Basic Information | |
---|---|
Family ID | F060448 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 43 residues |
Representative Sequence | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.76 % |
% of genes near scaffold ends (potentially truncated) | 95.49 % |
% of genes from short scaffolds (< 2000 bps) | 87.97 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (38.346 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (54.135 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.917 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.722 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.66% β-sheet: 0.00% Coil/Unstructured: 46.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 6.77 |
PF12236 | Head-tail_con | 5.26 |
PF13385 | Laminin_G_3 | 3.01 |
PF00313 | CSD | 0.75 |
PF02739 | 5_3_exonuc_N | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 6.77 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.65 % |
Unclassified | root | N/A | 38.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000115|DelMOSum2011_c10019718 | All Organisms → Viruses → Predicted Viral | 3233 | Open in IMG/M |
3300000116|DelMOSpr2010_c10095999 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
3300001352|JGI20157J14317_10041133 | All Organisms → Viruses → Predicted Viral | 2250 | Open in IMG/M |
3300001419|JGI11705J14877_10169468 | Not Available | 579 | Open in IMG/M |
3300004097|Ga0055584_101655835 | Not Available | 662 | Open in IMG/M |
3300005512|Ga0074648_1013618 | Not Available | 5087 | Open in IMG/M |
3300005611|Ga0074647_1007926 | All Organisms → Viruses → Predicted Viral | 2198 | Open in IMG/M |
3300006026|Ga0075478_10064597 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300006026|Ga0075478_10235886 | Not Available | 551 | Open in IMG/M |
3300006637|Ga0075461_10088112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 982 | Open in IMG/M |
3300006789|Ga0098054_1109518 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
3300006802|Ga0070749_10226435 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
3300006802|Ga0070749_10270703 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300006802|Ga0070749_10327292 | Not Available | 855 | Open in IMG/M |
3300006802|Ga0070749_10372557 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300006802|Ga0070749_10742390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
3300006802|Ga0070749_10783075 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006810|Ga0070754_10287512 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300006867|Ga0075476_10315938 | Not Available | 545 | Open in IMG/M |
3300006868|Ga0075481_10150601 | Not Available | 847 | Open in IMG/M |
3300006868|Ga0075481_10276238 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300006868|Ga0075481_10298761 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300006869|Ga0075477_10248806 | Not Available | 716 | Open in IMG/M |
3300006869|Ga0075477_10413739 | Not Available | 523 | Open in IMG/M |
3300006870|Ga0075479_10075824 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
3300006916|Ga0070750_10070291 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
3300006916|Ga0070750_10175132 | Not Available | 961 | Open in IMG/M |
3300006916|Ga0070750_10195197 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300006916|Ga0070750_10288261 | Not Available | 704 | Open in IMG/M |
3300006916|Ga0070750_10298653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 689 | Open in IMG/M |
3300006916|Ga0070750_10417487 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300006916|Ga0070750_10485367 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006919|Ga0070746_10127116 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
3300006919|Ga0070746_10520825 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300007234|Ga0075460_10069771 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
3300007236|Ga0075463_10096046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Carboxylicivirga | 956 | Open in IMG/M |
3300007236|Ga0075463_10295294 | All Organisms → Viruses → environmental samples → uncultured marine virus | 519 | Open in IMG/M |
3300007276|Ga0070747_1134875 | All Organisms → Viruses → environmental samples → uncultured marine virus | 894 | Open in IMG/M |
3300007344|Ga0070745_1079757 | Not Available | 1302 | Open in IMG/M |
3300007344|Ga0070745_1150082 | All Organisms → Viruses → environmental samples → uncultured marine virus | 883 | Open in IMG/M |
3300007344|Ga0070745_1292896 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 581 | Open in IMG/M |
3300007345|Ga0070752_1177134 | Not Available | 862 | Open in IMG/M |
3300007346|Ga0070753_1188922 | Not Available | 766 | Open in IMG/M |
3300007640|Ga0070751_1311317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Magnetovibrio → unclassified Magnetovibrio → Magnetovibrio sp. | 585 | Open in IMG/M |
3300007960|Ga0099850_1168855 | Not Available | 873 | Open in IMG/M |
3300009027|Ga0102957_1341757 | Not Available | 552 | Open in IMG/M |
3300009507|Ga0115572_10265057 | Not Available | 980 | Open in IMG/M |
3300009507|Ga0115572_10716736 | All Organisms → Viruses → environmental samples → uncultured marine virus | 543 | Open in IMG/M |
3300010296|Ga0129348_1147914 | Not Available | 814 | Open in IMG/M |
3300010296|Ga0129348_1252541 | All Organisms → Viruses → environmental samples → uncultured marine virus | 593 | Open in IMG/M |
3300010300|Ga0129351_1010280 | All Organisms → Viruses → Predicted Viral | 3895 | Open in IMG/M |
3300010318|Ga0136656_1094779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Alkaliphilus → unclassified Alkaliphilus → Alkaliphilus sp. B6464 | 1050 | Open in IMG/M |
3300017753|Ga0181407_1080928 | All Organisms → Viruses → environmental samples → uncultured marine virus | 829 | Open in IMG/M |
3300017782|Ga0181380_1114397 | Not Available | 930 | Open in IMG/M |
3300017951|Ga0181577_10817240 | Not Available | 561 | Open in IMG/M |
3300017957|Ga0181571_10876773 | All Organisms → Viruses → environmental samples → uncultured marine virus | 529 | Open in IMG/M |
3300017957|Ga0181571_10891550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300017968|Ga0181587_10414499 | Not Available | 888 | Open in IMG/M |
3300018049|Ga0181572_10225878 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
3300018410|Ga0181561_10135408 | Not Available | 1283 | Open in IMG/M |
3300018416|Ga0181553_10173907 | Not Available | 1263 | Open in IMG/M |
3300018416|Ga0181553_10413927 | Not Available | 730 | Open in IMG/M |
3300018417|Ga0181558_10283427 | Not Available | 911 | Open in IMG/M |
3300018417|Ga0181558_10315746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300018420|Ga0181563_10741529 | Not Available | 541 | Open in IMG/M |
3300018423|Ga0181593_10693722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 722 | Open in IMG/M |
3300018423|Ga0181593_10864224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → Desulfovibrio oxyclinae | 629 | Open in IMG/M |
3300018423|Ga0181593_11062417 | All Organisms → Viruses → environmental samples → uncultured marine virus | 553 | Open in IMG/M |
3300018424|Ga0181591_10317408 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
3300018424|Ga0181591_11052825 | All Organisms → Viruses → environmental samples → uncultured marine virus | 550 | Open in IMG/M |
3300018876|Ga0181564_10045319 | All Organisms → Viruses → Predicted Viral | 3035 | Open in IMG/M |
3300019737|Ga0193973_1028838 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300019756|Ga0194023_1027421 | Not Available | 1154 | Open in IMG/M |
3300019756|Ga0194023_1042044 | Not Available | 921 | Open in IMG/M |
3300019765|Ga0194024_1039184 | Not Available | 1038 | Open in IMG/M |
3300020188|Ga0181605_10248052 | Not Available | 774 | Open in IMG/M |
3300020347|Ga0211504_1106416 | Not Available | 629 | Open in IMG/M |
3300021373|Ga0213865_10501800 | All Organisms → Viruses → environmental samples → uncultured marine virus | 517 | Open in IMG/M |
3300021389|Ga0213868_10024367 | All Organisms → Viruses → Predicted Viral | 4631 | Open in IMG/M |
3300021960|Ga0222715_10321269 | All Organisms → Viruses → environmental samples → uncultured marine virus | 872 | Open in IMG/M |
3300022068|Ga0212021_1055098 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300022168|Ga0212027_1018240 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300022183|Ga0196891_1026361 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
3300022183|Ga0196891_1031693 | Not Available | 991 | Open in IMG/M |
3300022183|Ga0196891_1032131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Carboxylicivirga | 983 | Open in IMG/M |
3300022187|Ga0196899_1035698 | All Organisms → Viruses → Predicted Viral | 1713 | Open in IMG/M |
3300022187|Ga0196899_1188698 | All Organisms → Viruses → environmental samples → uncultured marine virus | 551 | Open in IMG/M |
3300022900|Ga0255771_1187769 | Not Available | 789 | Open in IMG/M |
3300022923|Ga0255783_10114900 | Not Available | 1382 | Open in IMG/M |
3300022923|Ga0255783_10392077 | All Organisms → Viruses → environmental samples → uncultured marine virus | 524 | Open in IMG/M |
3300022925|Ga0255773_10129124 | Not Available | 1266 | Open in IMG/M |
3300022928|Ga0255758_10118633 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
3300022928|Ga0255758_10127755 | Not Available | 1289 | Open in IMG/M |
3300022929|Ga0255752_10098704 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
3300022929|Ga0255752_10168609 | Not Available | 1066 | Open in IMG/M |
3300022929|Ga0255752_10172767 | Not Available | 1046 | Open in IMG/M |
3300022929|Ga0255752_10241784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300023119|Ga0255762_10185441 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
3300023175|Ga0255777_10132646 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
3300023178|Ga0255759_10112110 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1905 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10289380 | Not Available | 683 | Open in IMG/M |
3300025098|Ga0208434_1013454 | All Organisms → Viruses → Predicted Viral | 2185 | Open in IMG/M |
3300025610|Ga0208149_1048289 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
3300025630|Ga0208004_1065221 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Carboxylicivirga | 940 | Open in IMG/M |
3300025630|Ga0208004_1124007 | Not Available | 588 | Open in IMG/M |
3300025653|Ga0208428_1012621 | All Organisms → Viruses → Predicted Viral | 2909 | Open in IMG/M |
3300025671|Ga0208898_1016745 | All Organisms → Viruses → Predicted Viral | 3390 | Open in IMG/M |
3300025671|Ga0208898_1066346 | Not Available | 1222 | Open in IMG/M |
3300025699|Ga0209715_1012103 | All Organisms → Viruses → Predicted Viral | 4887 | Open in IMG/M |
3300025751|Ga0208150_1110708 | All Organisms → Viruses → environmental samples → uncultured marine virus | 892 | Open in IMG/M |
3300025751|Ga0208150_1175516 | Not Available | 670 | Open in IMG/M |
3300025759|Ga0208899_1012003 | All Organisms → Viruses → Predicted Viral | 4736 | Open in IMG/M |
3300025759|Ga0208899_1186036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300025759|Ga0208899_1213823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Votkovvirus | 602 | Open in IMG/M |
3300025769|Ga0208767_1018943 | All Organisms → Viruses → Predicted Viral | 3899 | Open in IMG/M |
3300025769|Ga0208767_1185600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300025769|Ga0208767_1213128 | Not Available | 637 | Open in IMG/M |
3300025771|Ga0208427_1181001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 680 | Open in IMG/M |
3300025810|Ga0208543_1120616 | All Organisms → Viruses → environmental samples → uncultured marine virus | 620 | Open in IMG/M |
3300025810|Ga0208543_1173587 | Not Available | 500 | Open in IMG/M |
3300025815|Ga0208785_1003923 | Not Available | 6061 | Open in IMG/M |
3300025840|Ga0208917_1098625 | Not Available | 1070 | Open in IMG/M |
3300025889|Ga0208644_1083381 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
3300025889|Ga0208644_1102115 | Not Available | 1409 | Open in IMG/M |
3300025889|Ga0208644_1154985 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
3300025889|Ga0208644_1205105 | Not Available | 853 | Open in IMG/M |
3300031569|Ga0307489_11124442 | All Organisms → Viruses → environmental samples → uncultured marine virus | 565 | Open in IMG/M |
3300034374|Ga0348335_017767 | All Organisms → Viruses → Predicted Viral | 3542 | Open in IMG/M |
3300034374|Ga0348335_139087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → Desulfovibrio oxyclinae | 684 | Open in IMG/M |
3300034374|Ga0348335_159157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 605 | Open in IMG/M |
3300034418|Ga0348337_099404 | Not Available | 953 | Open in IMG/M |
3300034418|Ga0348337_105111 | Not Available | 908 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 54.14% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 23.31% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.01% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.26% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.26% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.26% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.26% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.50% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.50% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.50% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.75% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.75% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.75% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.75% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.75% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.75% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.75% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2011_100197181 | 3300000115 | Marine | LALGEGDSTEDHAAAILWNASAWAWTEEQIKNGKLPKELDDLGYRDDK* |
DelMOSpr2010_100959992 | 3300000116 | Marine | LGEGDSTEDHTAAILWNASAWAWTEEQIKEGNLPKELDDLGYRDEHKNTA* |
JGI20157J14317_100411337 | 3300001352 | Pelagic Marine | WNASAWAWTEDQIKNGKLPKELDDLGYREHESTDSL* |
JGI11705J14877_101694681 | 3300001419 | Saline Water And Sediment | AAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE* |
Ga0055584_1016558351 | 3300004097 | Pelagic Marine | DHAAAILWNASAWAWTEEQINKGNLPKELNDLGYREHESTDSL* |
Ga0074648_10136181 | 3300005512 | Saline Water And Sediment | LAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT* |
Ga0074647_10079262 | 3300005611 | Saline Water And Sediment | LGEGDNTEDHAAAILWNASAWCWTEDKIKQGKLPKELDDLGYREHE* |
Ga0075478_100645976 | 3300006026 | Aqueous | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE* |
Ga0075478_102358862 | 3300006026 | Aqueous | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYREHESTDSL* |
Ga0075461_100881123 | 3300006637 | Aqueous | AEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV* |
Ga0098054_11095182 | 3300006789 | Marine | LGEGDNTEDHAAAILWNASAWCWTEEQIKQGKLPKELDDLGYREHE* |
Ga0070749_102264351 | 3300006802 | Aqueous | AEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRDETHT* |
Ga0070749_102707033 | 3300006802 | Aqueous | EDHAAAILWNASAWCWTEEKIKEGKLPSELDDLGYRDE* |
Ga0070749_103272923 | 3300006802 | Aqueous | GAILWNASAWIWTEQKIKEGKLPQELADISYRDESTDSV* |
Ga0070749_103725573 | 3300006802 | Aqueous | SEDHAAAILWNASAWCWTEEKIKEGKLPSELDDLDYNNDAS* |
Ga0070749_107423901 | 3300006802 | Aqueous | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT* |
Ga0070749_107830751 | 3300006802 | Aqueous | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV* |
Ga0070754_102875123 | 3300006810 | Aqueous | EDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRGE* |
Ga0075476_103159382 | 3300006867 | Aqueous | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYREHESTDSV* |
Ga0075481_101506011 | 3300006868 | Aqueous | HAGAILWNASAWIWTEQKIKEGKLPSELDDISYRDE* |
Ga0075481_102762381 | 3300006868 | Aqueous | AAILWNASAWAWTEEQIKNGKLPKELDDLGYREHE* |
Ga0075481_102987613 | 3300006868 | Aqueous | GLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRDE* |
Ga0075477_102488061 | 3300006869 | Aqueous | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKQGKLPSELDDIGYREHE* |
Ga0075477_104137392 | 3300006869 | Aqueous | LWNASAWCWTEEKIKEGKLPSELDDIGYREHESTDSL* |
Ga0075479_100758241 | 3300006870 | Aqueous | AAILWNASAWAWTEEQIKNGKLPKELDDITYRSE* |
Ga0070750_100702911 | 3300006916 | Aqueous | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDLGYRDE* |
Ga0070750_101751321 | 3300006916 | Aqueous | LLALGEGDSTEDHTAAILWNASAWAWTEEQIKEGNLPKELDDLGYREHESTDSV* |
Ga0070750_101951971 | 3300006916 | Aqueous | AAILWNASAWCWTEEKIKEGKLPSELDDLGYRDESTDSV* |
Ga0070750_102882611 | 3300006916 | Aqueous | EGDNSEDHAAAILWNASAWCWTEEQIKEGKLPSELDDIGYRDESTDSV* |
Ga0070750_102986531 | 3300006916 | Aqueous | GAILWNASAWIWTEQKIKEGKLPKELSDISYRDEAHT* |
Ga0070750_104174871 | 3300006916 | Aqueous | LGEGDSTEDHTAAILWNASAWAWTEEQIKEGNLPQELDDLGYRDE* |
Ga0070750_104853672 | 3300006916 | Aqueous | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV* |
Ga0070746_101271161 | 3300006919 | Aqueous | DSTEDHTAAILWNASAWAWTEEQIKEGNLPKELDDLGYRSDK* |
Ga0070746_105208251 | 3300006919 | Aqueous | GDSTEDHTAAILWNASAWAWTEEQIKEGNLPQELDDLGYRDE* |
Ga0075460_100697711 | 3300007234 | Aqueous | LAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRDE* |
Ga0075463_100960461 | 3300007236 | Aqueous | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV* |
Ga0075463_102952941 | 3300007236 | Aqueous | HAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE* |
Ga0070747_11348751 | 3300007276 | Aqueous | DHTAAILWNASAWAWTEEQIKEGNLPKELDDLGYREYER* |
Ga0070745_10797574 | 3300007344 | Aqueous | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT* |
Ga0070745_11500821 | 3300007344 | Aqueous | EDHAAAILWNASAWIWTEQKIKEGKLPQELSDISYRDE* |
Ga0070745_12928961 | 3300007344 | Aqueous | SEDHAAAILWNASAWCWTEEKIKEGKLPKELSDISYRDESTDI* |
Ga0070752_11771341 | 3300007345 | Aqueous | ILWNASAWCWTEEKIKEGKLPSELDDIGYREHESTDSV* |
Ga0070753_11889222 | 3300007346 | Aqueous | EDHAAAILWNASAWCWTEEKIKEGKLPKELSDISYRDESTDI* |
Ga0070751_13113173 | 3300007640 | Aqueous | EGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE* |
Ga0099850_11688553 | 3300007960 | Aqueous | DHAAAILWNASAWAWTEEQIKNGKLPKELDDLGYREHE* |
Ga0102957_13417572 | 3300009027 | Pond Water | SEDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRSE* |
Ga0115572_102650571 | 3300009507 | Pelagic Marine | GDSTEDHAAAILWNASAWAWTEEQIKNGKLPKELDDLGYREHESTDSL* |
Ga0115572_107167361 | 3300009507 | Pelagic Marine | GDSTEDHAAAILWNASAWAWTEEQIKNGKLPKELDDLGYRDDK* |
Ga0129348_11479142 | 3300010296 | Freshwater To Marine Saline Gradient | AAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT* |
Ga0129348_12525413 | 3300010296 | Freshwater To Marine Saline Gradient | AAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE* |
Ga0129351_101028010 | 3300010300 | Freshwater To Marine Saline Gradient | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE* |
Ga0136656_10947791 | 3300010318 | Freshwater To Marine Saline Gradient | HLLGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPQELSDISYRGE* |
Ga0181407_10809284 | 3300017753 | Seawater | TAAILWNASAWAWTEEQINNGKLPKELDDLGYREHERQ |
Ga0181380_11143971 | 3300017782 | Seawater | HLLALGKGDNTEDHAAAILWNASAWAWTEEQINNGKLPKELDDLGYREHESTDSV |
Ga0181577_108172401 | 3300017951 | Salt Marsh | GDNSEDHAAAILWNASAWCWTEEKIKEGKIPQELSDISYRDESTDSV |
Ga0181571_108767731 | 3300017957 | Salt Marsh | LAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0181571_108915501 | 3300017957 | Salt Marsh | LAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNDAS |
Ga0181587_104144991 | 3300017968 | Salt Marsh | HAAAILWNASAWCWTEEKIKEGKLPSELDDLGYRDE |
Ga0181572_102258784 | 3300018049 | Salt Marsh | GLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNDAS |
Ga0181561_101354081 | 3300018410 | Salt Marsh | LAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDEAHT |
Ga0181553_101739071 | 3300018416 | Salt Marsh | SEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDEAHT |
Ga0181553_104139271 | 3300018416 | Salt Marsh | GLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRSE |
Ga0181558_102834273 | 3300018417 | Salt Marsh | WNASAWCWTEEKIKEGKLPSELDDIAYREHESTDSV |
Ga0181558_103157461 | 3300018417 | Salt Marsh | DHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDDAS |
Ga0181563_107415291 | 3300018420 | Salt Marsh | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0181593_106937224 | 3300018423 | Salt Marsh | EGDNSEDHAAAILWNASAWCWTEEKIKEGKLPKELDDIDYNNE |
Ga0181593_108642241 | 3300018423 | Salt Marsh | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDISYRDE |
Ga0181593_110624173 | 3300018423 | Salt Marsh | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDISYREHE |
Ga0181591_103174084 | 3300018424 | Salt Marsh | LAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDDAS |
Ga0181591_110528253 | 3300018424 | Salt Marsh | EGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDISYREHE |
Ga0181564_100453199 | 3300018876 | Salt Marsh | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNER |
Ga0193973_10288382 | 3300019737 | Sediment | MFRHLLGLAEGDNSEDHAVAILWNASAWIWTEQKIKEGKLPSELDDIGYRDE |
Ga0194023_10274216 | 3300019756 | Freshwater | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0194023_10420441 | 3300019756 | Freshwater | EGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0194024_10391844 | 3300019765 | Freshwater | EDHAAAILWNASAWCWTEEKIKEGKLPKELDDLGYRNDEHER |
Ga0181605_102480521 | 3300020188 | Salt Marsh | DNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0211504_11064161 | 3300020347 | Marine | HLLALGEGDSTEDHAAAILWNASAWAWTEEQINNGKLPKELNDLGYREHE |
Ga0213865_105018003 | 3300021373 | Seawater | DHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0213868_100243671 | 3300021389 | Seawater | HTAAILWNASAWAWTEEQIKNGKLPKELDDITYRSE |
Ga0222715_103212694 | 3300021960 | Estuarine Water | GLAEADNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0212021_10550981 | 3300022068 | Aqueous | SEDHAAAILWNASAWIWTEQKIKEGKLPSELDDITYRDETHT |
Ga0212027_10182403 | 3300022168 | Aqueous | DHAGAILWNASAWIWTEQKIKEGKLPQELSDISYRDESTDSV |
Ga0196891_10263611 | 3300022183 | Aqueous | SEDHAAAILWNASAWIWTEQKIKEGKLPSELDDIGYRDETHT |
Ga0196891_10316931 | 3300022183 | Aqueous | LLGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0196891_10321311 | 3300022183 | Aqueous | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV |
Ga0196899_10356981 | 3300022187 | Aqueous | DSTEDHTAAILWNASAWAWTEEQIKNGKLPKELDDITYRSE |
Ga0196899_11886983 | 3300022187 | Aqueous | HAAAILWNASAWCWTEEKIKEGKLPKELDDIGHRDE |
Ga0255771_11877691 | 3300022900 | Salt Marsh | GLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDEAHT |
Ga0255783_101149004 | 3300022923 | Salt Marsh | AILWNASAWCWTEEKIKEGKLPSELDDIGYRDEAHT |
Ga0255783_103920771 | 3300022923 | Salt Marsh | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPKELDDIGYRDE |
Ga0255773_101291243 | 3300022925 | Salt Marsh | SEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT |
Ga0255758_101186331 | 3300022928 | Salt Marsh | GLAEGDNSEDHAAAILWNASAWCWTEEQIKEGKLPSELDDIDYNNE |
Ga0255758_101277553 | 3300022928 | Salt Marsh | DHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDEAHT |
Ga0255752_100987045 | 3300022929 | Salt Marsh | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDEAHT |
Ga0255752_101686091 | 3300022929 | Salt Marsh | EDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRDE |
Ga0255752_101727671 | 3300022929 | Salt Marsh | EGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRSE |
Ga0255752_102417841 | 3300022929 | Salt Marsh | AEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDDAS |
Ga0255762_101854411 | 3300023119 | Salt Marsh | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0255777_101326461 | 3300023175 | Salt Marsh | LLGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNDAS |
Ga0255759_101121107 | 3300023178 | Salt Marsh | HSEDHAAAILWNASAWCWTEEQIKEGKLPSELDDIGYRDE |
(restricted) Ga0255040_102893802 | 3300024059 | Seawater | LGEGDNTEDHAAAILWNASAWAWTEEQINNGKLPKELDDLGYREYES |
Ga0208434_10134542 | 3300025098 | Marine | LGEGDNTEDHAAAILWNASAWAWTEEQIKQGKLPKELDDLGYRDE |
Ga0209337_13391231 | 3300025168 | Marine | AEDHLGAILWNASAWMWTEQAIKDGRLPHELNDLTYK |
Ga0208149_10482891 | 3300025610 | Aqueous | EDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0208004_10652211 | 3300025630 | Aqueous | DHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV |
Ga0208004_11240071 | 3300025630 | Aqueous | DHAAAILWNASAWCWTEEKIKEGKLPSELDDITYRSE |
Ga0208428_10126218 | 3300025653 | Aqueous | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0208898_10167451 | 3300025671 | Aqueous | AAILWNASAWCWTEQKIKEGKLPKELDDIGYRNDEHE |
Ga0208898_10663461 | 3300025671 | Aqueous | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT |
Ga0209715_10121031 | 3300025699 | Pelagic Marine | HLLALGEGDSTEDHAAAILWNASAWAWTEDQINNGKLPKELDDLGYREHESTDSL |
Ga0208150_11107081 | 3300025751 | Aqueous | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0208150_11755162 | 3300025751 | Aqueous | LLGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYREHE |
Ga0208899_10120039 | 3300025759 | Aqueous | HTAAILWNASAWAWTEEQIKEGNLPKELDDLGYRSDK |
Ga0208899_11860361 | 3300025759 | Aqueous | AAAILWNASAWCWTEEKIKEGKLPSELDDLDYNNDAS |
Ga0208899_12138233 | 3300025759 | Aqueous | AAAILWNASAWCWTEEKIKEGKLPSELDDLGYRDE |
Ga0208767_101894310 | 3300025769 | Aqueous | LLGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDLGYRDE |
Ga0208767_11856002 | 3300025769 | Aqueous | DHAAAILWNASAWCWTEEKIKEGKLPSELDDLDYNNDAS |
Ga0208767_12131282 | 3300025769 | Aqueous | GDNSEDHAAAILWNASAWCWTEDKIKQGKLPSELDDIGYRDETHT |
Ga0208427_11810013 | 3300025771 | Aqueous | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0208543_11206164 | 3300025810 | Aqueous | HAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0208543_11735871 | 3300025810 | Aqueous | HAAAILWNASAWCWTEEKIKEGKLPSELDDITYRSE |
Ga0208785_10039231 | 3300025815 | Aqueous | SEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0208917_10986251 | 3300025840 | Aqueous | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYREHE |
Ga0208644_10833811 | 3300025889 | Aqueous | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDESTDSV |
Ga0208644_11021151 | 3300025889 | Aqueous | ILWNASAWCWTEEKIKEGKLPSELDDIGYRDETHT |
Ga0208644_11549853 | 3300025889 | Aqueous | HAAAILWNASAWCWTEEKIKEGKLPSELDDITYRDETHT |
Ga0208644_12051051 | 3300025889 | Aqueous | AILWNASAWIWTEQKIKEGKLPQELADISYRDESTDSV |
Ga0307489_111244421 | 3300031569 | Sackhole Brine | EGDNTEDHTAAILWNASAWAWTEEQINNGKLPKELDDLGYRDER |
Ga0348335_017767_3_119 | 3300034374 | Aqueous | AAAILWNASAWCWTEEKIKEGKLPKELDDIGYRNEEHE |
Ga0348335_139087_3_116 | 3300034374 | Aqueous | DHAAAILWNASAWCWTEEKIKEGKLPSELDDIDYNNE |
Ga0348335_159157_1_123 | 3300034374 | Aqueous | NSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYRDE |
Ga0348337_099404_791_952 | 3300034418 | Aqueous | LGLAEGDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYREHESTDSL |
Ga0348337_105111_1_147 | 3300034418 | Aqueous | GDNSEDHAAAILWNASAWCWTEEKIKEGKLPSELDDIGYREHESTDSV |
⦗Top⦘ |