NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060330

Metagenome / Metatranscriptome Family F060330

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060330
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 82 residues
Representative Sequence LTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Number of Associated Samples 106
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 14.39 %
% of genes near scaffold ends (potentially truncated) 56.39 %
% of genes from short scaffolds (< 2000 bps) 87.22 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.489 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.812 % of family members)
Environment Ontology (ENVO) Unclassified
(60.150 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(59.398 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 73.42%    β-sheet: 0.00%    Coil/Unstructured: 26.58%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF00520Ion_trans 1.50
PF00027cNMP_binding 1.50
PF07885Ion_trans_2 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.25 %
UnclassifiedrootN/A0.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000120|SA_S2_NOR13_50mDRAFT_c1022331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum924Open in IMG/M
3300003860|Ga0031658_1100478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300005043|Ga0071100_1080298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300005516|Ga0066831_10062948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1003Open in IMG/M
3300005838|Ga0008649_10059909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1654Open in IMG/M
3300006165|Ga0075443_10120411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum913Open in IMG/M
3300006396|Ga0075493_1415275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum918Open in IMG/M
3300007513|Ga0105019_1039237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2955Open in IMG/M
3300007513|Ga0105019_1041562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2845Open in IMG/M
3300007513|Ga0105019_1043118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2773Open in IMG/M
3300007513|Ga0105019_1045491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2677Open in IMG/M
3300007513|Ga0105019_1057725All Organisms → Viruses → Predicted Viral2283Open in IMG/M
3300007513|Ga0105019_1086032All Organisms → Viruses → Predicted Viral1746Open in IMG/M
3300007554|Ga0102820_1040772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1132Open in IMG/M
3300007557|Ga0102821_1167527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300007718|Ga0102852_1103826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300007862|Ga0105737_1156593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300008108|Ga0114341_10076749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2087Open in IMG/M
3300008113|Ga0114346_1183671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300008952|Ga0115651_1152123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1625Open in IMG/M
3300008993|Ga0104258_1060138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300009003|Ga0102813_1037129All Organisms → Viruses → Predicted Viral1710Open in IMG/M
3300009077|Ga0115552_1107850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1199Open in IMG/M
3300009080|Ga0102815_10179863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1163Open in IMG/M
3300009172|Ga0114995_10678184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300009265|Ga0103873_1127927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300009432|Ga0115005_11015463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300009432|Ga0115005_11427259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300009432|Ga0115005_11721226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300009436|Ga0115008_11266507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300009441|Ga0115007_10085468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1996Open in IMG/M
3300009441|Ga0115007_11315252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300009470|Ga0126447_1038299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1191Open in IMG/M
3300009497|Ga0115569_10073155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1804Open in IMG/M
3300009497|Ga0115569_10117974All Organisms → Viruses → Predicted Viral1312Open in IMG/M
3300009507|Ga0115572_10728634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300009508|Ga0115567_10674343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300009538|Ga0129287_10031635All Organisms → Viruses → Predicted Viral2286Open in IMG/M
3300009599|Ga0115103_1617264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300009677|Ga0115104_10012213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300009677|Ga0115104_11221032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300009679|Ga0115105_11424646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300010354|Ga0129333_10129560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2320Open in IMG/M
3300010883|Ga0133547_10812337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1835Open in IMG/M
3300012782|Ga0138268_1253528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300012963|Ga0129340_1058332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300013006|Ga0164294_10259105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1216Open in IMG/M
3300013295|Ga0170791_10651968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300017697|Ga0180120_10099640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1265Open in IMG/M
3300018874|Ga0192977_1008222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1690Open in IMG/M
3300018980|Ga0192961_10042708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1277Open in IMG/M
3300018980|Ga0192961_10055394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1149Open in IMG/M
3300018982|Ga0192947_10060460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1205Open in IMG/M
3300019048|Ga0192981_10073410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1298Open in IMG/M
3300019103|Ga0192946_1009518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1336Open in IMG/M
3300019150|Ga0194244_10098289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300020014|Ga0182044_1245316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1188Open in IMG/M
3300021169|Ga0206687_1905997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1197Open in IMG/M
3300021169|Ga0206687_1974405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1161Open in IMG/M
3300021350|Ga0206692_1400398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300021350|Ga0206692_1905993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum942Open in IMG/M
3300021925|Ga0063096_1058555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1758Open in IMG/M
3300021941|Ga0063102_1000626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1160Open in IMG/M
3300021942|Ga0063098_1037298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1430Open in IMG/M
3300021950|Ga0063101_1038155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1101Open in IMG/M
3300022074|Ga0224906_1168279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300025680|Ga0209306_1099820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300025699|Ga0209715_1140375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum828Open in IMG/M
3300025890|Ga0209631_10050927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2701Open in IMG/M
3300025890|Ga0209631_10441358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300025897|Ga0209425_10286476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300026182|Ga0208275_1013699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1765Open in IMG/M
3300026448|Ga0247594_1002463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2462Open in IMG/M
3300026448|Ga0247594_1017081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1167Open in IMG/M
3300026468|Ga0247603_1125503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300027188|Ga0208921_1060227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300027198|Ga0208163_1035372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300027308|Ga0208796_1049071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum950Open in IMG/M
3300027752|Ga0209192_10081050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1378Open in IMG/M
3300027752|Ga0209192_10360331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300027810|Ga0209302_10327009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300027833|Ga0209092_10598813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300027899|Ga0209668_10186559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1282Open in IMG/M
3300028095|Ga0247563_1063332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300028137|Ga0256412_1246789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300028137|Ga0256412_1271904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300028137|Ga0256412_1297358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300030671|Ga0307403_10022527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2276Open in IMG/M
3300030709|Ga0307400_10730626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300030721|Ga0308133_1025784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum807Open in IMG/M
3300030723|Ga0308129_1038534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300030724|Ga0308138_1018485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1004Open in IMG/M
3300030724|Ga0308138_1054590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300031569|Ga0307489_10740836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300031579|Ga0308134_1060191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum868Open in IMG/M
3300031579|Ga0308134_1159172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300031734|Ga0307397_10009707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2517Open in IMG/M
3300031738|Ga0307384_10155611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum984Open in IMG/M
3300031752|Ga0307404_10058516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1426Open in IMG/M
3300031752|Ga0307404_10431573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300031752|Ga0307404_10447043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300032463|Ga0314684_10389282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum818Open in IMG/M
3300032470|Ga0314670_10017056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2157Open in IMG/M
3300032470|Ga0314670_10149091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1128Open in IMG/M
3300032481|Ga0314668_10126879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1239Open in IMG/M
3300032491|Ga0314675_10010306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2527Open in IMG/M
3300032492|Ga0314679_10355296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300032517|Ga0314688_10660367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300032519|Ga0314676_10191548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1144Open in IMG/M
3300032521|Ga0314680_10130781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1341Open in IMG/M
3300032522|Ga0314677_10131996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1192Open in IMG/M
3300032615|Ga0314674_10062012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1603Open in IMG/M
3300032617|Ga0314683_10261973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1069Open in IMG/M
3300032617|Ga0314683_10935716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300032707|Ga0314687_10421205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300032708|Ga0314669_10102750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1302Open in IMG/M
3300032708|Ga0314669_10121924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1231Open in IMG/M
3300032711|Ga0314681_10212819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1033Open in IMG/M
3300032711|Ga0314681_10337405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum838Open in IMG/M
3300032713|Ga0314690_10126811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1174Open in IMG/M
3300032727|Ga0314693_10588668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300032728|Ga0314696_10086147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1381Open in IMG/M
3300032730|Ga0314699_10106956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1142Open in IMG/M
3300032742|Ga0314710_10187750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum835Open in IMG/M
3300032743|Ga0314707_10195212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1025Open in IMG/M
3300032744|Ga0314705_10173936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1099Open in IMG/M
3300032746|Ga0314701_10538586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300032747|Ga0314712_10121353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1186Open in IMG/M
3300033572|Ga0307390_11039171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300033984|Ga0334989_0057096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2147Open in IMG/M
3300034068|Ga0334990_0038905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2542Open in IMG/M
3300034068|Ga0334990_0152244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1262Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater20.30%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.02%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.02%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine5.26%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.01%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.01%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.26%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.50%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.50%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.75%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.75%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.75%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.75%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.75%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.75%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.75%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.75%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.75%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.75%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028095Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 11R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR13_50mDRAFT_102233123300000120MarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0031658_110047813300003860Freshwater Lake SedimentLMGSITSLFSTTDDFDSLIEEKLDFLDMWIKKIEKSNKPYHIQPTLYSDIRKYVEQAFMYDFNLVIEEF*
Ga0071100_108029823300005043Marine Subseafloor AquiferIALEFIGLTFFSFLMGNMSGIFGQKDKFDDLIEDKLDSLNMWIKKIEKSNAPYHIQPTLYKDIRKYAEHAFLYDFNLLIEEFDFFQ*
Ga0066831_1006294823300005516MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0008649_1005990933300005838MarineMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFPFFQQITPKM*
Ga0075443_1012041123300006165MarineEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0075493_141527533300006396AqueousGDYSGATSEEYIFSIVLEFIGLTFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRRYVEQAFLYDFNLVIEEFQFY*
Ga0105019_103923713300007513MarineMGCINNIFNTSDNFEDLIDQKLDSLDMWIKKIEKSNKPFHIQPYLYNDIKNYINQAFLYDYNLVIEEFQFFQ*
Ga0105019_104156243300007513MarineMGSINGIFSASDNFEDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFYFDFNLVIEEFNFYQQMTPKM*
Ga0105019_104311833300007513MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEF*
Ga0105019_104549143300007513MarineMSDSFDDLIEEKLDSLDMWVKKIEKSNKPFHIQPKLYNDIRKYVEQAFHFDFNLVIEDFPFYS*
Ga0105019_105772543300007513MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFPFYQQITPKMQTDLI*
Ga0105019_108603213300007513MarineMGSVNDFFNVSDNFDDLIEEKLDELDMWIKKIEKSNKPFHIQPTLYNDIKSNVEDAFLYDFNLLIEEFSFYQ*
Ga0102820_104077233300007554EstuarineFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF*
Ga0102821_116752723300007557EstuarineIFSIVLEFIGLTFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF*
Ga0102852_110382623300007718EstuarineFLGLTFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0105737_115659313300007862Estuary WaterVGKTSEEYIFSIVTEFLGLTFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0114341_1007674923300008108Freshwater, PlanktonMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPSLYNDIRKYVEQAFLYDFNLVIEEFQFY*
Ga0114346_118367123300008113Freshwater, PlanktonMGSITSIFSTSDNFDDLIEQKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0115651_115212313300008952MarineMGSVNDFFNVSDNFDDLIEEKLDELDMWIKKIEKSNKPFHIQPTLYNDIRSNVEDAFLYDFNLLIEEFSFYQ*
Ga0104258_106013813300008993Ocean WaterGDYSGNTPEEYIFSIVLEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM*
Ga0102813_103712913300009003EstuarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF*
Ga0115552_110785023300009077Pelagic MarineMGSITSIFSTSDNFDDLIEQKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFNFYQ*
Ga0102815_1017986313300009080EstuarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF*
Ga0114995_1067818413300009172MarineMGLTFFSFLMGTVNGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYTDIRKYVEQAFLYDFNLVIEEFQF
Ga0103873_112792723300009265Surface Ocean WaterSEYIFSIILEFLGLTFFSFLMGSINGIFNTSDNFDDLIEDKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFMYDFNLVIEEFVFY*
Ga0115005_1101546323300009432MarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM*
Ga0115005_1142725923300009432MarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPK
Ga0115005_1172122613300009432MarineVGYGDYAGSTPDEYIFSIALEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQT
Ga0115008_1126650713300009436MarineMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM*
Ga0115007_1008546823300009441MarineMGSVNDFFNVSDNFDDLIEEKLDELDMWIKKIEKSNKPFHIQPTLYNDIRSNVVDAFLYDFNLLIEEFSFYD*
Ga0115007_1131525223300009441MarineATSQEYIFSIILEFLGLTFFSFLMGSINGIFSASDNFEDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRRYVEQAFYFDFNLVIEEFSFY*
Ga0126447_103829913300009470Meromictic PondGYGDYTGSTSEEYIFSILLEFLGLTFFSFLMGSITGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM*
Ga0115569_1007315523300009497Pelagic MarineMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI*
Ga0115569_1011797413300009497Pelagic MarineLGLTFFSFLMGSINGIFNTTDSFEDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEMAFLYDFNLVIEEFEFY*
Ga0115572_1072863413300009507Pelagic MarineGSINGIFNTSDSFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFKYDFNLVIEEFSFYQ*
Ga0115567_1067434323300009508Pelagic MarineMGTVNGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLIQNTRVFKEFEK
Ga0129287_1003163533300009538Beach Aquifer PorewaterMGTINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFMYDFNLVIEEFTFYQHLTPKM*
Ga0115103_161726413300009599MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0115104_1001221313300009677MarineYIFSIALEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF*
Ga0115104_1122103223300009677MarineMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTD
Ga0115105_1142464613300009679MarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY*
Ga0129333_1012956033300010354Freshwater To Marine Saline GradientMGSINGIFNTSDNFEDLIDEKLDQLDMWIKKIEKSNKPFHIQPYLYNDIKKYIKQAFLYDYNLVIEDFPFF*
Ga0133547_1081233743300010883MarineMGLTFFSFLMGTVNGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYTDIRKYVEQAFLYDFNLVIEEFQFYQ*
Ga0138268_125352823300012782Polar MarineFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQSFLYDFNLVIEEFQFYQ*
Ga0129340_105833213300012963AqueousMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTD
Ga0164294_1025910513300013006FreshwaterMGSITSIFSTSDSFDDLIEEKLENLDKWIKKIEKSNYPYHIQPTLYCDIRKYVEVAFLFDFNLIIEEFNFY*
Ga0170791_1065196813300013295FreshwaterMGSITSLFSTTDDFDSLIEEKLDFLDMWIKKIEKSNKPYHIQPTLYSDIRKYVEQAFMYDFNLVIEEF*
Ga0180120_1009964023300017697Freshwater To Marine Saline GradientSFLMGSITSIFSTSDNFDDLIEQKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFNFYQ
Ga0192977_100822223300018874MarineMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0192961_1004270823300018980MarineMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFPFFQQITPKM
Ga0192961_1005539423300018980MarineYGDYSGSTSTEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0192947_1006046013300018982MarineFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI
Ga0192981_1007341013300019048MarineDYSGKTSFEYIFSIALEFLGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0192946_100951813300019103MarineGKTSEEYIFSIGLEFLGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0194244_1009828913300019150MarineALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0182044_124531633300020014Salt MarshSGATSEEYIFSIVLEFLGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0206687_190599713300021169SeawaterLEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNL
Ga0206687_197440533300021169SeawaterLTFFSFLMGSINGIFNTSDNFDDLIEEKLASLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0206692_140039823300021350SeawaterMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNRVIEEF
Ga0206692_190599313300021350SeawaterMGSINGIFSASDNFEDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRRYVEQAFYFDFNLVIEEFSFYQ
Ga0063096_105855533300021925MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0063102_100062613300021941MarineEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0063098_103729823300021942MarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0063101_103815513300021950MarineDYAGSTPDEYIFSIALEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0224906_116827913300022074SeawaterMGSINGIFNTSDNFEDLIDEKLDQLDMWIKKIEKSNKPFHIQPYLYNDIKQYINQAFLYDYNLVIEEF
Ga0209306_109982023300025680Pelagic MarineMGSITSIFSTSDNFDDLIEQKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFNFYQ
Ga0209715_114037513300025699Pelagic MarineMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEE
Ga0209631_1005092733300025890Pelagic MarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY
Ga0209631_1044135813300025890Pelagic MarineRSTFFLIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0209425_1028647613300025897Pelagic MarineFSFLMGSITSIFGASDNFDDLIEYKLDTLDMWIKKIEKSNKPYHIQPTLYSDIRKYVEQAFLYDFNLVIEEFPFYQQITPKMQTDLI
Ga0208275_101369943300026182MarineVGYGDYSGKTSGEYIFSIILEFLGLTFFSFLMGSINGIFSASDNFEDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFYFDFNLVIEEFQFYQQMTPKMQTDLIK
Ga0247594_100246353300026448SeawaterMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0247594_101708123300026448SeawaterMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0247603_112550313300026468SeawaterMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPYLYNDIKNYINQAFLYDYNLVIE
Ga0208921_106022723300027188EstuarineFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0208163_103537213300027198EstuarineVGYGDYSGATSEEYIFSIVLEFIGLTFFSFLMGSINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0208796_104907123300027308EstuarineMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDF
Ga0209192_1008105013300027752MarineSGATSEEYIFSIILEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM
Ga0209192_1036033113300027752MarineMGTVNGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYTDIRKYVEQAFLYDFNLVIEEFQF
Ga0209302_1032700923300027810MarineMGSVNDFFNVSDNFDDLIEEKLDELDMWIKKIEKSNKPFHIQPTLYNDIRSNVVDAFLYDFNLLIEEFSFYD
Ga0209092_1059881313300027833MarineVGYGDYTGNTTHEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0209668_1018655943300027899Freshwater Lake SedimentTGATNSEYLFSIGLEFLGLTFFSFLMGSITSLFSTTDDFDSLIEEKLDFLDMWIKKIEKSNKPYHIQPTLYSDIRKYVEQAFMYDFNLVIEEF
Ga0247563_106333213300028095SeawaterVGYGDYSGSTSEEYIFSIALEFMGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0256412_124678913300028137SeawaterMEFLGLVFFSFLMGSITSIFGASDNFDDLIEYKLDTLDMWIKKIEKSNKPYHIQPTLYSDIRKYVEQAFLYDFNLVIEEF
Ga0256412_127190413300028137SeawaterMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRNYVEEAFYFDFNLVIEEFPYYQ
Ga0256412_129735813300028137SeawaterLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0307403_1002252733300030671MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM
Ga0307400_1073062623300030709MarineLEFLGLTFFSFLMGSINDIFDTADNFDDLIEEKLDQLDMWVKKIEKSNKPFHIQPILYADIRKYVEQAFMYDFNLVIEEFSFYQ
Ga0308133_102578423300030721MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI
Ga0308129_103853423300030723MarineMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0308138_101848523300030724MarineMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0308138_105459013300030724MarineEFLGLTFFSFLMGSINGIFSASDNFEDLIEEKLDSLDMWIKKIEKSNKPFHIQPNLYNDIRRYVEQAFYFDFNLVIEEFSFY
Ga0307388_1086207613300031522MarineNTSDNFDDLIEEKLDLLDMWIKKIEKSNKPNHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0307489_1074083613300031569Sackhole BrineMGSINGIFSSADNFDDLIEGKLDSLDMWIKKIEKSNRELHIQPSLYNDIREYVEQAFLHDFNLVIEEFPFY
Ga0308134_106019123300031579MarineMGSINGIFSASDNFEDLIEEKLDSLDMWIKKIEKSNKPFHIQPNLYNDIRRYVEQAFYFDFNLVIEEFSFY
Ga0308134_115917233300031579MarineFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI
Ga0307397_1000970753300031734MarineMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEF
Ga0307384_1015561113300031738MarineMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLIQNTRVFK
Ga0307404_1005851633300031752MarineVITTVGYGDYAGKTSYEYIFSIGLEFLGLTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM
Ga0307404_1043157313300031752MarineLGLTFFSFLMGSINGIFNTSDSFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFKYDFNLVIEEFSFYQ
Ga0307404_1044704323300031752MarineMGSITSIFSTSDNFDDLIEQKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFNFYQQITPKMQTDLI
Ga0314684_1038928213300032463SeawaterTHEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0314670_1001705623300032470SeawaterMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI
Ga0314670_1014909113300032470SeawaterMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0314668_1012687913300032481SeawaterDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI
Ga0314675_1001030623300032491SeawaterMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQTDLI
Ga0314679_1035529623300032492SeawaterMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKMQ
Ga0314688_1066036723300032517SeawaterMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIE
Ga0314676_1019154813300032519SeawaterMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY
Ga0314680_1013078133300032521SeawaterVGYGDYSGSTQNEYIFSICLEFLGLTFFSFLMGSINKLFSTQDSFDSLMEEKLDALDLWIKKIEKSNMPFHIQPILYNDIKKYVEQAFKHDFNLVVEEFEFF
Ga0314677_1013199633300032522SeawaterGSTQNEYIFSICLEFLGLTFFSFLMGSINKLFSTQDSFDSLMEEKLDALDLWIKKIEKSNMPFHIQPILYNDIKKYVEQAFKHDFNLVVEEFEFF
Ga0314674_1006201223300032615SeawaterMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0314683_1026197313300032617SeawaterTSTEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY
Ga0314683_1093571613300032617SeawaterFLGLTFFSFLMGSVSGIFSHSDSFEDLIEEKLDQLDMWLKKIEKSNKPFHIQPILYNDIRFYIELAFKRDFNLIIE
Ga0314687_1042120513300032707SeawaterTSTEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0314669_1010275033300032708SeawaterYIFSICLEFFGLTFFSFLMGSINKLFSTQDSFDSLMEEKLDALDLWIKKIEKSNMPFHIQPILYNDIKKYVEQAFKHDFNLVVEEFEFF
Ga0314669_1012192423300032708SeawaterTFFSFLMGSINGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM
Ga0314681_1021281913300032711SeawaterSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0314681_1033740523300032711SeawaterEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0314690_1012681113300032713SeawaterTVGYGDYSGSTSEEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY
Ga0314693_1058866813300032727SeawaterGIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQQITPKM
Ga0314696_1008614713300032728SeawaterINSIFNTTDSFEALIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRRYVEQAFLYDFNLVIEEF
Ga0314699_1010695613300032730SeawaterEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0314710_1018775013300032742SeawaterEEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY
Ga0314707_1019521223300032743SeawaterMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFY
Ga0314705_1017393613300032744SeawaterINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPFHIQPTLYNDIRKYVEQAFLYDFNLVIEEFQFYQ
Ga0314701_1053858623300032746SeawaterDYSGSTQNEYIFSICLEFLGLTFFSFLMGSINKLFSTQDSFDSLMEEKLDALDLWIKKIEKSNMPFHIQPILYNDIKKYVEQAFKHDFNLVVEEFEFF
Ga0314712_1012135313300032747SeawaterTTHEYIFSIALEFMGLTFFSFLMGSINSIFNTSDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFLYDFNLVIEEFSFYQQITPKM
Ga0307390_1103917123300033572MarineDFYGKTSWEYVFSIVLEFVGLTFFSFLMGTINGIFNTKDNFDDLIEEKLDSLDMWIKKIEKSNKPYHIQPTLYNDIRKYVEQAFMYDFNLVIEEF
Ga0334989_0057096_481_6873300033984FreshwaterMGSITSLFSTTDDFDSLIEEKLDFLDMWIKKIEKSNKPYHIQPTLYSDIRKYVEQAFMYDFNLVIEEF
Ga0334990_0038905_1018_12633300034068FreshwaterMGLTFFSFLMGSINGIFNTSDNFDDLIEEKMDSLDMWIKKIEKSNKPLHIQPVLYNEIRKYIEQAFLYDFNLVIEEFKFYQ
Ga0334990_0152244_54_2723300034068FreshwaterMGSINGIFNTSDNFDDLIEEKMDALDMWIKKIEKSNYPYHIQPTLYNEIRKYIEQAFLYDFNLVIEEFKFYQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.