIKEAYRE
Ga0210402_1080651613300021478SoilEMYDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE
Ga0210410_1111686713300021479SoilANLAAGEMYDLLDKRDLAMKKYQTVLAGNANTTPADQARRYIKEAYRE
Ga0126371_1199483623300021560Tropical Forest SoilAGEMYDLLQKRDLAMKAYHTVLAGNANTGPADLARRYIKEAYRE
Ga0242660_115665323300022531SoilEMYDLLQKRDLAMKKYQTVLAENGSTPPAEQARRHIREAYRE
Ga0212123_1032894523300022557Iron-Sulfur Acid SpringYDLLKKRDLAMQKYQTVLAGNANTGPADQARRYIKEAYRE
Ga0233357_105367513300023056SoilAGQMYDLLQKRDLAMQKYQIVLAGNANTGPADQARRYIKEAYRE
Ga0207692_1063795323300025898Corn, Switchgrass And Miscanthus RhizosphereMYDLLQKRDLAMKSYETVLEGRADSGQADQARRYIKEAYRE
Ga0207665_1073327913300025939Corn, Switchgrass And Miscanthus RhizosphereQKRDLAMKAYEAVLTGRADSGQADLARRHMKEAYRE
Ga0207679_1146367213300025945Corn RhizosphereQKRDLAMKRYETVLAGNANTGPADQARRYIREAYRE
Ga0257154_104206413300026467SoilQQRELAVKKYQTVLAESDSTPLAERARKHIKQAYRE
Ga0209161_1045574433300026548SoilMYDLLQKRDLAMKAYEAVLTGRADSGQADQARRHMKEAYRE
Ga0208239_102079813300027168Forest SoilQKRDMALQKYQTVLAGNANTTPADLARRYLKEAYRE
Ga0208983_106003613300027381Forest SoilDLMQKRDLALMKYRTVLAQNSSTPPAEAARKHMREAYRE
Ga0209421_108395113300027432Forest SoilQKRDLAMKKYETVLAGNANSGPADQARHYIKEAYRE
Ga0207761_103737013300027516Tropical Forest SoilAAGEVYDLQQKRELAMKAYEAVLTGRADSGQADQARRYLKEAYRE
Ga0209446_116855933300027698Bog Forest SoilKRDLAMKSYETVLAGNANTGPADLARRYIREAYKE
Ga0209038_1027428513300027737Bog Forest SoilAGEMYDLLQKRDLAMKKYQTVVAENGSTPRAEKAREHIREAYRE
Ga0209039_1033657213300027825Bog Forest SoilNLAAGEMYDLLQKRDLAMKKYQTVLAENSATPRAEKAREHIREAYRE
Ga0209167_1082953213300027867Surface SoilAAGEMYDLMQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE
Ga0209465_1064227523300027874Tropical Forest SoilKRDLAMKAYEAVLTGRADSGQADQARRYIREAYRE
Ga0209275_1055687613300027884SoilGEMYDLLQKRDLAVKKYEIVLAENAGTAPAEMARKHIREAYRE
Ga0209624_1000099913300027895Forest SoilDLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE
Ga0209624_1094846313300027895Forest SoilEMYDLMQKRDLAMKKYQSVLAENASSPPAEKARQYIREAYRE
Ga0209624_1100019713300027895Forest SoilEMYDILQQRELAVKKYQTVLAESDSTPLAEQARKHIKQAYRE
Ga0265354_100800143300028016RhizosphereDLLQKRELAMKKYQSVLAENASTPPAEKAREYIREAYRE
Ga0265356_100746043300028017RhizosphereAGEMYDLLQKRDLAMKKYQSVLAENASTPPAEKARQYIREAYRE
Ga0302222_1005310433300028798PalsaKRDLAMEKYETVLAENGSTAPAEQARKHIREAYRE
Ga0302221_1013129533300028806PalsaDLLQKRDLAMQKYQTVLAGNANTTPADQARRYIKEAYRE
Ga0302228_1018554833300028808PalsaMYDLLQKRDLAMQKYQTVLAGNANTTPADQARRYIKEAYRE
Ga0302306_1024874213300030043PalsaEMYDLLQKRDLAMQKYQTVLAGNANTTPADQARRYIKEAYRE
Ga0302192_1045618913300030507BogLQKRELAMKKYQTVLAENASTPPAEKARQYIREAYRE
Ga0310038_1028759813300030707Peatlands SoilLLQKRDLAMKKYQTVLAGNANTGPADQARRYIKEAYRE
Ga0138301_184246823300031022SoilLLQKRELAMKKYQTVLAENGSTPPAEQARKHIREAYRE
Ga0170824_11626962113300031231Forest SoilDLLDKRDLAMKRYETVLAGNANTTPADLARRYIKDAYRE
Ga0307476_1023299013300031715Hardwood Forest SoilAGEMYDLLQKRDLAMKKYQIVLAENGSTPPAEQARKHIREAYRE
Ga0307476_1043056713300031715Hardwood Forest SoilLAAGEMYDLLQKRDLAMKKYQIVLAENASTPPAEQARKHIREAYRE
Ga0307476_1109355623300031715Hardwood Forest SoilDLMQKRDLAMKRYETVLAGNANTGPADQARRYIKEAYRE
Ga0307474_1009523913300031718Hardwood Forest SoilLAAGEMYDLLQKRDLAMKKYQIVLAENGSTPPAEQARKHIREAYRE
Ga0307469_1039675533300031720Hardwood Forest SoilLAAGEMYDLMQKRDLAMKKYQTVLAENGSTPPAERARQHIREAYRE
Ga0307469_1157062413300031720Hardwood Forest SoilMYDLLQKRDLAMKAYEAVLTGRADSGQADLARRHMKEAYRE
Ga0307477_1088250023300031753Hardwood Forest SoilKRDLAMKKYQTVLAQNGSTPPAEEARRHLKDAYRE
Ga0307478_1060188813300031823Hardwood Forest SoilKRDLAMKKYQIVLAENGSTPCAEEARKHIRDAYRE
Ga0307479_1021425413300031962Hardwood Forest SoilLAAGEMYDLLQKRDLAMKKYQTVLAENGSTPPAERARKHIREAYRE
Ga0307479_1186877613300031962Hardwood Forest SoilEMYDLLQKRDLAMKKYQIVLAQNGSTPPAEQARKHIREAYRE
Ga0318504_1062228523300032063SoilMYDLMQKRELAMRAYEAVLTGRPDSGQADQARRYLKDAYRE
Ga0306920_10122370813300032261SoilEVYDLQQKRDLAMKAYEAVLTGRADSGQADQARRYLKDAYRE
Ga0348332_1201056013300032515Plant LitterLQKRDLAMKKYQTVLAENASTPPAEKAREHIREAYRE
Ga0348332_1270154313300032515Plant LitterEMYDLLQKRDLAMKKYQTVLAGNASTGPADQARRYIKEAYRE
Ga0335085_1029498743300032770SoilANLAAGEVYDLLQKRDLAMKSYETVLEGRADSGQADLARRYIKEAYRE
Ga0335080_1109489833300032828SoilNLAAGEMYDLLQKRDLAMKKYETVLAGNANTGPADQARRYIREAYRE
Ga0335081_1190311413300032892SoilMQKRDQAMKSYQTVLAGRPDTGPADLARRYIKDAYRE
Ga0335071_10012603103300032897SoilQKRDLAMKSYETVLEGRADSGQADLARRYIKEAYRE
Ga0310914_1081430323300033289SoilNLAAGEMYDLLQKRDMAMKAYEAVLTGRADSGQADQARRYIKEAYRE
Ga0316214_105062933300033545RootsLYDLMQKRDLAMKSYQMVLAGNANTGPADQARRYIREAYRE
Ga0326724_0485814_506_6313300034091Peat SoilMYDLMQKRDLAMKKYEIVVAQNANTGPADQARRYIKEAFRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.