| Basic Information | |
|---|---|
| Family ID | F060546 |
| Family Type | Metagenome |
| Number of Sequences | 132 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKRLIPIVILLAAAIAAGFYFYPRLTKKAAPTNQLTLSGNIEAHE |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.24 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.12 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.424 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (15.152 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.879 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 0.00% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF02321 | OEP | 88.64 |
| PF00440 | TetR_N | 3.03 |
| PF01161 | PBP | 1.52 |
| PF01569 | PAP2 | 1.52 |
| PF00891 | Methyltransf_2 | 0.76 |
| PF04932 | Wzy_C | 0.76 |
| COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 177.27 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.52 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.42 % |
| Unclassified | root | N/A | 32.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918008|ConsensusfromContig321357 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109652991 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300003324|soilH2_10394907 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300004152|Ga0062386_101474895 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005437|Ga0070710_10914891 | Not Available | 634 | Open in IMG/M |
| 3300005539|Ga0068853_101421621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. M18 | 671 | Open in IMG/M |
| 3300005614|Ga0068856_100156602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2288 | Open in IMG/M |
| 3300009174|Ga0105241_11172750 | Not Available | 726 | Open in IMG/M |
| 3300009549|Ga0116137_1021105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2419 | Open in IMG/M |
| 3300009628|Ga0116125_1229535 | Not Available | 535 | Open in IMG/M |
| 3300009631|Ga0116115_1103449 | Not Available | 730 | Open in IMG/M |
| 3300009760|Ga0116131_1041861 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300010343|Ga0074044_10228509 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300010343|Ga0074044_10355925 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300010379|Ga0136449_104579076 | Not Available | 507 | Open in IMG/M |
| 3300010398|Ga0126383_11042615 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012189|Ga0137388_10242988 | All Organisms → cellular organisms → Bacteria | 1636 | Open in IMG/M |
| 3300013102|Ga0157371_10529967 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300014153|Ga0181527_1391178 | Not Available | 533 | Open in IMG/M |
| 3300014155|Ga0181524_10424096 | Not Available | 576 | Open in IMG/M |
| 3300014160|Ga0181517_10421497 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300014160|Ga0181517_10443708 | Not Available | 661 | Open in IMG/M |
| 3300014161|Ga0181529_10305701 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300014167|Ga0181528_10070667 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300014168|Ga0181534_10183633 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300014199|Ga0181535_10661335 | Not Available | 596 | Open in IMG/M |
| 3300014200|Ga0181526_10743981 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300014491|Ga0182014_10035834 | All Organisms → cellular organisms → Bacteria | 3698 | Open in IMG/M |
| 3300014491|Ga0182014_10299933 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300014491|Ga0182014_10373304 | Not Available | 716 | Open in IMG/M |
| 3300014491|Ga0182014_10502077 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300014492|Ga0182013_10128010 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300014492|Ga0182013_10393007 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300014493|Ga0182016_10589257 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300014496|Ga0182011_10381243 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300014498|Ga0182019_10143026 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300014502|Ga0182021_12886164 | Not Available | 577 | Open in IMG/M |
| 3300014638|Ga0181536_10286222 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300014655|Ga0181516_10143497 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300014657|Ga0181522_10550823 | Not Available | 697 | Open in IMG/M |
| 3300014839|Ga0182027_11455045 | Not Available | 676 | Open in IMG/M |
| 3300016422|Ga0182039_11356775 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300017822|Ga0187802_10279152 | Not Available | 649 | Open in IMG/M |
| 3300017928|Ga0187806_1341379 | Not Available | 535 | Open in IMG/M |
| 3300017931|Ga0187877_1024588 | All Organisms → cellular organisms → Bacteria | 3151 | Open in IMG/M |
| 3300017943|Ga0187819_10485198 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300017946|Ga0187879_10450237 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300017946|Ga0187879_10497186 | Not Available | 676 | Open in IMG/M |
| 3300017988|Ga0181520_10183607 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300018006|Ga0187804_10041568 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300018015|Ga0187866_1213260 | Not Available | 710 | Open in IMG/M |
| 3300018019|Ga0187874_10109155 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300018022|Ga0187864_10459819 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018024|Ga0187881_10304214 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300018024|Ga0187881_10338181 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018034|Ga0187863_10839284 | Not Available | 521 | Open in IMG/M |
| 3300018040|Ga0187862_10713778 | Not Available | 585 | Open in IMG/M |
| 3300018040|Ga0187862_10798090 | Not Available | 547 | Open in IMG/M |
| 3300018043|Ga0187887_10589417 | Not Available | 656 | Open in IMG/M |
| 3300018057|Ga0187858_10882674 | Not Available | 527 | Open in IMG/M |
| 3300018088|Ga0187771_10175409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
| 3300018088|Ga0187771_10966428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300018090|Ga0187770_10777845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300022526|Ga0224533_1034520 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300022875|Ga0224553_1065190 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300022877|Ga0224527_1056128 | Not Available | 737 | Open in IMG/M |
| 3300023101|Ga0224557_1016241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4144 | Open in IMG/M |
| 3300023228|Ga0224530_1024345 | Not Available | 787 | Open in IMG/M |
| 3300023258|Ga0224535_1127244 | Not Available | 537 | Open in IMG/M |
| 3300024238|Ga0224523_1124867 | Not Available | 583 | Open in IMG/M |
| 3300025412|Ga0208194_1045112 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300025612|Ga0208691_1067192 | Not Available | 809 | Open in IMG/M |
| 3300025648|Ga0208507_1060513 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300025941|Ga0207711_10048995 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
| 3300025960|Ga0207651_10010100 | All Organisms → cellular organisms → Bacteria | 5211 | Open in IMG/M |
| 3300026088|Ga0207641_11007815 | Not Available | 829 | Open in IMG/M |
| 3300026502|Ga0255350_1010465 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
| 3300027625|Ga0208044_1018073 | All Organisms → cellular organisms → Bacteria | 2555 | Open in IMG/M |
| 3300027634|Ga0209905_1032565 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300027905|Ga0209415_10919394 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027911|Ga0209698_10905985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300028087|Ga0255354_1019244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300028087|Ga0255354_1028493 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300028087|Ga0255354_1092036 | Not Available | 544 | Open in IMG/M |
| 3300028268|Ga0255348_1072004 | Not Available | 597 | Open in IMG/M |
| 3300028379|Ga0268266_10435491 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300028379|Ga0268266_10875038 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300028572|Ga0302152_10069513 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300028762|Ga0302202_10318065 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300028779|Ga0302266_10079480 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300028859|Ga0302265_1222644 | Not Available | 564 | Open in IMG/M |
| 3300028873|Ga0302197_10044559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2543 | Open in IMG/M |
| 3300028874|Ga0302155_10110466 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300029908|Ga0311341_10708637 | Not Available | 561 | Open in IMG/M |
| 3300029911|Ga0311361_10067388 | All Organisms → cellular organisms → Bacteria | 5477 | Open in IMG/M |
| 3300029911|Ga0311361_11358009 | Not Available | 550 | Open in IMG/M |
| 3300029913|Ga0311362_11047499 | Not Available | 630 | Open in IMG/M |
| 3300029917|Ga0311326_10517613 | Not Available | 581 | Open in IMG/M |
| 3300029922|Ga0311363_11167885 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300029945|Ga0311330_10261681 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300029953|Ga0311343_10150863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2525 | Open in IMG/M |
| 3300029954|Ga0311331_11058797 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300029985|Ga0302280_1297378 | Not Available | 537 | Open in IMG/M |
| 3300029988|Ga0302190_10082025 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300030002|Ga0311350_10900217 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300030051|Ga0302195_10173951 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300030659|Ga0316363_10154401 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300030688|Ga0311345_10344587 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300030693|Ga0302313_10144907 | Not Available | 970 | Open in IMG/M |
| 3300030707|Ga0310038_10497432 | Not Available | 516 | Open in IMG/M |
| 3300031235|Ga0265330_10153192 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300031249|Ga0265339_10585752 | Not Available | 512 | Open in IMG/M |
| 3300031259|Ga0302187_10402787 | Not Available | 647 | Open in IMG/M |
| 3300031341|Ga0307418_1138988 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031524|Ga0302320_10119080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4137 | Open in IMG/M |
| 3300031669|Ga0307375_10263341 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300031726|Ga0302321_101659773 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031788|Ga0302319_11604940 | Not Available | 573 | Open in IMG/M |
| 3300032010|Ga0318569_10266207 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300032770|Ga0335085_10176752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2642 | Open in IMG/M |
| 3300032782|Ga0335082_10570799 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300032782|Ga0335082_11620914 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032805|Ga0335078_10155830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3225 | Open in IMG/M |
| 3300032828|Ga0335080_10454412 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300032829|Ga0335070_11225509 | Not Available | 688 | Open in IMG/M |
| 3300033755|Ga0371489_0089614 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300033755|Ga0371489_0155112 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300033755|Ga0371489_0162907 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300033755|Ga0371489_0361844 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300033888|Ga0334792_186740 | Not Available | 502 | Open in IMG/M |
| 3300033977|Ga0314861_0054463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2201 | Open in IMG/M |
| 3300033982|Ga0371487_0041829 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 15.15% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 9.85% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 9.85% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 5.30% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.03% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.03% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.76% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.76% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.76% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.76% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.76% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300022526 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14 | Environmental | Open in IMG/M |
| 3300022875 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14 | Environmental | Open in IMG/M |
| 3300022877 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T0 | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300023228 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T75 | Environmental | Open in IMG/M |
| 3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
| 3300024238 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028087 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T50 | Environmental | Open in IMG/M |
| 3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031341 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Bog_all_C_02002320 | 2140918008 | Soil | MAVIARFEAMKRMIPVVILLAAAIAASVYYYQRLMDKPAPVNQLTLSGNIE |
| JGIcombinedJ13530_1096529912 | 3300001213 | Wetland | MKRIIPVLIVRAAAGAAGVFFYPRWTRKAVPANQIPLSGN |
| soilH2_103949071 | 3300003324 | Sugarcane Root And Bulk Soil | MKRRLPILIVLAAIIAAGLYFYPRLTKKRGPSNEIVLSGNI |
| Ga0062386_1014748952 | 3300004152 | Bog Forest Soil | MMKRIIPIVILLAVAVAVGVYYYTRLTVKKASDHEIALSG |
| Ga0070710_109148911 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRIIPVVILLAAAVVGGFYFYPRFKTKPALTNEITLSGN |
| Ga0068853_1014216212 | 3300005539 | Corn Rhizosphere | MKRMIPIIILLVAAVAAGIYFYPRFKTKAAPANEITLFGNIEAHESLL |
| Ga0068856_1001566023 | 3300005614 | Corn Rhizosphere | MKRMIPIIILLVAAVAAGIYFYPRFKTKAAPANEITLFGNIEAHESLLSFK |
| Ga0105241_111727502 | 3300009174 | Corn Rhizosphere | MKKRIPSLLVLAALVAAGLYFYPRMKEKPAPANQLVVSGNIEAH |
| Ga0116137_10211051 | 3300009549 | Peatland | MKRRLSVLILIAAVIAAGAYFYPRITKKAKPENQLTLS |
| Ga0116125_12295352 | 3300009628 | Peatland | MKLRLPILIGLVAAIAAGVYFYPRLTRKTQAQNQLTLSGNIEAHQSLVSFKV |
| Ga0116115_11034491 | 3300009631 | Peatland | MKRVLPVLILLIAAIAAGVYFYPRLIKKPSPATQLTLS |
| Ga0116131_10418612 | 3300009760 | Peatland | MKRRIAVLVLLAAVIATGVYLHPRLAKKTEPESQITLSGNIEAHESLVSFKVQ |
| Ga0074044_102285091 | 3300010343 | Bog Forest Soil | MKRLLPVLILLIAAIAAGVYFYPRLIKKPQPANQLTLSGNIEAHESL |
| Ga0074044_103559251 | 3300010343 | Bog Forest Soil | MKRRLPILILLAAAIAAGVYLYPRLTRKTEPQNQLTL |
| Ga0136449_1045790762 | 3300010379 | Peatlands Soil | MKRLIPILILLAAAIAAGVYYYPRFAKRPAPVNQLTLSGNIEAH |
| Ga0126383_110426151 | 3300010398 | Tropical Forest Soil | MKKRLPLLIVLAVVVAAGLYLYPRFLDKPAPSNQLVLSGNIEAHESLVSF |
| Ga0137388_102429882 | 3300012189 | Vadose Zone Soil | MKRRISILLALAAVIAASWYGYRHFTKKSEPGNQLTLSGNIEAHESL |
| Ga0157371_105299671 | 3300013102 | Corn Rhizosphere | MKKRIPVLLALAALVAAGLYFYPRMKEKPAPVNQLVVSGNIEAHESLVSFK |
| Ga0181527_13911781 | 3300014153 | Bog | MKRLIPILILLAAAIAAGVYLYPRLAKKPEPENQITL |
| Ga0181524_104240961 | 3300014155 | Bog | MRRVIPIVILLAAAVAACVYFYPQLTHKSAPVNQLTLSGNIEAHESL |
| Ga0181517_104214971 | 3300014160 | Bog | MLLFARFNIMKRVIPVLILLAVAIAAGVYFYPRLASKPAPANQLTLSGNIEAHESL |
| Ga0181517_104437081 | 3300014160 | Bog | MKRVIPIVILLAAAIAGGLYFYPKLIKKPAPVNEIKLSGNIEAHESLVSFK |
| Ga0181529_103057012 | 3300014161 | Bog | MIPVLILLAAAVAAGVFFYPRLTKKAAPANEITLSGNIEA |
| Ga0181528_100706673 | 3300014167 | Bog | MKRVIPILILLAAAIAAGVYFYPRWSRKPAEENQLTL |
| Ga0181534_101836331 | 3300014168 | Bog | MKRLIPILILLIAAIAAGVYYYPRFAKKAEPVSQLSLSGNIEAHES |
| Ga0181535_106613352 | 3300014199 | Bog | MKRLIPIVILLAAAIAAGFYFYPRLTKKAAPTNQLTLSGNIEAHES |
| Ga0181526_107439811 | 3300014200 | Bog | MVPIVILLAAAALAGIYLYPRLAKRPAPANQLLLSGNIEAHESL |
| Ga0182014_100358341 | 3300014491 | Bog | MKRLIPIFILLVAAIAAGLYFYPRLTRKPAPANQLALSGNIEAHE |
| Ga0182014_102999331 | 3300014491 | Bog | MKRLIPILILVLAAIAAGLYFYPRLTRKPAPANQLALSGNIEAHESL |
| Ga0182014_103733041 | 3300014491 | Bog | MKRLIPVIVLLIVVVVAGVYFYPRLTRKTAPANEIALSGNIEAHES |
| Ga0182014_105020772 | 3300014491 | Bog | MKRVIPILILLAAAIAAGVYFYPRLIKKPEPANQLTLSGNIEAHESLV |
| Ga0182013_101280101 | 3300014492 | Bog | MKRVIPIVILLAGGVAAGVYYYPPLVKKPVPVNQLVLSGNIEAH |
| Ga0182013_103930071 | 3300014492 | Bog | MKRVIPIVILLAVATAAGVYFYPKLIKKPAPITELKLS |
| Ga0182016_105892571 | 3300014493 | Bog | MRGLEAMKRVIPILILLAVAIAAGIRYYPLLIKKPTPVNQLTLSGNIEAHESLVG |
| Ga0182011_103812432 | 3300014496 | Fen | MKRLIPVLVVLAAVIAAGVYYYPRIGKKPAPSNQLTLSGNIEAHESL |
| Ga0182019_101430261 | 3300014498 | Fen | MKRLIPILILLGAVIAAGVYFYPRLTKKSEPENQITL |
| Ga0182021_128861642 | 3300014502 | Fen | MKRAIPIVILLAAAVAAGLYYYPRLMQKSAPANQLTLSGNIEAHES |
| Ga0181536_102862221 | 3300014638 | Bog | MKKIIPIVILLAAAIAAGIYYYPQLTHKTAPVTQLSLS |
| Ga0181516_101434971 | 3300014655 | Bog | MKRVIPVVILLVAAIAAGVYYYPRFVKKTVPENQLT |
| Ga0181522_105508232 | 3300014657 | Bog | MKRLIPIVIVLAAVVVAAFYFYPRLAKKPVPSNELTLSGNIEAHE |
| Ga0182027_114550452 | 3300014839 | Fen | MKRLIPIVILLAAAIAAGVYFYPRLIKKPAPVNQLTLS |
| Ga0182039_113567751 | 3300016422 | Soil | MKRLIPIVILLAAAVAAGIYFYPRWKTKPAPTNEITLSGNIEAHESL |
| Ga0187802_102791522 | 3300017822 | Freshwater Sediment | MKRRIAVLILLAAMIAAGVYFYPRLTRKPELENQITL |
| Ga0187806_13413792 | 3300017928 | Freshwater Sediment | MKRRIPVLILLAAVIVAGIHFYPRLNQKKAPENQITLSGNIEAH |
| Ga0187877_10245885 | 3300017931 | Peatland | MRKRRIVIPIVLMAAIAAGFYFYPKLTRKPAPTNELTLSGNIEAHESLVSFKM |
| Ga0187819_104851981 | 3300017943 | Freshwater Sediment | MKRRIPILVLLAAVIAAAVYFYPRWANKDKVENQVTLSGNIEAHE |
| Ga0187879_104502371 | 3300017946 | Peatland | MTRVISVLILLVAAVAAGVHYYLGLVGKPAPVNQLTLSGNI |
| Ga0187879_104971862 | 3300017946 | Peatland | MKRIIPVVILLAAAVAAGVYFYPRLAKKPEPVNQLALSGNIEAH |
| Ga0181520_101836072 | 3300017988 | Bog | MKRVIPIVILLAVALAASVYYYPRLTKKALPANELILSG |
| Ga0187804_100415683 | 3300018006 | Freshwater Sediment | MKRRIPILVLLAAAIAAAVHFYPRLADKDKAEDQLTLSGNIEAHESLVSFKV |
| Ga0187866_12132601 | 3300018015 | Peatland | MKRRIPVLILLAAIIAAGVYFYARLTRKSGPENQIALSGNIEAHESLVS |
| Ga0187874_101091551 | 3300018019 | Peatland | MKRLIAVLIVLAVMITTGVYLYPRLTKKTEPENQISLSGNIEAHESLVSFK |
| Ga0187864_104598192 | 3300018022 | Peatland | MKKRLPLVIVIAAVIVAVIYFYPRWTAKPAPSSHLMLSGNIEAHESLISF |
| Ga0187881_103042141 | 3300018024 | Peatland | MKRRIPVLILLAAVIAAGVYFYPRLTKKAKPENQLTLSGNI |
| Ga0187881_103381812 | 3300018024 | Peatland | MKRLIPILILLAAVIAAAVYFYPRLTKKPGPENQIALSGN |
| Ga0187863_108392842 | 3300018034 | Peatland | MKKIIPIVILLAVAVAAGVYYYPRLTQKTAPVNQLTLSGNIEAH |
| Ga0187862_107137782 | 3300018040 | Peatland | MKRLISVLILLAAAIAAGVYYYPRFAKRPEPLNQITLSGNIEAHES |
| Ga0187862_107980901 | 3300018040 | Peatland | MKRLIPVLILLAAAIAAGVYLYPRLTRKSEPENRLTLSGNIEAHESLVSFK |
| Ga0187887_105894171 | 3300018043 | Peatland | MRRVIPIVILLAAAVAAGVYFYPKLTNKSVPVNQLTLSGNIEAHESLVG |
| Ga0187858_108826742 | 3300018057 | Peatland | MKKRRIVIPIVLAAAVAAGFYFYPKYARKAAPANEHTLSGNIEAHESLV |
| Ga0187771_101754091 | 3300018088 | Tropical Peatland | MKRRIAVLILLAAMIAAGVYFYPRLTKKPGLENQITLSGNIEAH |
| Ga0187771_109664281 | 3300018088 | Tropical Peatland | MKRRLSVLILMAAVIAAGAYFYPRITKKAKPENQLTLSGNIEAHESL |
| Ga0187770_107778451 | 3300018090 | Tropical Peatland | MKRRLFVLILIAAAIAAGAHFYPRIAKKAKSENQLTLSGNFEAHESLVS |
| Ga0224533_10345202 | 3300022526 | Soil | MKRVITVLVLLAAAIAAGVYFYPRLTKKPESTNRLTLSGNI |
| Ga0224553_10651901 | 3300022875 | Soil | MKRAIPIVILLAAAVAAGVYYYPRLTKKSAPANQLTLS |
| Ga0224527_10561281 | 3300022877 | Soil | MKRIIPVLILLAAAIAAGVYFYPRWTRKAVPANQLTLSGNIEAHESLIS |
| Ga0224557_10162415 | 3300023101 | Soil | MKRVIPVLIVLAAAIAAGVYFYPRLMKKPAPANELTLSGNI |
| Ga0224530_10243452 | 3300023228 | Soil | MKRIIPILILLAAAVAAGLYFYPRWTKNAAPTNQLTLSGNIE |
| Ga0224535_11272442 | 3300023258 | Soil | MKRIIPIVILLIAAVVTGVHYYPRLTQKPAPVNQLSLSGNIEAHESLV |
| Ga0224523_11248672 | 3300024238 | Soil | MKRVIPIVILLAVAIAAGVYYYPQLTTKSAPINQLTLSGNIE |
| Ga0208194_10451122 | 3300025412 | Peatland | MTRVISVLILLVAAVAAGVHYYLGLVGKPAPVNQLTLSGNIEAHESLVGFKVQG |
| Ga0208691_10671922 | 3300025612 | Peatland | MKRIIPVVILLAAAVAAGVYFYPRLAKKPEPVNQLA |
| Ga0208507_10605131 | 3300025648 | Freshwater | MKRVIPILVLLAAAIAACVYYYPRLTKKPELVNQVTLSG |
| Ga0207711_100489951 | 3300025941 | Switchgrass Rhizosphere | MKKRIPLLLVLAALVAAGLYFYPRMKEKPAPANQLVVSGNIEAHESL |
| Ga0207651_100101001 | 3300025960 | Switchgrass Rhizosphere | MKKRIPSLLVLAALVAAGLYFYPRMKEKPAPANQLVVSGNIEA |
| Ga0207641_110078152 | 3300026088 | Switchgrass Rhizosphere | MKKRIPSLLVLAALVAAGLYFYPRMKEKPAPANQLVVSGNI |
| Ga0255350_10104651 | 3300026502 | Soil | MKRVIPILILLAVAIAAGIRYYPLLIKKPTPVNQLTLSGNIEAHESLVGFKV |
| Ga0208044_10180734 | 3300027625 | Peatlands Soil | MKRLIPIIILLAAVIGAGIYFYPRLAKKKAPANELTLSGNIE |
| Ga0209905_10325651 | 3300027634 | Thawing Permafrost | MKRVIPVLILLAAVIAAGVYFYPRLTRKPADANQLTLSGLSLIHI |
| Ga0209415_109193941 | 3300027905 | Peatlands Soil | MKRRLPILILLAAAIAAGVYLYPRLTRKTEPQNQLTLSGNIEAHESLV |
| Ga0209698_109059852 | 3300027911 | Watersheds | MKQRIPVLILLAAVIATGVYFYPRLGKKPGPENQITLSGN |
| Ga0255354_10192443 | 3300028087 | Soil | MKRVIPIVILLVAVVAAGVYFYPRFVRKPAPMNQLTLSG |
| Ga0255354_10284931 | 3300028087 | Soil | MKKIIPIVVLLIVAVTAGVYCYSRLTRKPAPANQLTLSGNIEAHES |
| Ga0255354_10920362 | 3300028087 | Soil | MKRVIPVLILLAAVIAAGVYFYPRLTRKPADANQLT |
| Ga0255348_10720042 | 3300028268 | Soil | MKRLIPIVILLAAAIAAGFYFYPRLTKKAAPTNQLTLSGNIEAHE |
| Ga0268266_104354912 | 3300028379 | Switchgrass Rhizosphere | MKKRIPLLLVLAALVAAGLYFYPRMKEKPAPANQLVVSGNIEAHESLVS |
| Ga0268266_108750382 | 3300028379 | Switchgrass Rhizosphere | MKKRIPSLLVLAALVAAGLYFYPRMKEKPAPANQLVVSGNIEAHESLVS |
| Ga0302152_100695131 | 3300028572 | Bog | MKRVIPIVILLAAVVAAGVYYYPRLFRKPAPVNQLTLSGNIEA |
| Ga0302202_103180651 | 3300028762 | Bog | MKRLIPVFILLVAAIAAGLYFYPRLTRKSAPANQL |
| Ga0302266_100794801 | 3300028779 | Bog | MKRLIPIVIVLCAAVAAGIYFYPRFAKKPAPANEI |
| Ga0302265_12226441 | 3300028859 | Bog | MKRIIPILILLAAAVAAGLYFYPRWTKNAAPTKQLTLSGNIEAHESLVS |
| Ga0302197_100445591 | 3300028873 | Bog | MKRVIPVLILLAAAVAAGVYFYPRLAKKPAAVNQLTLS |
| Ga0302155_101104662 | 3300028874 | Bog | MKRLILVFILLVAAIAAGLYFYPRLTRKPAPDNQLALSGNIEAHESLVR |
| Ga0311341_107086371 | 3300029908 | Bog | MKRIIPVLILLAAAIAAGVYFYPRWTRKAVPANQLTLSG |
| Ga0311361_100673886 | 3300029911 | Bog | MKRLIPVFILLVAAIAAGLYFYPRLTRKSAPANQLAL |
| Ga0311361_113580091 | 3300029911 | Bog | MKRLIPVLIVLAVAVAAGVYFYPRFAKKPAPTNQLTFSGN |
| Ga0311362_110474991 | 3300029913 | Bog | MKRLIPILILLAAVVAAGVYYYPRLTRKPAPVNELALSGNIEAHES |
| Ga0311326_105176132 | 3300029917 | Bog | MKRAIPILIVLIAVVAAGVYYYPRFHKKPAPLNQLTLSGNIE |
| Ga0311363_111678852 | 3300029922 | Fen | MKRLISVLILLAAAIAAGVYYYPRFVRKPAPANQLTL |
| Ga0311330_102616811 | 3300029945 | Bog | MKRLIPVFILLVAAIAAGLYFYPRLTRKPAPDNQLALSGNIEAHESL |
| Ga0311343_101508634 | 3300029953 | Bog | MKRAIPILIVLIAVVAAGVYYYPRFHKKPAPLNQLTL |
| Ga0311331_110587971 | 3300029954 | Bog | MKRLIPVFILLVVAIAAGLYFYPRLTKKPAPDNQLALSGNIEAHESLVSFK |
| Ga0302280_12973781 | 3300029985 | Fen | MKKIIPIVILLIVAVAAGVHYYPRMTKKAAPVNQLTLSGNIEAHES |
| Ga0302190_100820252 | 3300029988 | Bog | MKRIIPVLIVLAAAIAAGVYFYPRFMKKPAPTNQLTLSGNIEAHESL |
| Ga0311350_109002171 | 3300030002 | Fen | MKRIIPIVILLAVAVAAGLYFYPRLVKKPAPVNQLALSGNIEAHEALV |
| Ga0302195_101739511 | 3300030051 | Bog | MKRIIPIVIFLAAAIAAGIYFYPRLTKKPAPANELTLSGNIE |
| Ga0316363_101544011 | 3300030659 | Peatlands Soil | MKRSIQILVLLAAVIAAAVYFYPRWANKDKVENQLTLSG |
| Ga0311345_103445871 | 3300030688 | Bog | MKRLIPVVILLAAAVAAGVYFYPRLKKKAVPANEI |
| Ga0302313_101449071 | 3300030693 | Palsa | MKRAVPILILLAAAIAACLYFYPRFAKKPQPSNQLTLSG |
| Ga0310038_104974322 | 3300030707 | Peatlands Soil | MKRAIPILILLAVAIAAGVYYYPRFAKKPEPVNQLTLSGNIEAHESLVG |
| Ga0265330_101531921 | 3300031235 | Rhizosphere | MKRFIPVLILLAAAIAAGVYFYPRFAAKPAPANQLTLSGNIEAHESLVSF |
| Ga0265339_105857522 | 3300031249 | Rhizosphere | MKRFIPVLILLAAAIAAGVYFYPRFAAKPAPANQLTLS |
| Ga0302187_104027872 | 3300031259 | Bog | MKRLIPVLILLAAAIAAGVYYYPRLVKKPVPVNQLT |
| Ga0307418_11389882 | 3300031341 | Salt Marsh | MKRVIRVLILLAVVVAVGVYLYPRLTKKPAPVNELTLSGNIEAHESLVG |
| Ga0302320_101190801 | 3300031524 | Bog | MKRVIPIVILLVAAIAAAVYFYPRLTKKPAPANQL |
| Ga0307375_102633411 | 3300031669 | Soil | MKRLIAVVILLAAAVAAGVYFYPRLTKKPGPVNQLTVSG |
| Ga0302321_1016597732 | 3300031726 | Fen | MKRLIPIIVLLTAAIAAGVYFYPRLTSKPAPTNQLMLF |
| Ga0302319_116049402 | 3300031788 | Bog | MKRIIPVLIVLAAAIAAGVYFYPRFMKKPAPTNQLTLSGNIE |
| Ga0318569_102662072 | 3300032010 | Soil | MKRLIPIVILLAAAVAAGFYFYPRWKAKPAPANEVTLSGNIEAHES |
| Ga0335085_101767521 | 3300032770 | Soil | MKKRLPLLIVIAAVIAVGVYLYPRLKPKAAPANQLVLSGNIETHESLVGF |
| Ga0335082_105707992 | 3300032782 | Soil | MKRRIPILIVLAALVAAGVYFYPRFTKGSKPQNEIVLSGNIEAHESLVS |
| Ga0335082_116209142 | 3300032782 | Soil | MKRMIPVLLLLAIAAFAVWRYYPRWTRKQAPSNQLTLS |
| Ga0335078_101558301 | 3300032805 | Soil | MKRLIPILILLIVAGAAAFYFYPRFANKPALTNELMLSGNIE |
| Ga0335080_104544121 | 3300032828 | Soil | MKRIIPVVILLAAAIAAGVYFYPRLTKKAAPSNELVLSG |
| Ga0335070_112255092 | 3300032829 | Soil | MKRAIPLLVLVAAAIAAGFYYYPNLKKKPAAVNQLTLS |
| Ga0371489_0089614_1709_1837 | 3300033755 | Peat Soil | MKRLIPIVILLALAIAGGFYWHARQTKKPAPANEIVLSGNIEA |
| Ga0371489_0155112_1_138 | 3300033755 | Peat Soil | MFTPARFEAMKRLIPILILLAAAIAAGVYLYPRLTKKSEPESQLTL |
| Ga0371489_0162907_1073_1198 | 3300033755 | Peat Soil | MRRVIPIVILLAAAVAAGMYYYLHMKEKTAPVNQLTLFGNIE |
| Ga0371489_0361844_569_676 | 3300033755 | Peat Soil | MKRLIPILILLCAAVAAGVYFYPRYVKKPAPANAIV |
| Ga0334792_186740_2_127 | 3300033888 | Soil | MKRRIPLLILLAAVIGAGVYLYPRLTKKSESENHITLSGNIE |
| Ga0314861_0054463_3_122 | 3300033977 | Peatland | MKRLIPIAILLAAAVAAAIYFYPRLAQKSAPSNELTLSGN |
| Ga0371487_0041829_3_125 | 3300033982 | Peat Soil | MKRVIPIVILLTAAVAASAYYYLQLTNKSAPVNQLTFSGNI |
| ⦗Top⦘ |