NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060377

Metagenome / Metatranscriptome Family F060377

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060377
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 39 residues
Representative Sequence MHTFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Number of Associated Samples 117
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.79 %
% of genes near scaffold ends (potentially truncated) 20.30 %
% of genes from short scaffolds (< 2000 bps) 90.98 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.549 % of family members)
Environment Ontology (ENVO) Unclassified
(36.090 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.835 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 52.24%    β-sheet: 0.00%    Coil/Unstructured: 47.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF16798DUF5069 42.86
PF03364Polyketide_cyc 24.81
PF02566OsmC 6.77
PF13515FUSC_2 3.76
PF10604Polyketide_cyc2 1.50
PF00989PAS 0.75
PF03466LysR_substrate 0.75
PF00070Pyr_redox 0.75
PF07681DoxX 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 6.77
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 6.77
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.75
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.25 %
UnclassifiedrootN/A0.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02GHW5FAll Organisms → cellular organisms → Bacteria510Open in IMG/M
2170459016|G1P06HT01DONLAAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia507Open in IMG/M
2189573002|GZIGXIF01B36JDAll Organisms → cellular organisms → Bacteria519Open in IMG/M
2189573004|GZGWRS402FOP2LAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
3300000559|F14TC_104010439All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia556Open in IMG/M
3300004463|Ga0063356_102409890All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300005164|Ga0066815_10097889All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005181|Ga0066678_10692954All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300005186|Ga0066676_10564241All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005289|Ga0065704_10327039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia843Open in IMG/M
3300005367|Ga0070667_101013135All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300005435|Ga0070714_101378388All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia688Open in IMG/M
3300005450|Ga0066682_10135094All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1565Open in IMG/M
3300005457|Ga0070662_101257142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia637Open in IMG/M
3300005540|Ga0066697_10647701All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005554|Ga0066661_10272824All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005555|Ga0066692_10488865All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300005566|Ga0066693_10044983All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300005569|Ga0066705_10023287All Organisms → cellular organisms → Bacteria3232Open in IMG/M
3300005764|Ga0066903_103100979All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300005843|Ga0068860_101919389All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005843|Ga0068860_102322397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia557Open in IMG/M
3300006046|Ga0066652_100788960All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300006163|Ga0070715_10596896All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300006800|Ga0066660_10928793All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300006881|Ga0068865_100931699All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300007255|Ga0099791_10013974All Organisms → cellular organisms → Bacteria3397Open in IMG/M
3300007258|Ga0099793_10095197All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300009012|Ga0066710_102021007All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia853Open in IMG/M
3300009090|Ga0099827_10291917All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1378Open in IMG/M
3300009137|Ga0066709_100357674All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2009Open in IMG/M
3300009176|Ga0105242_10598361All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1065Open in IMG/M
3300010154|Ga0127503_10533070All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1266Open in IMG/M
3300010325|Ga0134064_10049509All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300010335|Ga0134063_10416653All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300010335|Ga0134063_10427017All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia654Open in IMG/M
3300010375|Ga0105239_13440696All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300010861|Ga0126349_1264581All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia808Open in IMG/M
3300012198|Ga0137364_10397144All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1032Open in IMG/M
3300012207|Ga0137381_10353654All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1281Open in IMG/M
3300012211|Ga0137377_10799010All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300012285|Ga0137370_10009855All Organisms → cellular organisms → Bacteria4526Open in IMG/M
3300012285|Ga0137370_10733034All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300012349|Ga0137387_10235490All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1318Open in IMG/M
3300012354|Ga0137366_10329569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1120Open in IMG/M
3300012356|Ga0137371_10786953All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300012357|Ga0137384_10186204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1738Open in IMG/M
3300012361|Ga0137360_10680877All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia883Open in IMG/M
3300012361|Ga0137360_11375665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia608Open in IMG/M
3300012685|Ga0137397_10085773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2295Open in IMG/M
3300012917|Ga0137395_10795112All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia685Open in IMG/M
3300012918|Ga0137396_10120161All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1893Open in IMG/M
3300012918|Ga0137396_10529630All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia873Open in IMG/M
3300012929|Ga0137404_11341657All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia660Open in IMG/M
3300012930|Ga0137407_10671971All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia975Open in IMG/M
3300012941|Ga0162652_100019758All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300012955|Ga0164298_10142039All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300012958|Ga0164299_10160942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1254Open in IMG/M
3300012958|Ga0164299_10326560All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300012961|Ga0164302_11166576All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia613Open in IMG/M
3300012972|Ga0134077_10495940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia540Open in IMG/M
3300012984|Ga0164309_10787054All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia764Open in IMG/M
3300012986|Ga0164304_11531504All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia553Open in IMG/M
3300012987|Ga0164307_11224531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia623Open in IMG/M
3300012988|Ga0164306_10124122All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300012989|Ga0164305_10232146All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1320Open in IMG/M
3300015371|Ga0132258_13147792All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1140Open in IMG/M
3300015372|Ga0132256_100917127All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia992Open in IMG/M
3300015372|Ga0132256_103236166All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia548Open in IMG/M
3300015373|Ga0132257_101093937All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1006Open in IMG/M
3300015373|Ga0132257_101425441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia882Open in IMG/M
3300017657|Ga0134074_1334179All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300017997|Ga0184610_1027769All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1568Open in IMG/M
3300018000|Ga0184604_10249745All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia620Open in IMG/M
3300018000|Ga0184604_10289621All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300018027|Ga0184605_10278695All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300018028|Ga0184608_10461755All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia546Open in IMG/M
3300018056|Ga0184623_10086053All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300018066|Ga0184617_1054750All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1024Open in IMG/M
3300018066|Ga0184617_1067162All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia947Open in IMG/M
3300018067|Ga0184611_1088997All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1064Open in IMG/M
3300018071|Ga0184618_10261551All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia733Open in IMG/M
3300018073|Ga0184624_10064016All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1518Open in IMG/M
3300018073|Ga0184624_10135492All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1075Open in IMG/M
3300018075|Ga0184632_10049803All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300018076|Ga0184609_10053112All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1734Open in IMG/M
3300018433|Ga0066667_12287874All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300019789|Ga0137408_1003310All Organisms → cellular organisms → Bacteria1986Open in IMG/M
3300019866|Ga0193756_1003620All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300019875|Ga0193701_1033129All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1060Open in IMG/M
3300019876|Ga0193703_1001127All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3824Open in IMG/M
3300019879|Ga0193723_1047741All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1262Open in IMG/M
3300019883|Ga0193725_1076889All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300019885|Ga0193747_1127370All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300019886|Ga0193727_1028804All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300019996|Ga0193693_1026932All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1029Open in IMG/M
3300019998|Ga0193710_1009703All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia970Open in IMG/M
3300020000|Ga0193692_1087174All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300020016|Ga0193696_1101939All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia737Open in IMG/M
3300020062|Ga0193724_1063923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia772Open in IMG/M
3300021078|Ga0210381_10084366All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300021080|Ga0210382_10024299All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300021086|Ga0179596_10444789All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia656Open in IMG/M
3300021411|Ga0193709_1048974All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300021415|Ga0193694_1051090All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300021951|Ga0222624_1106424All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia625Open in IMG/M
3300025915|Ga0207693_11401039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia519Open in IMG/M
3300025918|Ga0207662_10225376All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300025930|Ga0207701_10147584All Organisms → cellular organisms → Bacteria2086Open in IMG/M
3300025930|Ga0207701_10278499All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300025930|Ga0207701_10632621All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300026306|Ga0209468_1162566All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia570Open in IMG/M
3300026324|Ga0209470_1298848All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300026329|Ga0209375_1084035All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1468Open in IMG/M
3300026374|Ga0257146_1003849All Organisms → cellular organisms → Bacteria2500Open in IMG/M
3300026557|Ga0179587_10953781All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300027560|Ga0207981_1093204All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300028714|Ga0307309_10134281All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia615Open in IMG/M
3300028803|Ga0307281_10044407All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300030777|Ga0075402_11510877All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300030844|Ga0075377_11715013All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1378Open in IMG/M
3300030923|Ga0138296_1529774All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia769Open in IMG/M
3300031015|Ga0138298_1038387All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031015|Ga0138298_1613249All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia825Open in IMG/M
3300031057|Ga0170834_101326722All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300031231|Ga0170824_113835730All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300031231|Ga0170824_117977165All Organisms → cellular organisms → Bacteria9883Open in IMG/M
3300031231|Ga0170824_126612133All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031474|Ga0170818_101344670All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia537Open in IMG/M
3300031719|Ga0306917_10432159All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300031720|Ga0307469_10951094All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium799Open in IMG/M
3300033412|Ga0310810_10217314All Organisms → cellular organisms → Bacteria2140Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.29%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment10.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.76%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere2.26%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.50%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.50%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.75%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.75%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_007302502170459010Grass SoilMLLSFVVVWFTQLRAREFDAATFRSFAGEAATVHGFF
2ZMR_040379202170459016Switchgrass, Maize And Mischanthus LitterLSFTFVWFMPLRARGFDAATFGSFAGEAATLHGFF
FE1_011472202189573002Grass SoilMHTFLPFVVVWFTQLPAREFDAATFRSFADEAATVRDFF
FG2_100804402189573004Grass SoilFLSFVVVGVTPLRAREFDAATFRSFDEAATVRGFF
F14TC_10401043923300000559SoilMFLPFVVVWFTQLRAREFDAATFRSFAGEAVTVHGFF*
Ga0063356_10240989023300004463Arabidopsis Thaliana RhizosphereMHTFLPFVVVWFTPLRAPEFDAATFRSLSDEATKVHGFF*
Ga0066815_1009788923300005164SoilMHIFLPFAIVWFTPLRAREFDAATFRSFADEAATAPGFF*
Ga0066678_1069295413300005181SoilMHIFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF*
Ga0066676_1056424123300005186SoilMHIFLPFGVVWFSQLRAREFDAATFRSFAGEAATVRGFF*
Ga0065704_1032703923300005289Switchgrass RhizosphereMHMFLSFVVVWFRQLRAREFDAVTFRSFADEAATVRGFFSHSVFR*
Ga0070667_10101313523300005367Switchgrass RhizosphereMHIFLSFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF*
Ga0070714_10137838813300005435Agricultural SoilFHFFEVLMHPFLPFVVVWFTQLRAREFYAATFRSFADEAATKRGSF*
Ga0066682_1013509443300005450SoilMHTFLPFVVVSLRRLRAGEFDAATFPSLAGEAAALRVFF*
Ga0070662_10125714223300005457Corn RhizosphereMHTFLPFVVDWFTPLRAREFDAATFRSFADEAATAPGFF*
Ga0066697_1064770123300005540SoilMFLPFVVVWFTQLRAREFEAATFRSFAGEAATLRGFF*
Ga0066661_1027282423300005554SoilMFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF*
Ga0066692_1048886523300005555SoilMFLPFVVVWFTQLRAREFDAATFRRFAGEAATVRGFF*
Ga0066693_1004498333300005566SoilMHTFLPFVAVWFTQLRGGEFDAATFRSFAGEATTVRGFF*
Ga0066705_1002328713300005569SoilMHTFLPFVAGWFTQLRGGEFDAATFRSFAGEATTVRGFF*
Ga0066903_10310097923300005764Tropical Forest SoilMHTFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF*
Ga0068860_10191938923300005843Switchgrass RhizosphereMHIFLPFAIVWFTPLRAREFDAATFRSFVDEAATAPGFF*
Ga0068860_10232239723300005843Switchgrass RhizosphereKVLMHTFLSFVVVWFTPLRAREFYAATFRSFDEAATVRGFF*
Ga0066652_10078896023300006046SoilMFLPFVVVWFTQLRAREFDAATLRSFAGEAATVRGFF*
Ga0070715_1059689613300006163Corn, Switchgrass And Miscanthus RhizosphereMHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVPGFF*
Ga0066660_1092879323300006800SoilMHMFLPFVVVWFTQLRAREFEAATFRSFAGEAATLRGFF*
Ga0068865_10093169923300006881Miscanthus RhizosphereMHTFLPFVVIWFTQLRAREFDAATFRSFADEAATLRGFF*
Ga0099791_1001397413300007255Vadose Zone SoilMFLPFVVFWFTQLRAREFDAVIFRSFVGEAATVRGFF*
Ga0099793_1009519733300007258Vadose Zone SoilMFLPFVVVSFTQLRARESDAATFRSFAGEPTTVRGFF*
Ga0066710_10202100723300009012Grasslands SoilMHTFLPFVVVWFTPLRAREFDAATFRSFADEAATVRGFF
Ga0099827_1029191723300009090Vadose Zone SoilMFLPFVVVWFTQLRAREFDAATFRSFAGEAMTVRGFF*
Ga0066709_10035767433300009137Grasslands SoilMHTFLPFVVVWFTPLRAREFDAATFRSFAGEAATVRGFF*
Ga0105242_1059836113300009176Miscanthus RhizosphereFLPFAIVWFTPLRAREFDAATFRSFVDEAATAPGFF*
Ga0105237_1186549313300009545Corn RhizosphereQFHFFKVLMHTFLSFVVVWVTPLSAREFYAATFRSFDEAATVRGFF*
Ga0127503_1053307023300010154SoilMHTFSSFVVVCFTPLRAREFYGATFRSFDEAATVRGFF*
Ga0134064_1004950923300010325Grasslands SoilMHTFLPFVVVWFTPLRAREFDAATFRSFAGEATTVRGFF*
Ga0134063_1041665313300010335Grasslands SoilMFLPFVVVWFTQLRAREFDVATFRRFAGEAATVRGFF*
Ga0134063_1042701713300010335Grasslands SoilTFLPFVAGWFTQLRGGEFDAATFRSFAGEATTVRGFF*
Ga0105239_1344069623300010375Corn RhizosphereMHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVRGFF*
Ga0126349_126458113300010861Boreal Forest SoilVLMHMFLPFVVVSFTQLRARGSDAATFRSFAGEAATVRGFF*
Ga0137364_1039714423300012198Vadose Zone SoilMHTFLPFMAVWFTQLRGGEFDAATFRSFAGEATTVRGFF*
Ga0137381_1035365423300012207Vadose Zone SoilMFLPFVVVWFMQLRAREFDAATFRNFAGEAATVRGFF*
Ga0137377_1079901013300012211Vadose Zone SoilMHVFLPFGVVWFSQLRAREFDAATFRSFAGEAATVRGFF*
Ga0137370_1000985513300012285Vadose Zone SoilFFKVLMHTFLPFVAVWFTQLRGGEFDAATFRSFAGEATTVRGFF*
Ga0137370_1073303423300012285Vadose Zone SoilMFLPFVVVWFTQLRAREFDVATFRSFAGEAATVRGFF*
Ga0137387_1023549033300012349Vadose Zone SoilMFLPFVVVWFTPLRAREFDAATFRSFADEAATVRGFF*
Ga0137366_1032956923300012354Vadose Zone SoilMFLPFVVVWFTQLRAREFDAATFRSFAGEAATMRGFF*
Ga0137371_1078695323300012356Vadose Zone SoilMHTFLPFVVVWFTPLRAREFDAATFRNFAGEAATVRGFF*
Ga0137384_1018620423300012357Vadose Zone SoilMFLPFVVVWFTQLRAREFDAATVRRFAGEAATVRGFF*
Ga0137360_1068087723300012361Vadose Zone SoilMFLPFVVVWFTQLRARDFDAATFRSFSGEEATVRGFF*
Ga0137360_1137566523300012361Vadose Zone SoilLHFFKVFVHIFLSFTVVWFTPVRARGFDAATFGSFAGEAATLRGFF*
Ga0137397_1008577353300012685Vadose Zone SoilMHTFLSFVVVWFTPLFAREFDAATFRSFDEAATVRGFF*
Ga0137395_1079511223300012917Vadose Zone SoilMFLRFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF*
Ga0137396_1012016133300012918Vadose Zone SoilMHTFLPFVVVWVTPLRAREFDAATFRSFDEAATVRGFF*
Ga0137396_1052963023300012918Vadose Zone SoilMFLPFVVVWFTQLRAREFDAATFRSFAGEATTVRGFF*
Ga0137404_1134165723300012929Vadose Zone SoilHFFKVLMHMFLPFVVVWFTQLRAREFDAATFRSFSDEAATVRGFF*
Ga0137407_1067197123300012930Vadose Zone SoilMFLPFVVVWFTQLRAREFDAATFRSFSDEAATVRGFF*
Ga0162652_10001975813300012941SoilMSLPFVVVWVTQLRAREFDAATFRSFAGEAATVRGFF*
Ga0164298_1014203933300012955SoilMHTFLSFVVVWFTPLRAHEFDAATFRSFDEAATVPGFF*
Ga0164299_1016094233300012958SoilSSFVVVCFTPLRAREFYGATFRSFDEAATVRGFF*
Ga0164299_1032656043300012958SoilMHTFLSFVVVWFTPLRAREFDAATFRSFADEAATVSGFF*
Ga0164302_1116657613300012961SoilKVLLHIFLPFVVVWFTPLRAREFDAAPFRSFADEAATAPGFF*
Ga0134077_1049594023300012972Grasslands SoilHTFLPFVAVWSTQLRGGEFDAATFRSFAGEAATVRGFF*
Ga0164309_1078705423300012984SoilMHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVAGFF*
Ga0164304_1153150423300012986SoilFFKVLMHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVPGFF*
Ga0164307_1122453123300012987SoilMHPFLPFVVVWFTQLRAREFDAAIFRSFADEAATVRGFF*
Ga0164306_1012412233300012988SoilMHTFLSFVVVWFTPLRAREFDAATFRSFADEAATVRGFF*
Ga0164305_1023214623300012989SoilMHPFLPFVVVWFTQLRARELDAATFRSFADEAATVRGFF*
Ga0132258_1314779223300015371Arabidopsis RhizosphereMHIFLSFVVVWFTQLCAREFDAATFRSFAGEAATVRGFF*
Ga0132256_10091712733300015372Arabidopsis RhizosphereMHIFLPFAIVWFTPLRAREFDAATFRGFADEAATAPGFF*
Ga0132256_10323616623300015372Arabidopsis RhizosphereMHILLPFAIVWFMQLRAREFDAATFRSFAAVAATAPGFF*
Ga0132257_10109393713300015373Arabidopsis RhizosphereMHRFLPFVVVWFTPLRAREFDAATFPSFAEAATVRGFF*
Ga0132257_10142544113300015373Arabidopsis RhizosphereQFHFFKVLMHIFLSFVVVWFTQLRAREFNAATFRSFAGEAATVRGFF*
Ga0134074_133417923300017657Grasslands SoilMHTFLPFVVVSLRRLRAGEFDAATFPSLAGEAATLRVFF
Ga0184610_102776923300017997Groundwater SedimentMFLPFVVVGFTQLRARESDAATFRSFAGEAATVRGFF
Ga0184604_1024974523300018000Groundwater SedimentMFLPFVVVSFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0184604_1028962123300018000Groundwater SedimentMHTFLPFVVVWFTPLRAREFGAATFRNFAGEAATVRGFF
Ga0184605_1027869523300018027Groundwater SedimentMFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0184608_1046175523300018028Groundwater SedimentMFLPFVVVRFTQLRVREFDAATFRSFAGEAATVRGFF
Ga0184623_1008605323300018056Groundwater SedimentMFLPFVVVWFMQLHAREFDAATFRSFAGEAATVRGFF
Ga0184617_105475033300018066Groundwater SedimentMFLPFVVVSFTQLRAREFDAATFRSFAGEAAMVRTFF
Ga0184617_106716223300018066Groundwater SedimentMHTFLPFVVVWFTPLRAREFDAATFRSLSDEATKVHGFF
Ga0184611_108899723300018067Groundwater SedimentMSLPFVVVWLTQLRAREFDAATFRSFAGEAATVRGFF
Ga0184618_1026155123300018071Groundwater SedimentMHIFLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0184624_1006401623300018073Groundwater SedimentMSLPFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0184624_1013549223300018073Groundwater SedimentMHIFLPFAIVWFTPLRAREFDAATFRSFADEAATAPGFF
Ga0184632_1004980333300018075Groundwater SedimentMFLTFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0184609_1005311223300018076Groundwater SedimentMFLPFVVVWFMQLHAREFDAATFRSFSGEAATVRGFF
Ga0066667_1228787423300018433Grasslands SoilMFLPFVVVWFTPLRAREFDAATFRSFADEAATVRGFF
Ga0137408_100331043300019789Vadose Zone SoilMFLPFVVVWFTQLRAREFDAATFRSFSDEAATVRGFF
Ga0193756_100362033300019866SoilMHIFLSFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0193701_103312913300019875SoilVLMHIFLPFAIVWFTPLRVREFDAATFRSFSDEAATAPGFF
Ga0193703_100112733300019876SoilMHIFLPFAIVWFTPLRVREFDAATFRSFSDEAATAPGFF
Ga0193723_104774123300019879SoilMHIFLPFAIVWFTQLPAREFGAATFRSFADEGAMVRGFF
Ga0193725_107688933300019883SoilMHAFLPFVVVWFTQLRAREFDAATFRSFADEAATVRGFF
Ga0193747_112737023300019885SoilMHTFLSFVVVWFTPLRAREFDAATFRSFDEPATVCGFF
Ga0193727_102880423300019886SoilMHTFLSFVVVWFTPLRAREFDAATFRSFDEAATVRGFF
Ga0193693_102693213300019996SoilFKVLMHTFLPFVVVWVTPLRAREFDAATFRSFDEAATVRGFF
Ga0193710_100970323300019998SoilMFLPFVVVWFTQLRARESDAATFRSFAGEAATVRGFF
Ga0193692_108717423300020000SoilMHTFLSFVVVWFTPLCAREFDAATFRSFDEAATVRGFF
Ga0193696_110193933300020016SoilVLMHMFLPFVVVWFMQLRAREFDAATFRSFAGEAATVRGFF
Ga0193724_106392323300020062SoilFLSFVVVWFTQLRAREFDAATFRSFAGEAATVRGFF
Ga0210381_1008436633300021078Groundwater SedimentMFLPFVAVGFTQLRARESDAATFRSFAGEAATVRGFF
Ga0210382_1002429923300021080Groundwater SedimentMFLPFVVVWFTQLRAREFDAATFRSFADEAATVRGFF
Ga0179596_1044478923300021086Vadose Zone SoilMFLPFVVVSFTQLRARESDAATFRSFAGEPATVRGFF
Ga0193709_104897413300021411SoilMFLPFVVVWFTQLRAESDAATFRSFAGEAPTVRGFF
Ga0193694_105109013300021415SoilMFLPFVVVWFTQLRAREFDAATLQSFAGDAPTVRGFF
Ga0222624_110642423300021951Groundwater SedimentVLMHMFLPFVAVGFTQLRARESDAATFRSFAGEAATVRGFF
Ga0207693_1140103923300025915Corn, Switchgrass And Miscanthus RhizosphereFFKVLHTLLPFVVVRFTQLRAREFDAATFRSFADEAATVRGFF
Ga0207662_1022537633300025918Switchgrass RhizosphereMHTFLSFVVVWFTPLRVREFYAATFRSFDEAATVRGFF
Ga0207701_1014758453300025930Corn, Switchgrass And Miscanthus RhizosphereMHTFLSFVVVWFTPLRAREFYAATFRSFDEAATVRGFF
Ga0207701_1027849923300025930Corn, Switchgrass And Miscanthus RhizosphereMHTFLPFVVDWFTPLRAREFDAATFRSFADEAATAPGFF
Ga0207701_1063262123300025930Corn, Switchgrass And Miscanthus RhizosphereMHIFLPFAIVWFTPLRAREFDAATFRSFVDEAATAPGFF
Ga0209468_116256623300026306SoilMHTFLPFVAVWFTQLRGGEFDAATFRSFAGEATTVRGFF
Ga0209470_129884823300026324SoilMHIFLPFGVVWFSQLRAREFDAATFRSFAGEAATVRGFF
Ga0209375_108403523300026329SoilMHTFLPFVVVSLRRLRAGEFDAATFPSLAGEAAALRVFF
Ga0257146_100384943300026374SoilMHTFLPFVVVWVTPLRAREFYAATFRSFDEAATVRGFF
Ga0179587_1095378123300026557Vadose Zone SoilMFLPFVVVSFTQLRARESDAATFRSFAGEPTTVRGFF
Ga0207981_109320423300027560SoilMHIFLPFAIVWFTPLRAREFDAATFRGFADEAATAPGFF
Ga0307309_1013428113300028714SoilHFFKVLMHIFLPFAIVWFTPLRVREFDAATFRSFSDEAATAPGFF
Ga0307281_1004440733300028803SoilMHIFLPFAIVWFMQLRAREFDAATFRSFADVAATAPGFF
Ga0075402_1151087713300030777SoilMHTFLSFVVVWFTPLRAREFDAATFRSFAEAATVRGFF
Ga0075377_1171501323300030844SoilMHIFLPFVVVCFTQLRAREFDAVTFRSFAGEAATVRGFF
Ga0138296_152977433300030923SoilFFFTFVWFTSLRAHGFDAATFGSFAGEAATLRRFF
Ga0138298_103838723300031015SoilVHVFLSFAFVWFTSLRAQGFDAATFGSFAGEAATLRRFF
Ga0138298_161324923300031015SoilVHIFLSFTFVWFMPVRARGFRAATFGSFAGEAVTLRGFF
Ga0170834_10132672223300031057Forest SoilMHTFLPFVVVWFTQLCALEFDAANFQSFADEAATVRGLF
Ga0170824_11383573033300031231Forest SoilMHTFLPFVVVWFTQLPAREFDAATFRSFADEAATVRDLF
Ga0170824_11797716563300031231Forest SoilMHTFLLFVVVCFTQLRAREFDAATFRSFADEAATVRGFF
Ga0170824_12661213313300031231Forest SoilMFLTFVVVWFTQLRARESDAATFRSFAGEAATVRGFF
Ga0170818_10134467013300031474Forest SoilVLLHRFLPSVAVWFTQLRARESDAATFRSFAGEAATVRGFF
Ga0306917_1043215923300031719SoilVHVFLSFTFVWFTPLRARGFDAATFRGLAGEAATLRGFF
Ga0307469_1095109413300031720Hardwood Forest SoilMHTFLPFVVVWFTPLRAREFDAVTFRSFADEAATVRG
Ga0310810_1021731423300033412SoilMHAFLFFVVVWFTPLRAREFDAATFRSFADEAATVRGFF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.