| Basic Information | |
|---|---|
| Family ID | F060464 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYLSY |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.06 % |
| % of genes near scaffold ends (potentially truncated) | 21.05 % |
| % of genes from short scaffolds (< 2000 bps) | 77.44 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.594 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.81% β-sheet: 0.00% Coil/Unstructured: 82.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF01926 | MMR_HSR1 | 27.07 |
| PF00436 | SSB | 25.56 |
| PF01551 | Peptidase_M23 | 13.53 |
| PF02784 | Orn_Arg_deC_N | 9.02 |
| PF12323 | HTH_OrfB_IS605 | 6.02 |
| PF06071 | YchF-GTPase_C | 5.26 |
| PF04610 | TrbL | 3.76 |
| PF03099 | BPL_LplA_LipB | 2.26 |
| PF07690 | MFS_1 | 0.75 |
| PF08338 | DUF1731 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 25.56 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 25.56 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 9.02 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 9.02 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 5.26 |
| COG3704 | Type IV secretory pathway, VirB6 component | Intracellular trafficking, secretion, and vesicular transport [U] | 3.76 |
| COG3846 | Type IV secretory pathway, TrbL components | Intracellular trafficking, secretion, and vesicular transport [U] | 3.76 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 2.26 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 2.26 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 2.26 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.25 % |
| Unclassified | root | N/A | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1003644 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300001369|JGI12701J14581_1004232 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300001545|JGI12630J15595_10002932 | All Organisms → cellular organisms → Bacteria | 3706 | Open in IMG/M |
| 3300001661|JGI12053J15887_10045190 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300001661|JGI12053J15887_10083857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1750 | Open in IMG/M |
| 3300002557|JGI25381J37097_1072479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
| 3300002558|JGI25385J37094_10017642 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300002560|JGI25383J37093_10114593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 768 | Open in IMG/M |
| 3300002562|JGI25382J37095_10013762 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
| 3300002562|JGI25382J37095_10052935 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300002853|draft_1011866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300002909|JGI25388J43891_1023262 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300002912|JGI25386J43895_10035639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1460 | Open in IMG/M |
| 3300005166|Ga0066674_10129064 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300005166|Ga0066674_10147774 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300005167|Ga0066672_10077291 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300005174|Ga0066680_10171799 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300005175|Ga0066673_10204498 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300005176|Ga0066679_10135686 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300005176|Ga0066679_10144029 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300005177|Ga0066690_10192336 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005178|Ga0066688_10267472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300005178|Ga0066688_10536178 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005181|Ga0066678_10105075 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300005434|Ga0070709_10664132 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005435|Ga0070714_100522670 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300005445|Ga0070708_101226926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 701 | Open in IMG/M |
| 3300005447|Ga0066689_10163232 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300005447|Ga0066689_10222196 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300005467|Ga0070706_100003044 | All Organisms → cellular organisms → Bacteria | 16604 | Open in IMG/M |
| 3300005518|Ga0070699_100503207 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300005518|Ga0070699_101683403 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005536|Ga0070697_101493564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas veronii | 604 | Open in IMG/M |
| 3300005536|Ga0070697_102004083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300005553|Ga0066695_10863214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300005554|Ga0066661_10901273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300005556|Ga0066707_10753517 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005559|Ga0066700_10858417 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005559|Ga0066700_11026560 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005586|Ga0066691_10316692 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005598|Ga0066706_10527095 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300005598|Ga0066706_11364732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300006173|Ga0070716_100050991 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
| 3300006796|Ga0066665_10410041 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300009038|Ga0099829_10016574 | All Organisms → cellular organisms → Bacteria | 4950 | Open in IMG/M |
| 3300009038|Ga0099829_10234186 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300009038|Ga0099829_10250263 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300009088|Ga0099830_10158118 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300009090|Ga0099827_11177945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 666 | Open in IMG/M |
| 3300009137|Ga0066709_101202991 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300011269|Ga0137392_10256855 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300011270|Ga0137391_10215466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1668 | Open in IMG/M |
| 3300011998|Ga0120114_1078951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300012189|Ga0137388_10134342 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
| 3300012198|Ga0137364_10042055 | All Organisms → cellular organisms → Bacteria | 2998 | Open in IMG/M |
| 3300012198|Ga0137364_10538507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 879 | Open in IMG/M |
| 3300012198|Ga0137364_10575784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 848 | Open in IMG/M |
| 3300012199|Ga0137383_10081373 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300012199|Ga0137383_10971065 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012201|Ga0137365_11087370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 576 | Open in IMG/M |
| 3300012203|Ga0137399_10047242 | All Organisms → cellular organisms → Bacteria | 3102 | Open in IMG/M |
| 3300012205|Ga0137362_10587312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300012208|Ga0137376_11567445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 550 | Open in IMG/M |
| 3300012209|Ga0137379_11066975 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012211|Ga0137377_10278893 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300012285|Ga0137370_10122580 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300012285|Ga0137370_10272964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
| 3300012356|Ga0137371_11228010 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012357|Ga0137384_10358076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1208 | Open in IMG/M |
| 3300012362|Ga0137361_10613683 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012683|Ga0137398_10515551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
| 3300012918|Ga0137396_10189016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1512 | Open in IMG/M |
| 3300012918|Ga0137396_10386380 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012925|Ga0137419_11208614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300012927|Ga0137416_12154044 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012975|Ga0134110_10062567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1475 | Open in IMG/M |
| 3300014150|Ga0134081_10145305 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300015193|Ga0167668_1006023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2719 | Open in IMG/M |
| 3300018468|Ga0066662_12386708 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018482|Ga0066669_10044325 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300019888|Ga0193751_1028006 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300020022|Ga0193733_1162450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300021046|Ga0215015_10138447 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300021046|Ga0215015_10762498 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021418|Ga0193695_1064571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300022557|Ga0212123_10241645 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300022691|Ga0248483_100669 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300025910|Ga0207684_10000627 | All Organisms → cellular organisms → Bacteria | 42107 | Open in IMG/M |
| 3300025922|Ga0207646_10295106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1465 | Open in IMG/M |
| 3300025939|Ga0207665_10117528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1875 | Open in IMG/M |
| 3300026295|Ga0209234_1070668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1327 | Open in IMG/M |
| 3300026296|Ga0209235_1094394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1302 | Open in IMG/M |
| 3300026297|Ga0209237_1017543 | All Organisms → cellular organisms → Bacteria | 4149 | Open in IMG/M |
| 3300026297|Ga0209237_1148285 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300026298|Ga0209236_1014077 | All Organisms → cellular organisms → Bacteria | 4635 | Open in IMG/M |
| 3300026300|Ga0209027_1005505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4765 | Open in IMG/M |
| 3300026300|Ga0209027_1076828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1233 | Open in IMG/M |
| 3300026308|Ga0209265_1111520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300026309|Ga0209055_1213638 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026312|Ga0209153_1215509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300026313|Ga0209761_1239751 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300026315|Ga0209686_1034097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1940 | Open in IMG/M |
| 3300026322|Ga0209687_1035390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1624 | Open in IMG/M |
| 3300026371|Ga0257179_1006884 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300026548|Ga0209161_10585938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300026550|Ga0209474_10066474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2519 | Open in IMG/M |
| 3300026551|Ga0209648_10197392 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300026551|Ga0209648_10308537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
| 3300026552|Ga0209577_10401231 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300027383|Ga0209213_1030147 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300027388|Ga0208995_1026726 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300027521|Ga0209524_1047591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300027535|Ga0209734_1004212 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
| 3300027587|Ga0209220_1001998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5591 | Open in IMG/M |
| 3300027587|Ga0209220_1008135 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300027587|Ga0209220_1020240 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300027591|Ga0209733_1005072 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
| 3300027603|Ga0209331_1010968 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
| 3300027651|Ga0209217_1018436 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300027651|Ga0209217_1169826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
| 3300027669|Ga0208981_1081427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 825 | Open in IMG/M |
| 3300027674|Ga0209118_1022755 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300027674|Ga0209118_1081325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 927 | Open in IMG/M |
| 3300027674|Ga0209118_1136464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300027681|Ga0208991_1017437 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300027684|Ga0209626_1003743 | All Organisms → cellular organisms → Bacteria | 3347 | Open in IMG/M |
| 3300027727|Ga0209328_10190922 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300027846|Ga0209180_10758700 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300027903|Ga0209488_10036900 | All Organisms → cellular organisms → Bacteria | 3573 | Open in IMG/M |
| 3300028047|Ga0209526_10263237 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300028536|Ga0137415_10792431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 758 | Open in IMG/M |
| 3300028884|Ga0307308_10008125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4599 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 18.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001369 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10036443 | 3300001089 | Forest Soil | MMIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPTEVDDYLSY* |
| JGI12701J14581_10042322 | 3300001369 | Forest Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSH* |
| JGI12630J15595_100029324 | 3300001545 | Forest Soil | MIPEPHPYDPDDPTTYDENAEDLAYLVPDRGFRRDQLDIDDYPSY* |
| JGI12053J15887_100451902 | 3300001661 | Forest Soil | MIIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYPSY* |
| JGI12053J15887_100838574 | 3300001661 | Forest Soil | VMIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPTEVDDYLSY* |
| JGI25381J37097_10724791 | 3300002557 | Grasslands Soil | MTIPEPHPYDPDDPTYYDETTXELGYLAPDRGFRPDPMEVDDYLSY* |
| JGI25385J37094_100176421 | 3300002558 | Grasslands Soil | MAIPEPHPYDPDDPTYYDETTEELGYLVPDRGFHPDPMEVDDYLSY* |
| JGI25383J37093_101145932 | 3300002560 | Grasslands Soil | NMAIPEPHPYDPDDPTYYDETSEELGYLVPDPGFRPDPSDVDDYLSY* |
| JGI25382J37095_100137622 | 3300002562 | Grasslands Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPSDVDDYLSY* |
| JGI25382J37095_100529352 | 3300002562 | Grasslands Soil | MIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY* |
| draft_10118662 | 3300002853 | Hydrocarbon Resource Environments | MIPEPHPYDPDDPTFYDDTTEELGYLVPDRCFRPDPMEVDDYLSY* |
| JGI25388J43891_10232622 | 3300002909 | Grasslands Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY* |
| JGI25386J43895_100356391 | 3300002912 | Grasslands Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPSDVDDYLSY |
| Ga0066674_101290642 | 3300005166 | Soil | MTIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0066674_101477743 | 3300005166 | Soil | MTIPEPHPYDPDDPTYYDETTEELDYLAPDRGFRPDPMEVGDYLSY* |
| Ga0066672_100772912 | 3300005167 | Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRLDPMEVDDYLSY* |
| Ga0066680_101717992 | 3300005174 | Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPEPMEVDDYLSY* |
| Ga0066673_102044982 | 3300005175 | Soil | MTIPEPHPYDPDDPTYYDETTEELDYLAPDRGFRPDPTEVGDYLSY* |
| Ga0066679_101356863 | 3300005176 | Soil | MIPEPHPYDPDDPTDYDETTDELGYLVPGRGFLRDRIDLEDYPSY* |
| Ga0066679_101440292 | 3300005176 | Soil | MIPEPHPYDPDDPTYYDETTEELGYLAPDPGFRLDPTEADDYLSY* |
| Ga0066690_101923361 | 3300005177 | Soil | MIPEPHPYDPDDPTDYEETTDELGYLVPGRGFLRDRIDLEDYPSY* |
| Ga0066688_102674722 | 3300005178 | Soil | MIPEPHPYDPDDPTDYDETTDELGCLVPGRGFLRDRIDLEDYPSY* |
| Ga0066688_105361783 | 3300005178 | Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0066678_101050754 | 3300005181 | Soil | MMIPEPHPYDPDDPTEYDETAEELAYLVPDQGFRRDEAGLDDYPSY* |
| Ga0070709_106641322 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIPEPHPYDPDDPTDYDETSEELAYLAPDRGFLREQLDLDDHLSY* |
| Ga0070714_1005226703 | 3300005435 | Agricultural Soil | MMIPEPHPYDPDDPTDYDETSEELAYLAPDRGFLREQLDLDDHLSY* |
| Ga0070708_1012269261 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPEPHPYDPDDPTYFDETTEELGYLAPDRGFRPDPMEVDDYLNY* |
| Ga0066689_101632322 | 3300005447 | Soil | MMIPEPHPYDPDDPTEYDETAEDLAYLVPDQGFRRDEAGLDDYPSY* |
| Ga0066689_102221961 | 3300005447 | Soil | MTIPEPHPYDPDDPSYYDETSEELGYLVPDRGFRPDLMEVDDYLSY* |
| Ga0070706_10000304418 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPEPNPYDPDDPTYYDETTEELGYLLPDRGFRPDSTEVDDYMSY* |
| Ga0070699_1005032072 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIPEPHPYDPDDPTYYDETSEELGYLVPDQGFRPDPMEVDDYLSY* |
| Ga0070699_1016834032 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MILPEPHPYNPDDPTAYDETAEDLAYLVPDWGFLRDQTGLDDDLTY* |
| Ga0070697_1014935641 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPEPHPYDPDDPTYYDENTEELGYLVPDRGFPPDQMEVDDYLSY* |
| Ga0070697_1020040831 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MILPEPHPYDPDDPTAYDETAEDLAYLVPDWGFLRDQTGLDDDLTY* |
| Ga0066695_108632141 | 3300005553 | Soil | HPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY* |
| Ga0066661_109012731 | 3300005554 | Soil | PHPYDPDDPTYYDETTEELGYLAPDRGFRLDPMEVDDYLSY* |
| Ga0066707_107535171 | 3300005556 | Soil | EPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0066700_108584172 | 3300005559 | Soil | GHRLRSKITMIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDLMEVDDYLSY* |
| Ga0066700_110265601 | 3300005559 | Soil | PEPHPYDPDDPTYYDETTEELGYLAPDPGFRLDPTEADDYLSY* |
| Ga0066691_103166921 | 3300005586 | Soil | TMTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPEPMEVDDYLSY* |
| Ga0066706_105270952 | 3300005598 | Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0066706_113647322 | 3300005598 | Soil | PYDPDDPTEYDETAEDLAYLVPDQGFRRDEAGLDDYPSY* |
| Ga0070716_1000509915 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPEPHPYDPDDPTYFDETTEELGYLAPDRGFRPDPMEVDDYLSY* |
| Ga0066665_104100413 | 3300006796 | Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLS |
| Ga0099829_100165743 | 3300009038 | Vadose Zone Soil | MMIPEPQPYDPDDPTDYDETSEELAYLAPDRGFLRERVDLDDHLSY* |
| Ga0099829_102341862 | 3300009038 | Vadose Zone Soil | MMIPEPHPYDPDDPTYYDETTEELGYLTPDRGFLPDPMEVDDYLSY* |
| Ga0099829_102502632 | 3300009038 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETSEELGYLAPDRGFRPDPTDVDDYLSY* |
| Ga0099830_101581183 | 3300009088 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRSDPMEVDDYLSY* |
| Ga0099827_111779452 | 3300009090 | Vadose Zone Soil | MMIPEPHPYDPDDPTAYDETTEELAYLAPDRGLLGERVDRDDYPPY* |
| Ga0066709_1012029911 | 3300009137 | Grasslands Soil | PQPYDPDDPTYYDETSEELGYLVPDRGFRADPMEVDDYLSY* |
| Ga0137392_102568553 | 3300011269 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETTEELGYLTPDRGFLPDPMEVDDYLSY* |
| Ga0137391_102154661 | 3300011270 | Vadose Zone Soil | MIPEPHPYDPDDPSYYDETSEELGYLAPDRGFRPDPTDVDDYLSY* |
| Ga0120114_10789512 | 3300011998 | Permafrost | MMIPEPQPYDPDDPTDYDEATEELAYLAPDRGFLRDRIDLDDHLSY* |
| Ga0137388_101343423 | 3300012189 | Vadose Zone Soil | GHCLRGQTEMIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRSDPMEVDDYLSY* |
| Ga0137364_100420556 | 3300012198 | Vadose Zone Soil | MTIPEPHPDDPDDPTYYDETTEELGYLAPDRGFRLDPMEVDDYLSY* |
| Ga0137364_105385073 | 3300012198 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0137364_105757843 | 3300012198 | Vadose Zone Soil | MILPEPHPYDPDDPTAYDETAEDLAYLVPDRGFRRDQAGLDDDLTY* |
| Ga0137383_100813733 | 3300012199 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0137383_109710651 | 3300012199 | Vadose Zone Soil | DNMTIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0137365_110873701 | 3300012201 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPSDADDYLSY* |
| Ga0137399_100472425 | 3300012203 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPTEVDDYLSY* |
| Ga0137362_105873123 | 3300012205 | Vadose Zone Soil | MAIPEPHPYDPDDPTYYDETSEELGYLVPDPGFRPDPSDVDDYLSY* |
| Ga0137362_108570762 | 3300012205 | Vadose Zone Soil | CRRAGHRLRSKITMIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0137376_115674452 | 3300012208 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETTEELDHLAPDRGFRPDPMEVGDYLSY* |
| Ga0137379_110669752 | 3300012209 | Vadose Zone Soil | PHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0137377_102788931 | 3300012211 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPTEVDDYLSY* |
| Ga0137370_101225803 | 3300012285 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETTEELDYLAPDRGFRPNPTEVGDYLSY* |
| Ga0137370_102729642 | 3300012285 | Vadose Zone Soil | MILPEPHPYDPDDPTAYDETAEDLAYLVPNRGFRRDQAGLDDDLTY* |
| Ga0137371_112280102 | 3300012356 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDLSY* |
| Ga0137384_103580762 | 3300012357 | Vadose Zone Soil | EDNMTIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPSDADDYLSY* |
| Ga0137361_106136832 | 3300012362 | Vadose Zone Soil | KITMIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY* |
| Ga0137398_105155513 | 3300012683 | Vadose Zone Soil | MTIPEPHPYDPDDPTYYDETTEELGHLAPDLGFRPDPMEVDDYLSY* |
| Ga0137396_101890161 | 3300012918 | Vadose Zone Soil | KTKMMIPEPHPYDPDDPTYYDETTEELGYLVPDRGVRPDPSDVDDYLSY* |
| Ga0137396_103863802 | 3300012918 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETTEELGFLAPDRGFRPDPTEVDDYLSY* |
| Ga0137419_112086141 | 3300012925 | Vadose Zone Soil | DDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY* |
| Ga0137416_121540442 | 3300012927 | Vadose Zone Soil | MMIPEPHPYDPDDPTYYDETTEELGYLVPDRGVRPDPSDVDDYLSY* |
| Ga0134110_100625671 | 3300012975 | Grasslands Soil | MTIPEPHPYDPDDPTYYDETAEELGYLAPDRGFRPDPMEVDDYLSY* |
| Ga0134081_101453051 | 3300014150 | Grasslands Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPTRWRSTIT* |
| Ga0167668_10060231 | 3300015193 | Glacier Forefield Soil | QNMIPEPHPYDPDDPTYYDENTEELGYLVPDRSFRSDPMEVDDLSY* |
| Ga0066662_123867081 | 3300018468 | Grasslands Soil | MTIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY |
| Ga0066669_100443251 | 3300018482 | Grasslands Soil | MTIPEPHPYDPDDPTYYDETTEELDYLAPDRGFRPDPMEVGDYLSY |
| Ga0193751_10280063 | 3300019888 | Soil | MIPEPQPYDPDDPSDYDEATEELAYLAPDSGFLRDRIELDDHLSY |
| Ga0193733_11624502 | 3300020022 | Soil | MTIPEPHPYDPDEPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0215015_101384472 | 3300021046 | Soil | MMIPEPHPYDPDDPTYYDETSEELGYLVPDLGFRPDPMEVDDYLSY |
| Ga0215015_107624982 | 3300021046 | Soil | MMIPEPHPYDPDDPTSYDETTDDLGYLLSDPALRPDQGDLDDYLSY |
| Ga0193695_10645712 | 3300021418 | Soil | MIFPEPHPYDPDDPTGYDETAEDLAYLVPDRGFLRDRAGLDDDLTY |
| Ga0212123_102416452 | 3300022557 | Iron-Sulfur Acid Spring | MIPEPHPYDPDDPTFYDDTTEELGYLVPDRCFRPDPMEVDDYLSY |
| Ga0248483_1006692 | 3300022691 | Soil | MMIPEPHPYDPDDPTYYDETNDDLGYLVPDRGMWPDPTDLDDYLSY |
| Ga0207684_1000062721 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPEPNPYDPDDPTYYDETTEELGYLLPDRGFRPDSTEVDDYMSY |
| Ga0207646_102951062 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIPEPHPYDPDDPTDYDETSEELAYLAPDRGFLRERVDLDDHLSY |
| Ga0207665_101175284 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPEPHPYDPDDPTYFDETTEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0209234_10706683 | 3300026295 | Grasslands Soil | MMIPEPHPYDPDDPTEYDETAEELAYLVPDQGFRRDEAGLDDYPSY |
| Ga0209235_10943942 | 3300026296 | Grasslands Soil | GEDNMAIPEPHPYDPDDPTYYDETSEELGYLVPDPGFRPDPSDVDDYLSY |
| Ga0209237_10175433 | 3300026297 | Grasslands Soil | MAIPEPHPYDPDDPTYYDETSEELGYLVPDPGFRPDPSDVDDYLSY |
| Ga0209237_11482851 | 3300026297 | Grasslands Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSY |
| Ga0209236_10140772 | 3300026298 | Grasslands Soil | MAIPEPHPYDPDDPTYYDETTEELGYLVPDRGFHPDPMEVDDYLSY |
| Ga0209027_10055051 | 3300026300 | Grasslands Soil | HPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0209027_10768281 | 3300026300 | Grasslands Soil | MIFPEPHPYDSDDPSAYDETAEDLAYLVPDRGFLRDQAGLDDDLTY |
| Ga0209265_11115202 | 3300026308 | Soil | EHDMTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0209055_12136382 | 3300026309 | Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPEPMEVDDYLSY |
| Ga0209153_12155091 | 3300026312 | Soil | MTIPEPHPYDPDDPTYYDEATEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0209761_12397512 | 3300026313 | Grasslands Soil | MIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0209686_10340973 | 3300026315 | Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRLDPMEVDDYLSY |
| Ga0209687_10353901 | 3300026322 | Soil | PYDPDDPTYYDEATEELGYLAPDRGFRPDPMEVDDYLSY |
| Ga0257179_10068842 | 3300026371 | Soil | MMIPEPHPYDPDDPTYYDETTEELGYLSPDRGFLPDPMEVDDYLSY |
| Ga0209161_105859382 | 3300026548 | Soil | PYDPDDPTEYDETAEDLAYLVPDQGFRRDEAGLDDYPSY |
| Ga0209474_100664744 | 3300026550 | Soil | MTIPEPHPYDPDDPTYYDETTEELGYLAPDRGFLLDPMEVDDYLSY |
| Ga0209648_101973923 | 3300026551 | Grasslands Soil | MMIPEPHPYDPDDPTYYDETTEELGYLAPDRGFLPDPMEVDDYLSY |
| Ga0209648_103085371 | 3300026551 | Grasslands Soil | MIPEPHPYDPDDPTYYDETSEELGYLAPDRGFRPDPTDVDDYLSY |
| Ga0209577_104012312 | 3300026552 | Soil | MIPEPHPYDPDDPTDYDETTDELGYLVPGRGFLRDRVDLEDYPSY |
| Ga0209213_10301472 | 3300027383 | Forest Soil | MIIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPLEVDDYPSY |
| Ga0208995_10267262 | 3300027388 | Forest Soil | MIIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYPSY |
| Ga0209524_10475911 | 3300027521 | Forest Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRPDPMEVDDYLSH |
| Ga0209734_10042122 | 3300027535 | Forest Soil | MMIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDTMEVDDYLSH |
| Ga0209220_10019982 | 3300027587 | Forest Soil | MIPEPHPYDPDDPTYYDETTEELGYLVPDRGFHPDPSAVDDYLSY |
| Ga0209220_10081353 | 3300027587 | Forest Soil | MIPEPHPYDPDDPTYYDETTEELGYLVPDRGLRPDPMEADDYLSY |
| Ga0209220_10202402 | 3300027587 | Forest Soil | MIPEPHPYDPDDPTYYDENTEELGYLIPDRGFHPDPSAVDDYLSY |
| Ga0209733_10050726 | 3300027591 | Forest Soil | MIPEPHPYDPDDPTDYDENTEELGYLVPDRGFHPDPSAVDDYLSY |
| Ga0209331_10109682 | 3300027603 | Forest Soil | MIPEPHPYDPDDPTYYDETTEELGYLVPDRGFRPDPTEVDDYLSY |
| Ga0209217_10184363 | 3300027651 | Forest Soil | MIPEPHPYDPDDPTYYDEASEELGYLVPDRGFRPDPTDVDDYLSY |
| Ga0209217_11698262 | 3300027651 | Forest Soil | MIPEPHPYDPDDPTDYDENAEDLAYLNPDRGFRRDQFDVDDYLSY |
| Ga0208981_10814271 | 3300027669 | Forest Soil | MIIPEPHPYDPDDPTYYDETTEELGYLVPDRGLRPDRMEVDDYPSY |
| Ga0209118_10227552 | 3300027674 | Forest Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGLRSDPMEVDDYLSY |
| Ga0209118_10813253 | 3300027674 | Forest Soil | MMIPEPHPYDPNDPTYYDETTEELGYLVPDRGLRPDPTEVDDYLSY |
| Ga0209118_11364641 | 3300027674 | Forest Soil | PRRRAMIPEPHPYDPDDPDFYDETSEDLAYLVPGRMVPGNLVDPDDPMSY |
| Ga0208991_10174374 | 3300027681 | Forest Soil | MIPEPHPYDPDDPTYYDETTEELGYLAPDRGFRPDPTEVDDYLSY |
| Ga0209626_10037434 | 3300027684 | Forest Soil | MIPEPHPYDPDDPTTYDENAEDLAYLVPDRGFRRDQLDIDDYPSY |
| Ga0209328_101909222 | 3300027727 | Forest Soil | MIPEPHPYDPDDPATYDENAEDLAYLVPDRGFRRDQLDVDDYSNY |
| Ga0209180_107587002 | 3300027846 | Vadose Zone Soil | MIPEPHPYDPDDPTYYDETSEELGYLVPDRGFRSDPMEVDDYLSY |
| Ga0209488_100369002 | 3300027903 | Vadose Zone Soil | MMIPEPHPYDPDDPTYYDETTEELGYLTPDRGFLPDPMEVDDYLSY |
| Ga0209526_102632372 | 3300028047 | Forest Soil | MIPEPQPYDPDDPTYYDETTEELGYLVPDRGFRPDPMEVDDYLSY |
| Ga0137415_107924311 | 3300028536 | Vadose Zone Soil | MMIPEPHPYDPDDPTYYDETTEELGYLVPDRGVRPDPSDVDDYLSY |
| Ga0307308_100081256 | 3300028884 | Soil | MILPEPDPYNSDDPAAYDETAEDLAYLVPDQSFRRDQLGLDDDLTY |
| ⦗Top⦘ |