| Basic Information | |
|---|---|
| Family ID | F060515 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 132 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 132 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Eukaryota |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 96.97 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Eukaryota (93.939 % of family members) |
| NCBI Taxonomy ID | 2759 |
| Taxonomy | All Organisms → cellular organisms → Eukaryota |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (72.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (64.394 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.56% β-sheet: 13.89% Coil/Unstructured: 80.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 132 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 0.76 |
| PF13650 | Asp_protease_2 | 0.76 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.94 % |
| Unclassified | root | N/A | 6.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005347|Ga0070668_101120982 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 711 | Open in IMG/M |
| 3300005353|Ga0070669_101702934 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 550 | Open in IMG/M |
| 3300005548|Ga0070665_101073312 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 817 | Open in IMG/M |
| 3300005548|Ga0070665_102106645 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 568 | Open in IMG/M |
| 3300005549|Ga0070704_101395468 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 642 | Open in IMG/M |
| 3300005617|Ga0068859_101385245 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 775 | Open in IMG/M |
| 3300005617|Ga0068859_103125817 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
| 3300005842|Ga0068858_101892226 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 589 | Open in IMG/M |
| 3300005843|Ga0068860_102627254 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 522 | Open in IMG/M |
| 3300009972|Ga0105137_102584 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 763 | Open in IMG/M |
| 3300009976|Ga0105128_116995 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 550 | Open in IMG/M |
| 3300009980|Ga0105135_109465 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 728 | Open in IMG/M |
| 3300009981|Ga0105133_109846 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 712 | Open in IMG/M |
| 3300009989|Ga0105131_141808 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 513 | Open in IMG/M |
| 3300009989|Ga0105131_143097 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 507 | Open in IMG/M |
| 3300009992|Ga0105120_1026782 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 666 | Open in IMG/M |
| 3300009994|Ga0105126_1047180 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 541 | Open in IMG/M |
| 3300010373|Ga0134128_11894832 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 656 | Open in IMG/M |
| 3300010397|Ga0134124_11006549 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 845 | Open in IMG/M |
| 3300010397|Ga0134124_13063441 | Not Available | 511 | Open in IMG/M |
| 3300010400|Ga0134122_12643737 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 553 | Open in IMG/M |
| 3300014325|Ga0163163_11546528 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 725 | Open in IMG/M |
| 3300014968|Ga0157379_12220855 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 545 | Open in IMG/M |
| 3300014968|Ga0157379_12415694 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 525 | Open in IMG/M |
| 3300014968|Ga0157379_12631121 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
| 3300015270|Ga0182183_1052981 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 608 | Open in IMG/M |
| 3300015273|Ga0182102_1020568 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 628 | Open in IMG/M |
| 3300015297|Ga0182104_1044915 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 710 | Open in IMG/M |
| 3300015309|Ga0182098_1105837 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 539 | Open in IMG/M |
| 3300015309|Ga0182098_1129158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 501 | Open in IMG/M |
| 3300015312|Ga0182168_1037148 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 810 | Open in IMG/M |
| 3300015312|Ga0182168_1110479 | Not Available | 548 | Open in IMG/M |
| 3300015312|Ga0182168_1128580 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 516 | Open in IMG/M |
| 3300015315|Ga0182120_1080350 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 623 | Open in IMG/M |
| 3300015315|Ga0182120_1107669 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 557 | Open in IMG/M |
| 3300015315|Ga0182120_1131569 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 514 | Open in IMG/M |
| 3300015319|Ga0182130_1082383 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 609 | Open in IMG/M |
| 3300015319|Ga0182130_1126372 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 519 | Open in IMG/M |
| 3300015320|Ga0182165_1107303 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 572 | Open in IMG/M |
| 3300015325|Ga0182148_1058366 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 706 | Open in IMG/M |
| 3300015325|Ga0182148_1122968 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 538 | Open in IMG/M |
| 3300015325|Ga0182148_1125367 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 534 | Open in IMG/M |
| 3300015325|Ga0182148_1125708 | Not Available | 533 | Open in IMG/M |
| 3300015327|Ga0182114_1068846 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 709 | Open in IMG/M |
| 3300015327|Ga0182114_1094853 | Not Available | 628 | Open in IMG/M |
| 3300015330|Ga0182152_1151928 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 506 | Open in IMG/M |
| 3300015331|Ga0182131_1144927 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 518 | Open in IMG/M |
| 3300015331|Ga0182131_1151964 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 508 | Open in IMG/M |
| 3300015332|Ga0182117_1071660 | Not Available | 721 | Open in IMG/M |
| 3300015332|Ga0182117_1164061 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 510 | Open in IMG/M |
| 3300015333|Ga0182147_1168336 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 504 | Open in IMG/M |
| 3300015334|Ga0182132_1148407 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 532 | Open in IMG/M |
| 3300015336|Ga0182150_1097617 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 624 | Open in IMG/M |
| 3300015336|Ga0182150_1141663 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 538 | Open in IMG/M |
| 3300015338|Ga0182137_1124714 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 589 | Open in IMG/M |
| 3300015338|Ga0182137_1158954 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 529 | Open in IMG/M |
| 3300015338|Ga0182137_1175427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 506 | Open in IMG/M |
| 3300015339|Ga0182149_1120112 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 588 | Open in IMG/M |
| 3300015340|Ga0182133_1071164 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 759 | Open in IMG/M |
| 3300015340|Ga0182133_1144140 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 571 | Open in IMG/M |
| 3300015348|Ga0182115_1165289 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 709 | Open in IMG/M |
| 3300015348|Ga0182115_1172806 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 692 | Open in IMG/M |
| 3300015348|Ga0182115_1280556 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 527 | Open in IMG/M |
| 3300015348|Ga0182115_1292294 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 515 | Open in IMG/M |
| 3300015349|Ga0182185_1218904 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 577 | Open in IMG/M |
| 3300015349|Ga0182185_1259560 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 530 | Open in IMG/M |
| 3300015350|Ga0182163_1211149 | Not Available | 608 | Open in IMG/M |
| 3300015350|Ga0182163_1272267 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 530 | Open in IMG/M |
| 3300015350|Ga0182163_1273479 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 529 | Open in IMG/M |
| 3300015352|Ga0182169_1099164 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 931 | Open in IMG/M |
| 3300015352|Ga0182169_1139648 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 788 | Open in IMG/M |
| 3300015352|Ga0182169_1143318 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 778 | Open in IMG/M |
| 3300015353|Ga0182179_1245802 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 576 | Open in IMG/M |
| 3300015353|Ga0182179_1249021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 573 | Open in IMG/M |
| 3300015353|Ga0182179_1253941 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 567 | Open in IMG/M |
| 3300015353|Ga0182179_1314061 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 511 | Open in IMG/M |
| 3300015354|Ga0182167_1146494 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 871 | Open in IMG/M |
| 3300017408|Ga0182197_1122866 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 545 | Open in IMG/M |
| 3300017414|Ga0182195_1103985 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 681 | Open in IMG/M |
| 3300017414|Ga0182195_1138038 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 610 | Open in IMG/M |
| 3300017414|Ga0182195_1149853 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 591 | Open in IMG/M |
| 3300017421|Ga0182213_1165745 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 625 | Open in IMG/M |
| 3300017422|Ga0182201_1126959 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 527 | Open in IMG/M |
| 3300017432|Ga0182196_1117014 | Not Available | 557 | Open in IMG/M |
| 3300017432|Ga0182196_1149137 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 511 | Open in IMG/M |
| 3300017432|Ga0182196_1151345 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 508 | Open in IMG/M |
| 3300017435|Ga0182194_1107145 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 577 | Open in IMG/M |
| 3300017440|Ga0182214_1053301 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 813 | Open in IMG/M |
| 3300017445|Ga0182198_1073961 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 738 | Open in IMG/M |
| 3300017445|Ga0182198_1134550 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 592 | Open in IMG/M |
| 3300017447|Ga0182215_1064785 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 788 | Open in IMG/M |
| 3300017447|Ga0182215_1089779 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 679 | Open in IMG/M |
| 3300017447|Ga0182215_1159546 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 523 | Open in IMG/M |
| 3300017691|Ga0182212_1161603 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 511 | Open in IMG/M |
| 3300017692|Ga0182210_1077001 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 704 | Open in IMG/M |
| 3300017692|Ga0182210_1105474 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 609 | Open in IMG/M |
| 3300017692|Ga0182210_1113662 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 588 | Open in IMG/M |
| 3300017693|Ga0182216_1114459 | Not Available | 658 | Open in IMG/M |
| 3300017792|Ga0163161_10199903 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max | 1540 | Open in IMG/M |
| 3300025972|Ga0207668_11812436 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 551 | Open in IMG/M |
| 3300026088|Ga0207641_11607982 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 652 | Open in IMG/M |
| 3300026088|Ga0207641_12529373 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 512 | Open in IMG/M |
| 3300026118|Ga0207675_101726842 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 646 | Open in IMG/M |
| 3300026118|Ga0207675_101885930 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 616 | Open in IMG/M |
| 3300028053|Ga0268346_1031217 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 565 | Open in IMG/M |
| 3300028056|Ga0268330_1028340 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 667 | Open in IMG/M |
| 3300028062|Ga0268342_1011044 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 795 | Open in IMG/M |
| 3300028381|Ga0268264_11984207 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 591 | Open in IMG/M |
| 3300028474|Ga0268331_1008524 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 724 | Open in IMG/M |
| 3300032465|Ga0214493_1070161 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 833 | Open in IMG/M |
| 3300032465|Ga0214493_1079800 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 779 | Open in IMG/M |
| 3300032466|Ga0214503_1128621 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 791 | Open in IMG/M |
| 3300032502|Ga0214490_1074691 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 776 | Open in IMG/M |
| 3300032502|Ga0214490_1112613 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 620 | Open in IMG/M |
| 3300032502|Ga0214490_1133636 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 563 | Open in IMG/M |
| 3300032550|Ga0321340_1025719 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 833 | Open in IMG/M |
| 3300032551|Ga0321339_1043145 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max | 1018 | Open in IMG/M |
| 3300032697|Ga0214499_1287056 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 506 | Open in IMG/M |
| 3300032757|Ga0314753_1076158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 596 | Open in IMG/M |
| 3300032760|Ga0314754_1032060 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 832 | Open in IMG/M |
| 3300032761|Ga0314733_1079695 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 623 | Open in IMG/M |
| 3300032792|Ga0314744_1079305 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 631 | Open in IMG/M |
| 3300032824|Ga0314735_1046416 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 822 | Open in IMG/M |
| 3300032917|Ga0314721_116460 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 788 | Open in IMG/M |
| 3300032934|Ga0314741_1141776 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 539 | Open in IMG/M |
| 3300033530|Ga0314760_1059364 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 947 | Open in IMG/M |
| 3300033531|Ga0314756_1100774 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 501 | Open in IMG/M |
| 3300033532|Ga0314767_1054971 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 970 | Open in IMG/M |
| 3300033535|Ga0314759_1100815 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 907 | Open in IMG/M |
| 3300033535|Ga0314759_1301031 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 506 | Open in IMG/M |
| 3300033535|Ga0314759_1307254 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 500 | Open in IMG/M |
| 3300033542|Ga0314769_1243442 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 72.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.82% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 6.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.03% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 3.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.76% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017691 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032760 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032917 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033531 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033542 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070668_1011209821 | 3300005347 | Switchgrass Rhizosphere | NDNIKCLSGLDLSDYELISCAKDGFVPATLKPMENRLNHLM* |
| Ga0070669_1017029342 | 3300005353 | Switchgrass Rhizosphere | ALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0070665_1010733121 | 3300005548 | Switchgrass Rhizosphere | HDNIKCLLGLDLTDYDLISCTKEGFVSAVLKPMENRLHLLL* |
| Ga0070665_1021066451 | 3300005548 | Switchgrass Rhizosphere | TSSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM* |
| Ga0070704_1013954682 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNQLNHLM* |
| Ga0068859_1013852451 | 3300005617 | Switchgrass Rhizosphere | SISAHDNVKCLSGVDLSDYDLISCTKDGFVSAILKPMDNGLNHLM* |
| Ga0068859_1031258172 | 3300005617 | Switchgrass Rhizosphere | AHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM* |
| Ga0068858_1018922262 | 3300005842 | Switchgrass Rhizosphere | ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0068860_1026272542 | 3300005843 | Switchgrass Rhizosphere | VKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM* |
| Ga0105137_1025842 | 3300009972 | Switchgrass Associated | FVALADSDSISAHDNVMCLSGVDLSDYDLISCTKDGFVSAVLKSMDNRLNHLM* |
| Ga0105128_1169951 | 3300009976 | Switchgrass Associated | IKCLSDLDLTDYDLISCTKEGIVSAVLKPMENRLHLLL* |
| Ga0105135_1094652 | 3300009980 | Switchgrass Associated | NSAHDNVKCLSGVDLSDYDLISCTKDGFVSTVLKPMDNRLNHLM* |
| Ga0105133_1098461 | 3300009981 | Switchgrass Associated | KCLSGVDLSDYDLISCTKDGFVSAVLKPMNNWLNHLM* |
| Ga0105131_1418082 | 3300009989 | Switchgrass Associated | FVALADSDSISAHDNVKCLSGVDLSDYDLISCTNDGFVFVVLKSMDNRLNHLM* |
| Ga0105131_1430972 | 3300009989 | Switchgrass Associated | SAHDNVKCLSGMDLSDYNLISCTKDGFVFAVLKPMDNRLNHLM* |
| Ga0105120_10267822 | 3300009992 | Switchgrass Associated | TSSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0105126_10471802 | 3300009994 | Switchgrass Associated | ISAHDNVKCLSGMDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM* |
| Ga0134128_118948321 | 3300010373 | Terrestrial Soil | IKCLSGVDQSDYDLISFTKDGFVSAVLKPMDNWLNHLM* |
| Ga0134124_110065492 | 3300010397 | Terrestrial Soil | SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM* |
| Ga0134124_130634411 | 3300010397 | Terrestrial Soil | DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0134122_126437372 | 3300010400 | Terrestrial Soil | SSFVALIDWDSISAHDNVKCLSGVDLSDYDLFSCTKDGFVSAVLKPMDNWLNHLM* |
| Ga0163163_115465282 | 3300014325 | Switchgrass Rhizosphere | ADSNSIGANDNVKCLSGLDLSNYDFISCTKEGFVPATLKPMENRLNHLML* |
| Ga0157379_122208551 | 3300014968 | Switchgrass Rhizosphere | LGVHDDIKCLSGLDLSDFELISCIKDGFVPATLKPMENRLHYCK* |
| Ga0157379_124156943 | 3300014968 | Switchgrass Rhizosphere | ELIGAHDHIKCLSGLDLTDYDLISCTKEGFVSAVLKPMENRLQLLL* |
| Ga0157379_126311211 | 3300014968 | Switchgrass Rhizosphere | VKCLSGVDLSDYDLISCNKDGFVFAVLKSMDNRLNHLM* |
| Ga0182183_10529811 | 3300015270 | Switchgrass Phyllosphere | NIKCLSSLDLTDYDLINCTKEGFVSVVLKPMENWLHLLL* |
| Ga0182102_10205682 | 3300015273 | Switchgrass Phyllosphere | DNFKCLSGLDLTDYDLINCTKEGFVSAVLKPMENRLYLLL* |
| Ga0182104_10449152 | 3300015297 | Switchgrass Phyllosphere | LLGVDLFGYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0182098_11058372 | 3300015309 | Switchgrass Phyllosphere | TSSFVALADSDSISAHDNVNYLSGVDLSDYDLISCTNDGFVFVVLKPMDNRLNHLM* |
| Ga0182098_11291582 | 3300015309 | Switchgrass Phyllosphere | ALADSDSIGEYDNVKCLSGVDLSDYDLISYTKYGFVSAVLKPMDNRLNHLM* |
| Ga0182168_10371481 | 3300015312 | Switchgrass Phyllosphere | ISAHDNVKCLSGVDLSDYDLISCTKDGFVFAVLKPMDNRLNHLM* |
| Ga0182168_11104792 | 3300015312 | Switchgrass Phyllosphere | IVGTHDNIKCLSGLHLTGYDLISCTKEGFVSAVLKPMENRLHLLL* |
| Ga0182168_11285802 | 3300015312 | Switchgrass Phyllosphere | ADSEFVGAHDNIKCLSGLDLRDYDLISCTKEGFVSAVLKLIENWLHLLL* |
| Ga0182120_10803501 | 3300015315 | Switchgrass Phyllosphere | SFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSVVLKLMDNWLNHLM* |
| Ga0182120_11076692 | 3300015315 | Switchgrass Phyllosphere | DNIKCLSGVDLSDYDLISCTKDGFVFAVLKPMYNRLNHLM* |
| Ga0182120_11315691 | 3300015315 | Switchgrass Phyllosphere | HDNVKCLSGMDLSDYDLISYTKDGFVSIVLKPMDNQLNHLM* |
| Ga0182130_10823831 | 3300015319 | Switchgrass Phyllosphere | ALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNHLNHLM* |
| Ga0182130_11263722 | 3300015319 | Switchgrass Phyllosphere | HDNIKCLSGLDLTDYNLVSYTKEGFVSVVLKPMENQLHLLL* |
| Ga0182165_11073032 | 3300015320 | Switchgrass Phyllosphere | LDSISSHDNVKCLSGIDLSYYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0182148_10583662 | 3300015325 | Switchgrass Phyllosphere | IGAHDHIKCLSGLDLTDYDLISCTKEGFVSAVLKPMEN* |
| Ga0182148_11229681 | 3300015325 | Switchgrass Phyllosphere | IDSNTLGVHDDIKCLSGLDMSDFELISCTKDGFVSATLKPMENRLHCGK* |
| Ga0182148_11253672 | 3300015325 | Switchgrass Phyllosphere | DSDSISAHDNIKCLSGVDLSDYDLISCTKDGFVSAILKPINNRLKHLM* |
| Ga0182148_11257082 | 3300015325 | Switchgrass Phyllosphere | ANSNSIGANDNIKCLLSLDLSGYELISCTKDGFVPATLKPMKNWLNHLM* |
| Ga0182114_10688461 | 3300015327 | Switchgrass Phyllosphere | KCLSGVDLSDYDLISCTKDVFVSVVLKPMDNRLNHLM* |
| Ga0182114_10948532 | 3300015327 | Switchgrass Phyllosphere | SSLVAMADSDSIGAHDNVKCLLGVDLSDYDLISCTKNSFISAVLKLVDNRLNHLV* |
| Ga0182152_11519282 | 3300015330 | Switchgrass Phyllosphere | SDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM* |
| Ga0182131_11449271 | 3300015331 | Switchgrass Phyllosphere | SSGVDLSDYDLISYTKDGFVSAVLKPMDNRLNHLM* |
| Ga0182131_11519642 | 3300015331 | Switchgrass Phyllosphere | ELIGAHDHIKCLLGLDLTDYDLISCTKEGFVSAVLKPMENRLHLLL* |
| Ga0182117_10716601 | 3300015332 | Switchgrass Phyllosphere | SELIGAHDHIKCLSGLDLTDYDLISCPKEGFVSAALKPMENWLHLLL* |
| Ga0182117_11640612 | 3300015332 | Switchgrass Phyllosphere | MADSDSIGAHDNVKCLSGMDLSDYDLISYTKDGFVSIVLKPMDNQLNHLM* |
| Ga0182147_11683361 | 3300015333 | Switchgrass Phyllosphere | KCLSGVDLSDYDLISCTKDGFVSAVLKSMDNRLNHLM* |
| Ga0182132_11484072 | 3300015334 | Switchgrass Phyllosphere | SFVALADSDSISAHDNIKCLSGVDLSDYDLISYPKDGFVSVVLKPMDNRLNHLM* |
| Ga0182150_10976172 | 3300015336 | Switchgrass Phyllosphere | VALADSDSNSAHDNVKCLSGMDLSDYDLINCTKDGFVSIVLKPMDNRLNHLI* |
| Ga0182150_11416631 | 3300015336 | Switchgrass Phyllosphere | DSDFIGAHDYIQCLSCLDLFDYELISCTKDGFVSAVLKPMDNWLNHLM* |
| Ga0182137_11247142 | 3300015338 | Switchgrass Phyllosphere | ADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM* |
| Ga0182137_11589542 | 3300015338 | Switchgrass Phyllosphere | CLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM* |
| Ga0182137_11754272 | 3300015338 | Switchgrass Phyllosphere | ADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVFAVLKPMDNRLNHLI* |
| Ga0182149_11201121 | 3300015339 | Switchgrass Phyllosphere | LADSDSISAHDNVKFLSGVDLSDYDLISCTKDGFVSAVLKPM |
| Ga0182133_10711641 | 3300015340 | Switchgrass Phyllosphere | KCLSGVDLSDYDLISCTKDGFISAVLKPMDNRLNHLM* |
| Ga0182133_11441401 | 3300015340 | Switchgrass Phyllosphere | SDSISAHDNVKCLSGMDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM* |
| Ga0182115_11652891 | 3300015348 | Switchgrass Phyllosphere | SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDSFVSTILKPMDNRLNHLM* |
| Ga0182115_11728062 | 3300015348 | Switchgrass Phyllosphere | ALADSDSISAHDNVKCLSGLDLSDYDLISCTKEGFVSAVLKPMDNRLNHLM* |
| Ga0182115_12805563 | 3300015348 | Switchgrass Phyllosphere | LSGLDLTDYDMISCTKKGFVSAVLKPMENRLHLLL* |
| Ga0182115_12922942 | 3300015348 | Switchgrass Phyllosphere | LSGMDLSDYDLISCTKDGFVSTVLKPMDNRLNHLM* |
| Ga0182185_12189042 | 3300015349 | Switchgrass Phyllosphere | EHIKCLSGLDLSDYELISCTKDGFVPATLKPMENQLNHLILSR* |
| Ga0182185_12595602 | 3300015349 | Switchgrass Phyllosphere | MDDSDSIGAHDNVKCLSGMDLSDYDLISCTKDGFVSAVLKPMDNQLNHLM* |
| Ga0182163_12111492 | 3300015350 | Switchgrass Phyllosphere | GANDKINCLSGLDLSDYELISCTRDGFVPTTLKAMENRLNHLM* |
| Ga0182163_12722671 | 3300015350 | Switchgrass Phyllosphere | SISAHDNVKCLSGVDLSDYDLISCTKDCFISVVLKPMDNRLNHLI* |
| Ga0182163_12734792 | 3300015350 | Switchgrass Phyllosphere | ADSDSISAHDNVKCLSGVDLSDYNLISCAKDGFVSAILKPIDNQLNHLM* |
| Ga0182169_10991643 | 3300015352 | Switchgrass Phyllosphere | IGAHDNIKCLLGVDLSDYELISCTKDGFVSTVLNAMDNRLNHLI* |
| Ga0182169_11396481 | 3300015352 | Switchgrass Phyllosphere | NSIGANDNIKCLSGLDLSDYELISCTKEGFVHATLKPMENRLNHLML* |
| Ga0182169_11433183 | 3300015352 | Switchgrass Phyllosphere | AHDNIKCPYCLDLFDYELISCAKDSFVSAVLKPMDNWLNHLM* |
| Ga0182179_12458022 | 3300015353 | Switchgrass Phyllosphere | KCLSGVDLSDYDLISCTKDGFVSVVLKPTDNRLNHLL* |
| Ga0182179_12490212 | 3300015353 | Switchgrass Phyllosphere | KCLSGLDLSDYDLISCTKDGFVSAILKPMDNRLNHLM* |
| Ga0182179_12539412 | 3300015353 | Switchgrass Phyllosphere | VKCLSGVDLSDYDLISCTKDGFVSGILKPMDNRLNHLI* |
| Ga0182179_13140612 | 3300015353 | Switchgrass Phyllosphere | CLLDLDLTDYDLISCTKKGFVSAILKSKENRLHLLL* |
| Ga0182167_11464941 | 3300015354 | Switchgrass Phyllosphere | KCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLI* |
| Ga0182197_11228662 | 3300017408 | Switchgrass Phyllosphere | SSIVALADSDSISAHVIVKCLSGVDLSDYDLICCTKDGFVSTVLKPMDSRLNHLM |
| Ga0182195_11039851 | 3300017414 | Switchgrass Phyllosphere | KCLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM |
| Ga0182195_11380382 | 3300017414 | Switchgrass Phyllosphere | SAHDNVKCLSGVALSDYDLISCTKDSFVSAVLKPMDNRLNHLI |
| Ga0182195_11498531 | 3300017414 | Switchgrass Phyllosphere | DNVKCLSGMYLSDYDLISCTKDGFVYVVLKLMDNRLNHLM |
| Ga0182213_11657451 | 3300017421 | Switchgrass Phyllosphere | MADFDSIGAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNHLNHLM |
| Ga0182201_11269591 | 3300017422 | Switchgrass Phyllosphere | DTSSFVALADSDSISAHDHVKCLSGVDLSDYDLISCTKDDFVIAVLKPMDNRLNHLM |
| Ga0182196_11170142 | 3300017432 | Switchgrass Phyllosphere | AHDNVKCLSGVDLFDYDLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0182196_11491372 | 3300017432 | Switchgrass Phyllosphere | SIGAHDNIKCLSGLDLSDYELISCTKDGFVPATLKPMENRLNHLM |
| Ga0182196_11513452 | 3300017432 | Switchgrass Phyllosphere | VALADSDSISAHDNVKCLSGMDLSDYDLISCTKDGFVPAVLKPMNNRLNHLI |
| Ga0182194_11071451 | 3300017435 | Switchgrass Phyllosphere | SISAHDNVKCLSGVDLSDYDLISCTKNGFVSVVLKPMDNRLNHLM |
| Ga0182214_10533012 | 3300017440 | Switchgrass Phyllosphere | NSIGANDNIKCLSGLDLSDYELISYTKDGFVPATLKPMENRLNHLM |
| Ga0182198_10739613 | 3300017445 | Switchgrass Phyllosphere | DNVKCLSGVDLSDYDLISCTNDAFVFVVLKPMDNRLNHLM |
| Ga0182198_11345502 | 3300017445 | Switchgrass Phyllosphere | DNVKCLSGVDLSDYDLISCTKYGFVSTVLKPMDNRLNHLM |
| Ga0182215_10647851 | 3300017447 | Switchgrass Phyllosphere | SAHDNVKCLSGVDLSIYDLISCTKDGFVSVVLKPMDNRLNHLM |
| Ga0182215_10897792 | 3300017447 | Switchgrass Phyllosphere | LGVHDDIKCLSGLDLSDFELISCNKDGFVPATLKPMENRLHYCK |
| Ga0182215_11595462 | 3300017447 | Switchgrass Phyllosphere | TSFFVALADSDSVSAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPIDNRLNHLM |
| Ga0182212_11616032 | 3300017691 | Switchgrass Phyllosphere | AHDNVKCLSDVDLSDYDLINCTKDGFVSAVLKPMDNRLNHLI |
| Ga0182210_10770012 | 3300017692 | Switchgrass Phyllosphere | SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSVVLKPMDNRLNHLM |
| Ga0182210_11054742 | 3300017692 | Switchgrass Phyllosphere | LANSDSIGAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNQLNHLM |
| Ga0182210_11136621 | 3300017692 | Switchgrass Phyllosphere | NSSFAALADLGSISAHDNAKCLSGMDLSDYDLISCPTDCFVSAVLKLMDNRLNHLM |
| Ga0182216_11144592 | 3300017693 | Switchgrass Phyllosphere | SDSISAHDNVKCLSGVDLFYYDLISCTKDGFVSVVLKPMDNRLNHLM |
| Ga0163161_101999033 | 3300017792 | Switchgrass Rhizosphere | DNVKCLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM |
| Ga0207668_118124361 | 3300025972 | Switchgrass Rhizosphere | NIKCLSGLDLTDYDLISCAKEGFVSAVLKPMENRLHLLL |
| Ga0207641_116079821 | 3300026088 | Switchgrass Rhizosphere | VGAHDNIKCLSGLDLTDYDLISCTKEGFVSRILKPVENQLHLLL |
| Ga0207641_125293731 | 3300026088 | Switchgrass Rhizosphere | FVALADSDSIGKHDNIKCLSGVDLSDYDLISCTKDGFVFAVLKPMYNQLNHLM |
| Ga0207675_1017268421 | 3300026118 | Switchgrass Rhizosphere | AHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM |
| Ga0207675_1018859301 | 3300026118 | Switchgrass Rhizosphere | SFVALADSNSISAHDNVKCLSGVDLSDCDLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0268346_10312172 | 3300028053 | Phyllosphere | IGVNDDIKCLSGLDLFDYELISCTKDGFVPATLKPMENRLNHLI |
| Ga0268330_10283401 | 3300028056 | Phyllosphere | LANSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSVVLKPMDNRLKHLM |
| Ga0268342_10110443 | 3300028062 | Phyllosphere | ADSDSVSAHDNVKCLSGLDLSDYDLISCTKDGFVSAVLKLMDNRLNHLM |
| Ga0268264_119842073 | 3300028381 | Switchgrass Rhizosphere | ALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0268331_10085242 | 3300028474 | Phyllosphere | SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCSKDGFVSAVLKSMDNRLNHLM |
| Ga0214493_10701611 | 3300032465 | Switchgrass Phyllosphere | TSSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0214493_10798002 | 3300032465 | Switchgrass Phyllosphere | DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSSVLKPMDN |
| Ga0214503_11286211 | 3300032466 | Switchgrass Phyllosphere | SDSISAHDNVKYLSGVDLSDYDFISCTKDGFVSAILKPMDNRLNHLM |
| Ga0214490_10746912 | 3300032502 | Switchgrass Phyllosphere | ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM |
| Ga0214490_11126131 | 3300032502 | Switchgrass Phyllosphere | DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM |
| Ga0214490_11336362 | 3300032502 | Switchgrass Phyllosphere | MTDSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0321340_10257191 | 3300032550 | Switchgrass Phyllosphere | DNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM |
| Ga0321339_10431451 | 3300032551 | Switchgrass Phyllosphere | AHDNVKCLSGVDLSDYDLISCTKDGFLSAVLKLMDNRLNHLM |
| Ga0214499_12870562 | 3300032697 | Switchgrass Phyllosphere | AHDNIKSLSGLDLTDYDLISCTQEGFVSAVLKPMENRLHLLL |
| Ga0314753_10761581 | 3300032757 | Switchgrass Phyllosphere | DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSTVLKPMDNRLNHLM |
| Ga0314754_10320602 | 3300032760 | Switchgrass Phyllosphere | DNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM |
| Ga0314733_10796952 | 3300032761 | Switchgrass Phyllosphere | DSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM |
| Ga0314744_10793052 | 3300032792 | Switchgrass Phyllosphere | LADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM |
| Ga0314735_10464162 | 3300032824 | Switchgrass Phyllosphere | DSISAHDNVKCLSGVDLSDYDLISCTKHGFVSAILKPMDNRLNHLM |
| Ga0314721_1164601 | 3300032917 | Switchgrass Phyllosphere | NVKCLSGVDLSDYDFISCTKDGFVSAVIKPMDNRLNHLM |
| Ga0314741_11417762 | 3300032934 | Switchgrass Phyllosphere | SSFVGLADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFLFAVLKPMDNRLNHLM |
| Ga0314760_10593641 | 3300033530 | Switchgrass Phyllosphere | DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM |
| Ga0314756_11007742 | 3300033531 | Switchgrass Phyllosphere | VKCLSGVDLSDYDLISCTKDGFVSVVLKPVDNRLKHLM |
| Ga0314767_10549711 | 3300033532 | Switchgrass Phyllosphere | SDSISAHNNVKCLSGVDLYDYDLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0314759_11008151 | 3300033535 | Switchgrass Phyllosphere | ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM |
| Ga0314759_13010312 | 3300033535 | Switchgrass Phyllosphere | ADSDSISAHDNVKCLSDMDMSDYNLISCTKDGFVSAVLKPMDNRLNHLM |
| Ga0314759_13072542 | 3300033535 | Switchgrass Phyllosphere | DNVKCLSGVDLSDYDLISCTKDGFVSVVLKPVDNRLNHLM |
| Ga0314769_12434422 | 3300033542 | Switchgrass Phyllosphere | TSSFVALADSDSISARDNVKCLSGMDLSNYDLISCTKDGFVSAVLKPMDNRLNHLM |
| ⦗Top⦘ |