Metagenome / Metatranscriptome Family F060515

Basic Information
Family ID	F060515
Family Type	Metagenome / Metatranscriptome
Number of Sequences	132
Average Sequence Length	46 residues
Representative Sequence	ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM
Number of Associated Samples	83
Number of Associated Scaffolds	132

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	0.76 %
% of genes near scaffold ends (potentially truncated)	96.97 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	81
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Eukaryota (93.939 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (72.727 % of family members)
Environment Ontology (ENVO)	Unclassified (81.818 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (64.394 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 5.56% β-sheet: 13.89% Coil/Unstructured: 80.56%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 132 Family Scaffolds
PF00078	RVT_1	0.76
PF13650	Asp_protease_2	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	93.94 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	25.00 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	25.00 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	25.00 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	25.00 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	25.00 %
Unclassified	root	N/A	6.06 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	23.48 %
Unclassified	root	N/A	6.06 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	1.52 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	23.48 %
Unclassified	root	N/A	6.06 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	1.52 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	23.48 %
Unclassified	root	N/A	6.06 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	1.52 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	23.48 %
Unclassified	root	N/A	6.06 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	1.52 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	23.48 %
Unclassified	root	N/A	6.06 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	1.52 %

Name	Rank	Taxonomy	Distribution
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	9.09 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	6.06 %
Unclassified	root	N/A	6.06 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	1.52 %

Name	Rank	Taxonomy	Distribution
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	9.09 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	6.06 %
Unclassified	root	N/A	6.06 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	1.52 %

Name	Rank	Taxonomy	Distribution
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	9.09 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	6.06 %
Unclassified	root	N/A	6.06 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	1.52 %

Name	Rank	Taxonomy	Distribution
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	9.09 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	6.06 %
Unclassified	root	N/A	6.06 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	1.52 %

Name	Rank	Taxonomy	Distribution
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	9.09 %
Unclassified	root	N/A	6.06 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	5.30 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	1.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	6.06 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	5.30 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	1.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	6.06 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	5.30 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	1.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	6.06 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	5.30 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	1.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	6.06 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	5.30 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	1.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	6.06 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	5.30 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005347\|Ga0070668_101120982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	711	Open in IMG/M
3300005353\|Ga0070669_101702934	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	550	Open in IMG/M
3300005548\|Ga0070665_101073312	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	817	Open in IMG/M
3300005548\|Ga0070665_102106645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	568	Open in IMG/M
3300005549\|Ga0070704_101395468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	642	Open in IMG/M
3300005617\|Ga0068859_101385245	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	775	Open in IMG/M
3300005617\|Ga0068859_103125817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	504	Open in IMG/M
3300005842\|Ga0068858_101892226	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	589	Open in IMG/M
3300005843\|Ga0068860_102627254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	522	Open in IMG/M
3300009972\|Ga0105137_102584	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	763	Open in IMG/M
3300009976\|Ga0105128_116995	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	550	Open in IMG/M
3300009980\|Ga0105135_109465	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	728	Open in IMG/M
3300009981\|Ga0105133_109846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	712	Open in IMG/M
3300009989\|Ga0105131_141808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	513	Open in IMG/M
3300009989\|Ga0105131_143097	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	507	Open in IMG/M
3300009992\|Ga0105120_1026782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	666	Open in IMG/M
3300009994\|Ga0105126_1047180	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	541	Open in IMG/M
3300010373\|Ga0134128_11894832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	656	Open in IMG/M
3300010397\|Ga0134124_11006549	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	845	Open in IMG/M
3300010397\|Ga0134124_13063441	Not Available	511	Open in IMG/M
3300010400\|Ga0134122_12643737	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	553	Open in IMG/M
3300014325\|Ga0163163_11546528	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	725	Open in IMG/M
3300014968\|Ga0157379_12220855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	545	Open in IMG/M
3300014968\|Ga0157379_12415694	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	525	Open in IMG/M
3300014968\|Ga0157379_12631121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	504	Open in IMG/M
3300015270\|Ga0182183_1052981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	608	Open in IMG/M
3300015273\|Ga0182102_1020568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	628	Open in IMG/M
3300015297\|Ga0182104_1044915	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	710	Open in IMG/M
3300015309\|Ga0182098_1105837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	539	Open in IMG/M
3300015309\|Ga0182098_1129158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	501	Open in IMG/M
3300015312\|Ga0182168_1037148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	810	Open in IMG/M
3300015312\|Ga0182168_1110479	Not Available	548	Open in IMG/M
3300015312\|Ga0182168_1128580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	516	Open in IMG/M
3300015315\|Ga0182120_1080350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	623	Open in IMG/M
3300015315\|Ga0182120_1107669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	557	Open in IMG/M
3300015315\|Ga0182120_1131569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	514	Open in IMG/M
3300015319\|Ga0182130_1082383	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	609	Open in IMG/M
3300015319\|Ga0182130_1126372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	519	Open in IMG/M
3300015320\|Ga0182165_1107303	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	572	Open in IMG/M
3300015325\|Ga0182148_1058366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	706	Open in IMG/M
3300015325\|Ga0182148_1122968	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	538	Open in IMG/M
3300015325\|Ga0182148_1125367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	534	Open in IMG/M
3300015325\|Ga0182148_1125708	Not Available	533	Open in IMG/M
3300015327\|Ga0182114_1068846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	709	Open in IMG/M
3300015327\|Ga0182114_1094853	Not Available	628	Open in IMG/M
3300015330\|Ga0182152_1151928	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	506	Open in IMG/M
3300015331\|Ga0182131_1144927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	518	Open in IMG/M
3300015331\|Ga0182131_1151964	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508	Open in IMG/M
3300015332\|Ga0182117_1071660	Not Available	721	Open in IMG/M
3300015332\|Ga0182117_1164061	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	510	Open in IMG/M
3300015333\|Ga0182147_1168336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	504	Open in IMG/M
3300015334\|Ga0182132_1148407	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	532	Open in IMG/M
3300015336\|Ga0182150_1097617	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	624	Open in IMG/M
3300015336\|Ga0182150_1141663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	538	Open in IMG/M
3300015338\|Ga0182137_1124714	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	589	Open in IMG/M
3300015338\|Ga0182137_1158954	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	529	Open in IMG/M
3300015338\|Ga0182137_1175427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	506	Open in IMG/M
3300015339\|Ga0182149_1120112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	588	Open in IMG/M
3300015340\|Ga0182133_1071164	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	759	Open in IMG/M
3300015340\|Ga0182133_1144140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	571	Open in IMG/M
3300015348\|Ga0182115_1165289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	709	Open in IMG/M
3300015348\|Ga0182115_1172806	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	692	Open in IMG/M
3300015348\|Ga0182115_1280556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	527	Open in IMG/M
3300015348\|Ga0182115_1292294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	515	Open in IMG/M
3300015349\|Ga0182185_1218904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	577	Open in IMG/M
3300015349\|Ga0182185_1259560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	530	Open in IMG/M
3300015350\|Ga0182163_1211149	Not Available	608	Open in IMG/M
3300015350\|Ga0182163_1272267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	530	Open in IMG/M
3300015350\|Ga0182163_1273479	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	529	Open in IMG/M
3300015352\|Ga0182169_1099164	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	931	Open in IMG/M
3300015352\|Ga0182169_1139648	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	788	Open in IMG/M
3300015352\|Ga0182169_1143318	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	778	Open in IMG/M
3300015353\|Ga0182179_1245802	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	576	Open in IMG/M
3300015353\|Ga0182179_1249021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	573	Open in IMG/M
3300015353\|Ga0182179_1253941	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	567	Open in IMG/M
3300015353\|Ga0182179_1314061	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	511	Open in IMG/M
3300015354\|Ga0182167_1146494	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	871	Open in IMG/M
3300017408\|Ga0182197_1122866	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	545	Open in IMG/M
3300017414\|Ga0182195_1103985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	681	Open in IMG/M
3300017414\|Ga0182195_1138038	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	610	Open in IMG/M
3300017414\|Ga0182195_1149853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	591	Open in IMG/M
3300017421\|Ga0182213_1165745	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	625	Open in IMG/M
3300017422\|Ga0182201_1126959	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	527	Open in IMG/M
3300017432\|Ga0182196_1117014	Not Available	557	Open in IMG/M
3300017432\|Ga0182196_1149137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	511	Open in IMG/M
3300017432\|Ga0182196_1151345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	508	Open in IMG/M
3300017435\|Ga0182194_1107145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	577	Open in IMG/M
3300017440\|Ga0182214_1053301	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	813	Open in IMG/M
3300017445\|Ga0182198_1073961	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	738	Open in IMG/M
3300017445\|Ga0182198_1134550	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	592	Open in IMG/M
3300017447\|Ga0182215_1064785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	788	Open in IMG/M
3300017447\|Ga0182215_1089779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	679	Open in IMG/M
3300017447\|Ga0182215_1159546	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	523	Open in IMG/M
3300017691\|Ga0182212_1161603	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	511	Open in IMG/M
3300017692\|Ga0182210_1077001	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	704	Open in IMG/M
3300017692\|Ga0182210_1105474	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	609	Open in IMG/M
3300017692\|Ga0182210_1113662	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	588	Open in IMG/M
3300017693\|Ga0182216_1114459	Not Available	658	Open in IMG/M
3300017792\|Ga0163161_10199903	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1540	Open in IMG/M
3300025972\|Ga0207668_11812436	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	551	Open in IMG/M
3300026088\|Ga0207641_11607982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	652	Open in IMG/M
3300026088\|Ga0207641_12529373	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	512	Open in IMG/M
3300026118\|Ga0207675_101726842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	646	Open in IMG/M
3300026118\|Ga0207675_101885930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	616	Open in IMG/M
3300028053\|Ga0268346_1031217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	565	Open in IMG/M
3300028056\|Ga0268330_1028340	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	667	Open in IMG/M
3300028062\|Ga0268342_1011044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	795	Open in IMG/M
3300028381\|Ga0268264_11984207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	591	Open in IMG/M
3300028474\|Ga0268331_1008524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	724	Open in IMG/M
3300032465\|Ga0214493_1070161	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	833	Open in IMG/M
3300032465\|Ga0214493_1079800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	779	Open in IMG/M
3300032466\|Ga0214503_1128621	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	791	Open in IMG/M
3300032502\|Ga0214490_1074691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	776	Open in IMG/M
3300032502\|Ga0214490_1112613	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	620	Open in IMG/M
3300032502\|Ga0214490_1133636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563	Open in IMG/M
3300032550\|Ga0321340_1025719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	833	Open in IMG/M
3300032551\|Ga0321339_1043145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1018	Open in IMG/M
3300032697\|Ga0214499_1287056	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	506	Open in IMG/M
3300032757\|Ga0314753_1076158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	596	Open in IMG/M
3300032760\|Ga0314754_1032060	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	832	Open in IMG/M
3300032761\|Ga0314733_1079695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	623	Open in IMG/M
3300032792\|Ga0314744_1079305	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	631	Open in IMG/M
3300032824\|Ga0314735_1046416	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	822	Open in IMG/M
3300032917\|Ga0314721_116460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	788	Open in IMG/M
3300032934\|Ga0314741_1141776	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	539	Open in IMG/M
3300033530\|Ga0314760_1059364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	947	Open in IMG/M
3300033531\|Ga0314756_1100774	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	501	Open in IMG/M
3300033532\|Ga0314767_1054971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	970	Open in IMG/M
3300033535\|Ga0314759_1100815	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	907	Open in IMG/M
3300033535\|Ga0314759_1301031	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	506	Open in IMG/M
3300033535\|Ga0314759_1307254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	500	Open in IMG/M
3300033542\|Ga0314769_1243442	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	604	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.21%
Environmental	Environmental	3.79%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.21%
Terrestrial	Environmental → Terrestrial	3.79%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	75.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.58%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.06%
Unclassified	Host-Associated → Plants → Unclassified	6.06%
Soil	Environmental → Terrestrial → Soil	3.79%
Roots	Host-Associated → Plants → Roots	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	75.76%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.58%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	6.06%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.79%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.27%
Loam	Environmental → Terrestrial → Soil → Loam	0.76%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	75.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.58%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	6.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.79%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.76%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.76%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	72.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.82%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	6.06%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.03%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	3.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.27%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032550	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032917	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033531	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033532	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033542	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F060515

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070668_1011209821	3300005347	Switchgrass Rhizosphere	NDNIKCLSGLDLSDYELISCAKDGFVPATLKPMENRLNHLM*
Ga0070669_1017029342	3300005353	Switchgrass Rhizosphere	ALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0070665_1010733121	3300005548	Switchgrass Rhizosphere	HDNIKCLLGLDLTDYDLISCTKEGFVSAVLKPMENRLHLLL*
Ga0070665_1021066451	3300005548	Switchgrass Rhizosphere	TSSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM*
Ga0070704_1013954682	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNQLNHLM*
Ga0068859_1013852451	3300005617	Switchgrass Rhizosphere	SISAHDNVKCLSGVDLSDYDLISCTKDGFVSAILKPMDNGLNHLM*
Ga0068859_1031258172	3300005617	Switchgrass Rhizosphere	AHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM*
Ga0068858_1018922262	3300005842	Switchgrass Rhizosphere	ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0068860_1026272542	3300005843	Switchgrass Rhizosphere	VKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM*
Ga0105137_1025842	3300009972	Switchgrass Associated	FVALADSDSISAHDNVMCLSGVDLSDYDLISCTKDGFVSAVLKSMDNRLNHLM*
Ga0105128_1169951	3300009976	Switchgrass Associated	IKCLSDLDLTDYDLISCTKEGIVSAVLKPMENRLHLLL*
Ga0105135_1094652	3300009980	Switchgrass Associated	NSAHDNVKCLSGVDLSDYDLISCTKDGFVSTVLKPMDNRLNHLM*
Ga0105133_1098461	3300009981	Switchgrass Associated	KCLSGVDLSDYDLISCTKDGFVSAVLKPMNNWLNHLM*
Ga0105131_1418082	3300009989	Switchgrass Associated	FVALADSDSISAHDNVKCLSGVDLSDYDLISCTNDGFVFVVLKSMDNRLNHLM*
Ga0105131_1430972	3300009989	Switchgrass Associated	SAHDNVKCLSGMDLSDYNLISCTKDGFVFAVLKPMDNRLNHLM*
Ga0105120_10267822	3300009992	Switchgrass Associated	TSSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0105126_10471802	3300009994	Switchgrass Associated	ISAHDNVKCLSGMDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM*
Ga0134128_118948321	3300010373	Terrestrial Soil	IKCLSGVDQSDYDLISFTKDGFVSAVLKPMDNWLNHLM*
Ga0134124_110065492	3300010397	Terrestrial Soil	SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM*
Ga0134124_130634411	3300010397	Terrestrial Soil	DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0134122_126437372	3300010400	Terrestrial Soil	SSFVALIDWDSISAHDNVKCLSGVDLSDYDLFSCTKDGFVSAVLKPMDNWLNHLM*
Ga0163163_115465282	3300014325	Switchgrass Rhizosphere	ADSNSIGANDNVKCLSGLDLSNYDFISCTKEGFVPATLKPMENRLNHLML*
Ga0157379_122208551	3300014968	Switchgrass Rhizosphere	LGVHDDIKCLSGLDLSDFELISCIKDGFVPATLKPMENRLHYCK*
Ga0157379_124156943	3300014968	Switchgrass Rhizosphere	ELIGAHDHIKCLSGLDLTDYDLISCTKEGFVSAVLKPMENRLQLLL*
Ga0157379_126311211	3300014968	Switchgrass Rhizosphere	VKCLSGVDLSDYDLISCNKDGFVFAVLKSMDNRLNHLM*
Ga0182183_10529811	3300015270	Switchgrass Phyllosphere	NIKCLSSLDLTDYDLINCTKEGFVSVVLKPMENWLHLLL*
Ga0182102_10205682	3300015273	Switchgrass Phyllosphere	DNFKCLSGLDLTDYDLINCTKEGFVSAVLKPMENRLYLLL*
Ga0182104_10449152	3300015297	Switchgrass Phyllosphere	LLGVDLFGYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0182098_11058372	3300015309	Switchgrass Phyllosphere	TSSFVALADSDSISAHDNVNYLSGVDLSDYDLISCTNDGFVFVVLKPMDNRLNHLM*
Ga0182098_11291582	3300015309	Switchgrass Phyllosphere	ALADSDSIGEYDNVKCLSGVDLSDYDLISYTKYGFVSAVLKPMDNRLNHLM*
Ga0182168_10371481	3300015312	Switchgrass Phyllosphere	ISAHDNVKCLSGVDLSDYDLISCTKDGFVFAVLKPMDNRLNHLM*
Ga0182168_11104792	3300015312	Switchgrass Phyllosphere	IVGTHDNIKCLSGLHLTGYDLISCTKEGFVSAVLKPMENRLHLLL*
Ga0182168_11285802	3300015312	Switchgrass Phyllosphere	ADSEFVGAHDNIKCLSGLDLRDYDLISCTKEGFVSAVLKLIENWLHLLL*
Ga0182120_10803501	3300015315	Switchgrass Phyllosphere	SFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSVVLKLMDNWLNHLM*
Ga0182120_11076692	3300015315	Switchgrass Phyllosphere	DNIKCLSGVDLSDYDLISCTKDGFVFAVLKPMYNRLNHLM*
Ga0182120_11315691	3300015315	Switchgrass Phyllosphere	HDNVKCLSGMDLSDYDLISYTKDGFVSIVLKPMDNQLNHLM*
Ga0182130_10823831	3300015319	Switchgrass Phyllosphere	ALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNHLNHLM*
Ga0182130_11263722	3300015319	Switchgrass Phyllosphere	HDNIKCLSGLDLTDYNLVSYTKEGFVSVVLKPMENQLHLLL*
Ga0182165_11073032	3300015320	Switchgrass Phyllosphere	LDSISSHDNVKCLSGIDLSYYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0182148_10583662	3300015325	Switchgrass Phyllosphere	IGAHDHIKCLSGLDLTDYDLISCTKEGFVSAVLKPMEN*
Ga0182148_11229681	3300015325	Switchgrass Phyllosphere	IDSNTLGVHDDIKCLSGLDMSDFELISCTKDGFVSATLKPMENRLHCGK*
Ga0182148_11253672	3300015325	Switchgrass Phyllosphere	DSDSISAHDNIKCLSGVDLSDYDLISCTKDGFVSAILKPINNRLKHLM*
Ga0182148_11257082	3300015325	Switchgrass Phyllosphere	ANSNSIGANDNIKCLLSLDLSGYELISCTKDGFVPATLKPMKNWLNHLM*
Ga0182114_10688461	3300015327	Switchgrass Phyllosphere	KCLSGVDLSDYDLISCTKDVFVSVVLKPMDNRLNHLM*
Ga0182114_10948532	3300015327	Switchgrass Phyllosphere	SSLVAMADSDSIGAHDNVKCLLGVDLSDYDLISCTKNSFISAVLKLVDNRLNHLV*
Ga0182152_11519282	3300015330	Switchgrass Phyllosphere	SDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM*
Ga0182131_11449271	3300015331	Switchgrass Phyllosphere	SSGVDLSDYDLISYTKDGFVSAVLKPMDNRLNHLM*
Ga0182131_11519642	3300015331	Switchgrass Phyllosphere	ELIGAHDHIKCLLGLDLTDYDLISCTKEGFVSAVLKPMENRLHLLL*
Ga0182117_10716601	3300015332	Switchgrass Phyllosphere	SELIGAHDHIKCLSGLDLTDYDLISCPKEGFVSAALKPMENWLHLLL*
Ga0182117_11640612	3300015332	Switchgrass Phyllosphere	MADSDSIGAHDNVKCLSGMDLSDYDLISYTKDGFVSIVLKPMDNQLNHLM*
Ga0182147_11683361	3300015333	Switchgrass Phyllosphere	KCLSGVDLSDYDLISCTKDGFVSAVLKSMDNRLNHLM*
Ga0182132_11484072	3300015334	Switchgrass Phyllosphere	SFVALADSDSISAHDNIKCLSGVDLSDYDLISYPKDGFVSVVLKPMDNRLNHLM*
Ga0182150_10976172	3300015336	Switchgrass Phyllosphere	VALADSDSNSAHDNVKCLSGMDLSDYDLINCTKDGFVSIVLKPMDNRLNHLI*
Ga0182150_11416631	3300015336	Switchgrass Phyllosphere	DSDFIGAHDYIQCLSCLDLFDYELISCTKDGFVSAVLKPMDNWLNHLM*
Ga0182137_11247142	3300015338	Switchgrass Phyllosphere	ADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM*
Ga0182137_11589542	3300015338	Switchgrass Phyllosphere	CLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM*
Ga0182137_11754272	3300015338	Switchgrass Phyllosphere	ADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVFAVLKPMDNRLNHLI*
Ga0182149_11201121	3300015339	Switchgrass Phyllosphere	LADSDSISAHDNVKFLSGVDLSDYDLISCTKDGFVSAVLKPM
Ga0182133_10711641	3300015340	Switchgrass Phyllosphere	KCLSGVDLSDYDLISCTKDGFISAVLKPMDNRLNHLM*
Ga0182133_11441401	3300015340	Switchgrass Phyllosphere	SDSISAHDNVKCLSGMDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM*
Ga0182115_11652891	3300015348	Switchgrass Phyllosphere	SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDSFVSTILKPMDNRLNHLM*
Ga0182115_11728062	3300015348	Switchgrass Phyllosphere	ALADSDSISAHDNVKCLSGLDLSDYDLISCTKEGFVSAVLKPMDNRLNHLM*
Ga0182115_12805563	3300015348	Switchgrass Phyllosphere	LSGLDLTDYDMISCTKKGFVSAVLKPMENRLHLLL*
Ga0182115_12922942	3300015348	Switchgrass Phyllosphere	LSGMDLSDYDLISCTKDGFVSTVLKPMDNRLNHLM*
Ga0182185_12189042	3300015349	Switchgrass Phyllosphere	EHIKCLSGLDLSDYELISCTKDGFVPATLKPMENQLNHLILSR*
Ga0182185_12595602	3300015349	Switchgrass Phyllosphere	MDDSDSIGAHDNVKCLSGMDLSDYDLISCTKDGFVSAVLKPMDNQLNHLM*
Ga0182163_12111492	3300015350	Switchgrass Phyllosphere	GANDKINCLSGLDLSDYELISCTRDGFVPTTLKAMENRLNHLM*
Ga0182163_12722671	3300015350	Switchgrass Phyllosphere	SISAHDNVKCLSGVDLSDYDLISCTKDCFISVVLKPMDNRLNHLI*
Ga0182163_12734792	3300015350	Switchgrass Phyllosphere	ADSDSISAHDNVKCLSGVDLSDYNLISCAKDGFVSAILKPIDNQLNHLM*
Ga0182169_10991643	3300015352	Switchgrass Phyllosphere	IGAHDNIKCLLGVDLSDYELISCTKDGFVSTVLNAMDNRLNHLI*
Ga0182169_11396481	3300015352	Switchgrass Phyllosphere	NSIGANDNIKCLSGLDLSDYELISCTKEGFVHATLKPMENRLNHLML*
Ga0182169_11433183	3300015352	Switchgrass Phyllosphere	AHDNIKCPYCLDLFDYELISCAKDSFVSAVLKPMDNWLNHLM*
Ga0182179_12458022	3300015353	Switchgrass Phyllosphere	KCLSGVDLSDYDLISCTKDGFVSVVLKPTDNRLNHLL*
Ga0182179_12490212	3300015353	Switchgrass Phyllosphere	KCLSGLDLSDYDLISCTKDGFVSAILKPMDNRLNHLM*
Ga0182179_12539412	3300015353	Switchgrass Phyllosphere	VKCLSGVDLSDYDLISCTKDGFVSGILKPMDNRLNHLI*
Ga0182179_13140612	3300015353	Switchgrass Phyllosphere	CLLDLDLTDYDLISCTKKGFVSAILKSKENRLHLLL*
Ga0182167_11464941	3300015354	Switchgrass Phyllosphere	KCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLI*
Ga0182197_11228662	3300017408	Switchgrass Phyllosphere	SSIVALADSDSISAHVIVKCLSGVDLSDYDLICCTKDGFVSTVLKPMDSRLNHLM
Ga0182195_11039851	3300017414	Switchgrass Phyllosphere	KCLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM
Ga0182195_11380382	3300017414	Switchgrass Phyllosphere	SAHDNVKCLSGVALSDYDLISCTKDSFVSAVLKPMDNRLNHLI
Ga0182195_11498531	3300017414	Switchgrass Phyllosphere	DNVKCLSGMYLSDYDLISCTKDGFVYVVLKLMDNRLNHLM
Ga0182213_11657451	3300017421	Switchgrass Phyllosphere	MADFDSIGAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNHLNHLM
Ga0182201_11269591	3300017422	Switchgrass Phyllosphere	DTSSFVALADSDSISAHDHVKCLSGVDLSDYDLISCTKDDFVIAVLKPMDNRLNHLM
Ga0182196_11170142	3300017432	Switchgrass Phyllosphere	AHDNVKCLSGVDLFDYDLISCTKDGFVSAVLKPMDNRLNHLM
Ga0182196_11491372	3300017432	Switchgrass Phyllosphere	SIGAHDNIKCLSGLDLSDYELISCTKDGFVPATLKPMENRLNHLM
Ga0182196_11513452	3300017432	Switchgrass Phyllosphere	VALADSDSISAHDNVKCLSGMDLSDYDLISCTKDGFVPAVLKPMNNRLNHLI
Ga0182194_11071451	3300017435	Switchgrass Phyllosphere	SISAHDNVKCLSGVDLSDYDLISCTKNGFVSVVLKPMDNRLNHLM
Ga0182214_10533012	3300017440	Switchgrass Phyllosphere	NSIGANDNIKCLSGLDLSDYELISYTKDGFVPATLKPMENRLNHLM
Ga0182198_10739613	3300017445	Switchgrass Phyllosphere	DNVKCLSGVDLSDYDLISCTNDAFVFVVLKPMDNRLNHLM
Ga0182198_11345502	3300017445	Switchgrass Phyllosphere	DNVKCLSGVDLSDYDLISCTKYGFVSTVLKPMDNRLNHLM
Ga0182215_10647851	3300017447	Switchgrass Phyllosphere	SAHDNVKCLSGVDLSIYDLISCTKDGFVSVVLKPMDNRLNHLM
Ga0182215_10897792	3300017447	Switchgrass Phyllosphere	LGVHDDIKCLSGLDLSDFELISCNKDGFVPATLKPMENRLHYCK
Ga0182215_11595462	3300017447	Switchgrass Phyllosphere	TSFFVALADSDSVSAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPIDNRLNHLM
Ga0182212_11616032	3300017691	Switchgrass Phyllosphere	AHDNVKCLSDVDLSDYDLINCTKDGFVSAVLKPMDNRLNHLI
Ga0182210_10770012	3300017692	Switchgrass Phyllosphere	SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSVVLKPMDNRLNHLM
Ga0182210_11054742	3300017692	Switchgrass Phyllosphere	LANSDSIGAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNQLNHLM
Ga0182210_11136621	3300017692	Switchgrass Phyllosphere	NSSFAALADLGSISAHDNAKCLSGMDLSDYDLISCPTDCFVSAVLKLMDNRLNHLM
Ga0182216_11144592	3300017693	Switchgrass Phyllosphere	SDSISAHDNVKCLSGVDLFYYDLISCTKDGFVSVVLKPMDNRLNHLM
Ga0163161_101999033	3300017792	Switchgrass Rhizosphere	DNVKCLSGVDLSDYDLISCTKDGFVSAILKPMDNRLNHLM
Ga0207668_118124361	3300025972	Switchgrass Rhizosphere	NIKCLSGLDLTDYDLISCAKEGFVSAVLKPMENRLHLLL
Ga0207641_116079821	3300026088	Switchgrass Rhizosphere	VGAHDNIKCLSGLDLTDYDLISCTKEGFVSRILKPVENQLHLLL
Ga0207641_125293731	3300026088	Switchgrass Rhizosphere	FVALADSDSIGKHDNIKCLSGVDLSDYDLISCTKDGFVFAVLKPMYNQLNHLM
Ga0207675_1017268421	3300026118	Switchgrass Rhizosphere	AHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM
Ga0207675_1018859301	3300026118	Switchgrass Rhizosphere	SFVALADSNSISAHDNVKCLSGVDLSDCDLISCTKDGFVSAVLKPMDNRLNHLM
Ga0268346_10312172	3300028053	Phyllosphere	IGVNDDIKCLSGLDLFDYELISCTKDGFVPATLKPMENRLNHLI
Ga0268330_10283401	3300028056	Phyllosphere	LANSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSVVLKPMDNRLKHLM
Ga0268342_10110443	3300028062	Phyllosphere	ADSDSVSAHDNVKCLSGLDLSDYDLISCTKDGFVSAVLKLMDNRLNHLM
Ga0268264_119842073	3300028381	Switchgrass Rhizosphere	ALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM
Ga0268331_10085242	3300028474	Phyllosphere	SSFVALADSDSISAHDNVKCLSGVDLSDYDLISCSKDGFVSAVLKSMDNRLNHLM
Ga0214493_10701611	3300032465	Switchgrass Phyllosphere	TSSFVALADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM
Ga0214493_10798002	3300032465	Switchgrass Phyllosphere	DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSSVLKPMDN
Ga0214503_11286211	3300032466	Switchgrass Phyllosphere	SDSISAHDNVKYLSGVDLSDYDFISCTKDGFVSAILKPMDNRLNHLM
Ga0214490_10746912	3300032502	Switchgrass Phyllosphere	ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM
Ga0214490_11126131	3300032502	Switchgrass Phyllosphere	DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM
Ga0214490_11336362	3300032502	Switchgrass Phyllosphere	MTDSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMDNRLNHLM
Ga0321340_10257191	3300032550	Switchgrass Phyllosphere	DNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM
Ga0321339_10431451	3300032551	Switchgrass Phyllosphere	AHDNVKCLSGVDLSDYDLISCTKDGFLSAVLKLMDNRLNHLM
Ga0214499_12870562	3300032697	Switchgrass Phyllosphere	AHDNIKSLSGLDLTDYDLISCTQEGFVSAVLKPMENRLHLLL
Ga0314753_10761581	3300032757	Switchgrass Phyllosphere	DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSTVLKPMDNRLNHLM
Ga0314754_10320602	3300032760	Switchgrass Phyllosphere	DNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM
Ga0314733_10796952	3300032761	Switchgrass Phyllosphere	DSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM
Ga0314744_10793052	3300032792	Switchgrass Phyllosphere	LADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM
Ga0314735_10464162	3300032824	Switchgrass Phyllosphere	DSISAHDNVKCLSGVDLSDYDLISCTKHGFVSAILKPMDNRLNHLM
Ga0314721_1164601	3300032917	Switchgrass Phyllosphere	NVKCLSGVDLSDYDFISCTKDGFVSAVIKPMDNRLNHLM
Ga0314741_11417762	3300032934	Switchgrass Phyllosphere	SSFVGLADSDSISAHDNVKCLSGVDLSDYDLISCTKDGFLFAVLKPMDNRLNHLM
Ga0314760_10593641	3300033530	Switchgrass Phyllosphere	DSISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNRLNHLM
Ga0314756_11007742	3300033531	Switchgrass Phyllosphere	VKCLSGVDLSDYDLISCTKDGFVSVVLKPVDNRLKHLM
Ga0314767_10549711	3300033532	Switchgrass Phyllosphere	SDSISAHNNVKCLSGVDLYDYDLISCTKDGFVSAVLKPMDNRLNHLM
Ga0314759_11008151	3300033535	Switchgrass Phyllosphere	ISAHDNVKCLSGVDLSDYDLISCTKDGFVSAVLKPMNNQLNHLM
Ga0314759_13010312	3300033535	Switchgrass Phyllosphere	ADSDSISAHDNVKCLSDMDMSDYNLISCTKDGFVSAVLKPMDNRLNHLM
Ga0314759_13072542	3300033535	Switchgrass Phyllosphere	DNVKCLSGVDLSDYDLISCTKDGFVSVVLKPVDNRLNHLM
Ga0314769_12434422	3300033542	Switchgrass Phyllosphere	TSSFVALADSDSISARDNVKCLSGMDLSNYDLISCTKDGFVSAVLKPMDNRLNHLM

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign