Metagenome Family F060486

Overview

Basic Information

• Family ID: F060486
• Family Type: Metagenome
• Number of Sequences: 132
• Average Sequence Length: 40 residues
• Representative Sequence: YLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN
• Number of Associated Samples: 62
• Number of Associated Scaffolds: 132

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.78 %
• % of genes near scaffold ends (potentially truncated): 96.21 %
• % of genes from short scaffolds (< 2000 bps): 96.97 %
• Associated GOLD sequencing projects: 62
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (95.455 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.212 % of family members)
• Environment Ontology (ENVO): Unclassified (96.212 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (96.212 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 46.97%
  β-sheet: 0.00%
  Coil/Unstructured: 53.03%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
All Organisms	root	All Organisms	4.55 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
cellular organisms	root	All Organisms → cellular organisms	4.55 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	4.55 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3.79 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3.79 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	3.79 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3.79 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.27 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.27 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.27 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.27 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.27 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	2.27 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	2.27 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	2.27 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	2.27 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2.27 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.76 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.76 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.76 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	95.45 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.76 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005334|Ga0068869_101208723	Not Available	664
3300005459|Ga0068867_101934681	Not Available	556
3300013297|Ga0157378_11704212	Not Available	677
3300013308|Ga0157375_12802118	Not Available	583
3300014745|Ga0157377_11513764	Not Available	534
3300015267|Ga0182122_1067464	Not Available	513
3300015268|Ga0182154_1008558	Not Available	895
3300015269|Ga0182113_1035400	Not Available	681
3300015274|Ga0182188_1026754	Not Available	627
3300015276|Ga0182170_1039727	Not Available	611
3300015277|Ga0182128_1034677	Not Available	639
3300015277|Ga0182128_1035312	Not Available	635
3300015281|Ga0182160_1061437	Not Available	552
3300015282|Ga0182124_1039640	Not Available	622
3300015285|Ga0182186_1047279	Not Available	595
3300015287|Ga0182171_1016263	Not Available	809
3300015287|Ga0182171_1028060	Not Available	699
3300015287|Ga0182171_1039731	Not Available	636
3300015289|Ga0182138_1041891	Not Available	628
3300015289|Ga0182138_1048183	Not Available	603
3300015291|Ga0182125_1045699	Not Available	625
3300015291|Ga0182125_1048384	Not Available	614
3300015292|Ga0182141_1035253	Not Available	671
3300015292|Ga0182141_1042732	Not Available	635
3300015292|Ga0182141_1066412	Not Available	559
3300015292|Ga0182141_1091107	Not Available	508
3300015294|Ga0182126_1057844	Not Available	586
3300015296|Ga0182157_1037760	Not Available	678
3300015296|Ga0182157_1070068	Not Available	567
3300015296|Ga0182157_1070105	Not Available	566
3300015298|Ga0182106_1018347	Not Available	835
3300015299|Ga0182107_1013543	Not Available	911
3300015299|Ga0182107_1044674	Not Available	651
3300015299|Ga0182107_1084542	Not Available	537
3300015300|Ga0182108_1035191	Not Available	702
3300015302|Ga0182143_1023512	Not Available	778
3300015302|Ga0182143_1041475	Not Available	664
3300015302|Ga0182143_1065987	Not Available	580
3300015302|Ga0182143_1103315	Not Available	504
3300015303|Ga0182123_1002302	Not Available	1403
3300015303|Ga0182123_1030249	Not Available	705
3300015303|Ga0182123_1067804	Not Available	563
3300015304|Ga0182112_1039897	Not Available	672
3300015304|Ga0182112_1078622	Not Available	552
3300015305|Ga0182158_1003709	Not Available	1275
3300015307|Ga0182144_1009776	Not Available	1007
3300015308|Ga0182142_1061346	Not Available	612
3300015308|Ga0182142_1069925	Not Available	588
3300015314|Ga0182140_1019900	Not Available	846
3300015314|Ga0182140_1027945	Not Available	769
3300015314|Ga0182140_1065583	Not Available	601
3300015322|Ga0182110_1078587	Not Available	582
3300015323|Ga0182129_1005416	Not Available	1211
3300015323|Ga0182129_1023137	Not Available	810
3300015323|Ga0182129_1066650	Not Available	595
3300015323|Ga0182129_1079637	Not Available	565
3300015341|Ga0182187_1047131	Not Available	833
3300015341|Ga0182187_1084730	Not Available	683
3300015341|Ga0182187_1113568	Not Available	618
3300015341|Ga0182187_1141034	Not Available	572
3300015341|Ga0182187_1187489	Not Available	515
3300015342|Ga0182109_1033648	Not Available	995
3300015342|Ga0182109_1116931	Not Available	642
3300015342|Ga0182109_1128856	Not Available	620
3300015343|Ga0182155_1061266	Not Available	800
3300015343|Ga0182155_1070504	Not Available	763
3300015343|Ga0182155_1074330	Not Available	749
3300015344|Ga0182189_1106321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	670
3300015344|Ga0182189_1206930	Not Available	523
3300015344|Ga0182189_1220669	Not Available	509
3300015344|Ga0182189_1225083	Not Available	505
3300015345|Ga0182111_1104972	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	696
3300015345|Ga0182111_1123940	Not Available	654
3300015345|Ga0182111_1129856	Not Available	643
3300015345|Ga0182111_1190650	Not Available	554
3300015345|Ga0182111_1245858	Not Available	501
3300015346|Ga0182139_1060319	Not Available	852
3300015346|Ga0182139_1079795	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	770
3300015346|Ga0182139_1114019	Not Available	675
3300015346|Ga0182139_1114257	Not Available	675
3300015347|Ga0182177_1029483	Not Available	1101
3300015347|Ga0182177_1152557	Not Available	608
3300015351|Ga0182161_1162699	Not Available	614
3300015351|Ga0182161_1241539	Not Available	524
3300015355|Ga0182159_1081486	Not Available	932
3300015355|Ga0182159_1149470	Not Available	727
3300015355|Ga0182159_1178714	Not Available	674
3300015355|Ga0182159_1281441	Not Available	554
3300015355|Ga0182159_1329625	Not Available	516
3300015355|Ga0182159_1345257	Not Available	506
3300015361|Ga0182145_1177579	Not Available	518
3300015361|Ga0182145_1182181	Not Available	514
3300015361|Ga0182145_1189484	Not Available	507
3300017404|Ga0182203_1071369	Not Available	659
3300017407|Ga0182220_1036093	Not Available	683
3300017409|Ga0182204_1105337	Not Available	523
3300017411|Ga0182208_1112589	Not Available	525
3300017413|Ga0182222_1015672	Not Available	825
3300017413|Ga0182222_1036676	Not Available	666
3300017415|Ga0182202_1106348	Not Available	549
3300017420|Ga0182228_1065488	All Organisms → cellular organisms → Eukaryota	644
3300017420|Ga0182228_1101299	Not Available	550
3300017424|Ga0182219_1015120	Not Available	1015
3300017424|Ga0182219_1113437	Not Available	538
3300017424|Ga0182219_1115608	Not Available	535
3300017425|Ga0182224_1120482	Not Available	558
3300017425|Ga0182224_1165561	Not Available	502
3300017427|Ga0182190_1074743	Not Available	659
3300017427|Ga0182190_1112389	Not Available	574
3300017430|Ga0182192_1039678	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	831
3300017430|Ga0182192_1075265	Not Available	671
3300017436|Ga0182209_1020378	Not Available	976
3300017436|Ga0182209_1151750	Not Available	525
3300017438|Ga0182191_1022178	Not Available	996
3300017438|Ga0182191_1083529	Not Available	655
3300017438|Ga0182191_1089798	Not Available	639
3300017438|Ga0182191_1135835	Not Available	557
3300017438|Ga0182191_1172152	Not Available	513
3300017682|Ga0182229_1062044	Not Available	637
3300017683|Ga0182218_1032000	Not Available	808
3300017683|Ga0182218_1062077	Not Available	665
3300017684|Ga0182225_1026013	Not Available	856
3300017685|Ga0182227_1098522	Not Available	567
3300017686|Ga0182205_1056655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	727
3300017686|Ga0182205_1116637	Not Available	574
3300017690|Ga0182223_1002269	Not Available	1477
3300017690|Ga0182223_1011449	Not Available	957
3300017690|Ga0182223_1040696	Not Available	684

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.21%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.52%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.27%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.52%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.27%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.52%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.27%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.52%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1012087231	3300005334	Miscanthus Rhizosphere	KKLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0068867_1019346811	3300005459	Miscanthus Rhizosphere	KKLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0157378_117042121	3300013297	Miscanthus Rhizosphere	RMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0157375_128021181	3300013308	Miscanthus Rhizosphere	LSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0157377_115137641	3300014745	Miscanthus Rhizosphere	HRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182122_10674641	3300015267	Miscanthus Phyllosphere	HRMFVVYVWSIKYRRKDKLITQFGGKLRDEHFEPN*
Ga0182154_10085581	3300015268	Miscanthus Phyllosphere	HRMFAARAWSIKCRRKEKLITQFDKKLRDERFKPN*
Ga0182113_10354001	3300015269	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFESN*
Ga0182188_10267542	3300015274	Miscanthus Phyllosphere	YLSHRMFTAHAWSIKCRRKEKLIAQFCGKLRDERFEPN*
Ga0182170_10397272	3300015276	Miscanthus Phyllosphere	YLSHRMFAVCAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182128_10346771	3300015277	Miscanthus Phyllosphere	TPKSKKLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182128_10353121	3300015277	Miscanthus Phyllosphere	YLLHRMFTARAWSIKYRRKDKLIAQFDKKLRDKRFEPN*
Ga0182160_10614371	3300015281	Miscanthus Phyllosphere	RMFTARVWSIKYKQKEKLITQFDEKLRDERFKPN*
Ga0182124_10396401	3300015282	Miscanthus Phyllosphere	SHRMFAAYAWSIKCRRKKKLIAQFGGKLRDERFKPN*
Ga0182186_10472791	3300015285	Miscanthus Phyllosphere	PSHRIFAARAWSIKYRRKKLIAQFGGKLRDKRFEPN*
Ga0182171_10162631	3300015287	Miscanthus Phyllosphere	LQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDKRFEPN*
Ga0182171_10280601	3300015287	Miscanthus Phyllosphere	KKLLQYLSHRMFVVHAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182171_10397311	3300015287	Miscanthus Phyllosphere	SHRMFAAYAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182138_10418911	3300015289	Miscanthus Phyllosphere	QYLSHRMFAARVWSIKCRRKEKLIAQLGGKLRDERFKPN*
Ga0182138_10481831	3300015289	Miscanthus Phyllosphere	RRIFAVHVWNIKCRRKDKLITQFGGKLRDERFKPN*
Ga0182125_10456991	3300015291	Miscanthus Phyllosphere	YLSHRMFTACAWSIKCRRKEKLITQFGEKLRDERFEPN*
Ga0182125_10483841	3300015291	Miscanthus Phyllosphere	LSHRTFSAHIWSIKYRRKKKLIAQFGGKLRGERFKPN*
Ga0182141_10352531	3300015292	Miscanthus Phyllosphere	YLSHRMFAVRAWSIKCRRKEKLIAQFGEKLRDERFKPN*
Ga0182141_10427321	3300015292	Miscanthus Phyllosphere	SKKLLQYLSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFESN*
Ga0182141_10664121	3300015292	Miscanthus Phyllosphere	RMFAAHAWSIKCRRKEKLIAQFGGKLRVERFEPN*
Ga0182141_10911071	3300015292	Miscanthus Phyllosphere	LQYLSHRMFAVRVWNIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182126_10578441	3300015294	Miscanthus Phyllosphere	QYISHRMFTARVWSIKYRRKIKLIAQFGGKLRDGRFEPN*
Ga0182157_10377603	3300015296	Miscanthus Phyllosphere	LLQYLSHRMFAVRAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182157_10700681	3300015296	Miscanthus Phyllosphere	LSHRMFTAHAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182157_10701051	3300015296	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182106_10183471	3300015298	Miscanthus Phyllosphere	LSYRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182107_10135431	3300015299	Miscanthus Phyllosphere	LTSKKLLQYLSHRMFTARAWSIKYRRKEKLIAQFDGKLRDERFEPN*
Ga0182107_10446741	3300015299	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182107_10845421	3300015299	Miscanthus Phyllosphere	LSHRMFAVRAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182108_10351911	3300015300	Miscanthus Phyllosphere	KLLQYLSHRMFTVRAWSIKCRRKEKLIAQFGGKLRDERFEHN*
Ga0182143_10235122	3300015302	Miscanthus Phyllosphere	LQYLSHRIFAAYAWSIKCRRKKKLIAQLGGKLRDERFEPN*
Ga0182143_10414751	3300015302	Miscanthus Phyllosphere	RMFAARAWSIKCRRKKKLIDRFGGKLRDERFKPN*
Ga0182143_10659871	3300015302	Miscanthus Phyllosphere	YLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182143_11033151	3300015302	Miscanthus Phyllosphere	HRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182123_10023021	3300015303	Miscanthus Phyllosphere	LSHRMFAARAWSIKCRRKEKLIAQFGGKLRDEHFKPN*
Ga0182123_10302492	3300015303	Miscanthus Phyllosphere	SHRMFAARVWSIKCRRKEKLIAQFGGKLRNERFEPN*
Ga0182123_10678041	3300015303	Miscanthus Phyllosphere	KLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182112_10398971	3300015304	Miscanthus Phyllosphere	TPKSKKLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182112_10786221	3300015304	Miscanthus Phyllosphere	YLSHRMFAARAWSIKCRRKKLIAQFGGKLRDERFEPN*
Ga0182158_10037091	3300015305	Miscanthus Phyllosphere	SSTLTFKKLLQYLSRRMFTARAWSIKYRRKEKLIAQFGGKLRDERFEPN*
Ga0182144_10097761	3300015307	Miscanthus Phyllosphere	QYLLHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182142_10613461	3300015308	Miscanthus Phyllosphere	HRMFAAYAWCIKCRRKKLIAQFGGKLRDERFEPN*
Ga0182142_10699251	3300015308	Miscanthus Phyllosphere	SKKLLQYLSHRMFEARVWSIKCRRKEKLIAQFGGKLRDERLEPN*
Ga0182140_10199001	3300015314	Miscanthus Phyllosphere	KKLLQYLSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182140_10279451	3300015314	Miscanthus Phyllosphere	HRMFAARAWNIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182140_10655832	3300015314	Miscanthus Phyllosphere	YLSHRMFAARAWSIKYRRKEKLIAQFGGKLRDERFEPN*
Ga0182110_10785871	3300015322	Miscanthus Phyllosphere	FSWTSKSKKLLQYLSHQMFAALAWSIKCRRKEKLIAQFDGKLRDERFEPN*
Ga0182129_10054161	3300015323	Miscanthus Phyllosphere	YLSHRTFMAYAWSIKCRRKKLIAQFGEKLRDERFKSN*
Ga0182129_10231372	3300015323	Miscanthus Phyllosphere	QYLSHRMFVARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182129_10666501	3300015323	Miscanthus Phyllosphere	SHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFESN*
Ga0182129_10796371	3300015323	Miscanthus Phyllosphere	YLSHRMFAARVWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182187_10471311	3300015341	Miscanthus Phyllosphere	HRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182187_10847301	3300015341	Miscanthus Phyllosphere	YLSHRMFAARAWSIKYRRKEKLIAQFGGKLRDKCFETN*
Ga0182187_11135681	3300015341	Miscanthus Phyllosphere	QYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDEHFKPN*
Ga0182187_11410341	3300015341	Miscanthus Phyllosphere	LSHRMFAVRAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182187_11874891	3300015341	Miscanthus Phyllosphere	KKLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEAN*
Ga0182109_10217411	3300015342	Miscanthus Phyllosphere	LNKGSSTPTSKKLLQCLSHRMFAPRAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182109_10336481	3300015342	Miscanthus Phyllosphere	LLQYLSHRMFMARTWSIKYRRKEKLIAQFSGKLRDDRFKPN*
Ga0182109_11169311	3300015342	Miscanthus Phyllosphere	LQYLSHRMFTVHAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182109_11288561	3300015342	Miscanthus Phyllosphere	SHRMFVARAWSIKCRRKEKLIAQFGGKLRDERFESN*
Ga0182155_10612661	3300015343	Miscanthus Phyllosphere	QYLSHRMFAARAWNIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182155_10705041	3300015343	Miscanthus Phyllosphere	QYLSHRMFAARAWSIKCRRKEKLIAQFDGKLRDERFEPN*
Ga0182155_10743301	3300015343	Miscanthus Phyllosphere	QYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182189_11063211	3300015344	Miscanthus Phyllosphere	KVLQYLSHRMFAARAWSIKCRRKKLIAQFGEKLRDERFESN*
Ga0182189_12069301	3300015344	Miscanthus Phyllosphere	HRMFAARAWSIKCRRKEKLIAQFGGILRDERFKSN*
Ga0182189_12206691	3300015344	Miscanthus Phyllosphere	MFAARAWSIKYRRKEKLIAQFGGKLRDERFDPNYSMFEHYLPNKNERAT
Ga0182189_12250832	3300015344	Miscanthus Phyllosphere	LSQRMFAARAWSFECRRKETLIAQFVGKLRVGRFKPN*
Ga0182111_11049721	3300015345	Miscanthus Phyllosphere	PLFSWTSKSKKLLQYLSHRMFTARAWSIKYKQKEKLIAQFGGKLRDECFKPN*
Ga0182111_11239401	3300015345	Miscanthus Phyllosphere	LSHRMFAARAWSIKCRRKKLITQFDWKLRDERFEPN*
Ga0182111_11298561	3300015345	Miscanthus Phyllosphere	LSHRMFTARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182111_11906501	3300015345	Miscanthus Phyllosphere	MFSCNLNSKKLLQYLSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFEP
Ga0182111_12458581	3300015345	Miscanthus Phyllosphere	LSHRMFAARAWSIKYRRKEKLIAQFGGKLRDERFEPN*
Ga0182139_10603191	3300015346	Miscanthus Phyllosphere	MSHRMFAARAWSIKCIRKEKLIAQFGGKLRDERFEPN*
Ga0182139_10797952	3300015346	Miscanthus Phyllosphere	YLSHRMFAARVWSIKCRRKEKLIAQFGGKLRNERFKPN*
Ga0182139_11140191	3300015346	Miscanthus Phyllosphere	MFVARVWSIKCRRKEKLIAQFGGKLRDERFEPNYSMFEHY
Ga0182139_11142571	3300015346	Miscanthus Phyllosphere	VLQYLSHRMFAARAWSIKCRRKKLIAQFGGKLRDERFEPN*
Ga0182177_10294831	3300015347	Miscanthus Phyllosphere	HRMFAACAWSIKYRRKKLIAQFGGKLRDERFEPN*
Ga0182177_11525572	3300015347	Miscanthus Phyllosphere	YLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDEHFEAN*
Ga0182177_11852011	3300015347	Miscanthus Phyllosphere	TQDLSSFTLTSKKLLKYMSHRMFAARAWSIKYRRKEKLIAQFGGKLRDERFEPN*
Ga0182161_11626991	3300015351	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKSN*
Ga0182161_12415391	3300015351	Miscanthus Phyllosphere	YLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKLN*
Ga0182159_10814861	3300015355	Miscanthus Phyllosphere	KLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLLDERFEPN*
Ga0182159_11494701	3300015355	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKEKLIAQIGGKLRDERFEPN*
Ga0182159_11787141	3300015355	Miscanthus Phyllosphere	TSKFKKLLQYLSHRMFVAHAWSIKCRRKEKLIAQFGGKLRDERFKPN*
Ga0182159_12814411	3300015355	Miscanthus Phyllosphere	PSHRMFAARAWSIKCRRKKLIAQFGGKLRDEHFKPN*
Ga0182159_13296252	3300015355	Miscanthus Phyllosphere	SYRMFAACAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182159_13452571	3300015355	Miscanthus Phyllosphere	HRMFAARAWSIKCRRKKKLIAQFGGKLRDKRFEPN*
Ga0182145_11775791	3300015361	Miscanthus Phyllosphere	FSWTPKSKKLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182145_11821812	3300015361	Miscanthus Phyllosphere	LSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFESN*
Ga0182145_11894841	3300015361	Miscanthus Phyllosphere	LSHRMFVARAWSIKCRRKEKLIAQFGGKLRDERFEPN*
Ga0182203_10713691	3300017404	Miscanthus Phyllosphere	LQYLSYRMFVARAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182220_10360931	3300017407	Miscanthus Phyllosphere	YLSHRMFAVRAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182220_10367551	3300017407	Miscanthus Phyllosphere	DALFNFTLTSKKLLQYLSHRMFMARVWSIKCRRKEKLIAQFGGKLRDERFKSN
Ga0182204_11053371	3300017409	Miscanthus Phyllosphere	LSHRMFAVRAWSIKCRRKEKLIAQFGGKLRDKRFEPN
Ga0182208_11125891	3300017411	Miscanthus Phyllosphere	HRMFAARVWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182222_10156721	3300017413	Miscanthus Phyllosphere	NSKKLLQYLSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFESN
Ga0182222_10366761	3300017413	Miscanthus Phyllosphere	QYLSHRMFAARAWSIKCRRKEKLITQFGGKLRDERFKPN
Ga0182202_11063481	3300017415	Miscanthus Phyllosphere	LSHRMFAARAWSIKCRRKEKLITQFGGKLRDERFKPN
Ga0182228_10654881	3300017420	Miscanthus Phyllosphere	SKKLLQYLSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182228_11012991	3300017420	Miscanthus Phyllosphere	KKLLQYLLHRMFAARAWIIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182219_10151201	3300017424	Miscanthus Phyllosphere	FSSTPKSKKLLQYLSHRMFAAHAWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182219_11134371	3300017424	Miscanthus Phyllosphere	LLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182219_11156081	3300017424	Miscanthus Phyllosphere	MSHRMFATYALNIKCRQKKLIAQFGGKLRDERFEPN
Ga0182224_11204821	3300017425	Miscanthus Phyllosphere	YLSHRMFAAYAWNIKCRREKKLIAQFGGKLRDERFEPN
Ga0182224_11655611	3300017425	Miscanthus Phyllosphere	LSHRMFAAHAWSIKYRRKEKLIAQFGGKLRDERFKPN
Ga0182190_10747431	3300017427	Miscanthus Phyllosphere	LSHRMFAVCTWSIKCRRKKLITQFGGKLRDERFEPN
Ga0182190_11123891	3300017427	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFESN
Ga0182192_10396781	3300017430	Miscanthus Phyllosphere	LQYLLHRMFTARAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182192_10752651	3300017430	Miscanthus Phyllosphere	SHRMFAARAWSIKCRRKKKLIAQFGGKLRDKRFEPN
Ga0182206_11225252	3300017433	Miscanthus Phyllosphere	FSFTLTSKNLLQYLSHRMFAARAWSIKYRRKEKLIAQFGGKLRDERFEPN
Ga0182209_10203781	3300017436	Miscanthus Phyllosphere	KSKKLLQYLSHRMFAARAWSIKCRRKEKLITQFGRKLRDERFKPN
Ga0182209_11517501	3300017436	Miscanthus Phyllosphere	LSHRMFAVRVWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182191_10221782	3300017438	Miscanthus Phyllosphere	QYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182191_10835291	3300017438	Miscanthus Phyllosphere	LSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182191_10897981	3300017438	Miscanthus Phyllosphere	HRIFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182191_11358351	3300017438	Miscanthus Phyllosphere	SHRMFAARAWSIKYRRKEKLIAQFGGKLRDERFKPN
Ga0182191_11721521	3300017438	Miscanthus Phyllosphere	LPFKKLLQYLSHRMFVAHAWSIKYRRKEKLIAQFGGKLRDERFEPN
Ga0182229_10620441	3300017682	Miscanthus Phyllosphere	KKLVQYLSHQMFAARVWSIKYRRKEKLIAQFGGKLRDERFEPN
Ga0182218_10320001	3300017683	Miscanthus Phyllosphere	LKSQKVLQYLSHRMFVARAWSIKCRRKKLIAQFGGKMRDERFEPN
Ga0182218_10620771	3300017683	Miscanthus Phyllosphere	YLSHRMFAVRAWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182225_10260132	3300017684	Miscanthus Phyllosphere	YLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFKPN
Ga0182227_10985222	3300017685	Miscanthus Phyllosphere	YLSHRMFAVRAWNIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182205_10566551	3300017686	Miscanthus Phyllosphere	NFKKLLQYLSHRMFAARVWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182205_11166371	3300017686	Miscanthus Phyllosphere	KLLQYLSHRMFAARAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182223_10022692	3300017690	Miscanthus Phyllosphere	YLSHRMFAARVWSIKCRRKEKLIAQFGGKLRDEHFKPN
Ga0182223_10114491	3300017690	Miscanthus Phyllosphere	HRIFAAHAWSIKCRRKEKLIAQFGGKLRDERFEPN
Ga0182223_10406961	3300017690	Miscanthus Phyllosphere	QYLSHRMFAARVWSIKCRRKEKLIAQFGGKLRDERFEPK