| Basic Information | |
|---|---|
| Family ID | F060317 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MSDSSVLSPDAPVSESNSLQLPISSIVRAVCEAAKGGPDLLYEVMIKMSLMVEA |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 96.24 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.880 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (78.195 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.37% β-sheet: 0.00% Coil/Unstructured: 64.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF04977 | DivIC | 11.28 |
| PF02878 | PGM_PMM_I | 2.26 |
| PF09594 | GT87 | 1.50 |
| PF02880 | PGM_PMM_III | 0.75 |
| PF07287 | AtuA | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 11.28 |
| COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 11.28 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 3.01 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 3.01 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.43 % |
| Unclassified | root | N/A | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12438068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 534 | Open in IMG/M |
| 3300000891|JGI10214J12806_11744213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 525 | Open in IMG/M |
| 3300000953|JGI11615J12901_10346920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 650 | Open in IMG/M |
| 3300000955|JGI1027J12803_107584983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 549 | Open in IMG/M |
| 3300002155|JGI24033J26618_1014412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300003993|Ga0055468_10048698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300004052|Ga0055490_10053251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300004156|Ga0062589_102476205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 537 | Open in IMG/M |
| 3300004480|Ga0062592_102010714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 571 | Open in IMG/M |
| 3300004643|Ga0062591_101699999 | Not Available | 640 | Open in IMG/M |
| 3300004643|Ga0062591_102298763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 563 | Open in IMG/M |
| 3300005290|Ga0065712_10349978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 789 | Open in IMG/M |
| 3300005295|Ga0065707_10056484 | Not Available | 792 | Open in IMG/M |
| 3300005295|Ga0065707_10381322 | Not Available | 876 | Open in IMG/M |
| 3300005331|Ga0070670_100395336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300005333|Ga0070677_10558042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 629 | Open in IMG/M |
| 3300005334|Ga0068869_100695624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300005334|Ga0068869_101918815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 531 | Open in IMG/M |
| 3300005336|Ga0070680_100719941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 859 | Open in IMG/M |
| 3300005338|Ga0068868_101278589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 681 | Open in IMG/M |
| 3300005343|Ga0070687_100059993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2005 | Open in IMG/M |
| 3300005345|Ga0070692_10293075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300005345|Ga0070692_10411098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 857 | Open in IMG/M |
| 3300005345|Ga0070692_10603244 | Not Available | 727 | Open in IMG/M |
| 3300005345|Ga0070692_10750264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 662 | Open in IMG/M |
| 3300005345|Ga0070692_11120307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 557 | Open in IMG/M |
| 3300005438|Ga0070701_10246010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300005444|Ga0070694_100694807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 827 | Open in IMG/M |
| 3300005459|Ga0068867_100910238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 792 | Open in IMG/M |
| 3300005467|Ga0070706_100937831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 799 | Open in IMG/M |
| 3300005536|Ga0070697_101599214 | Not Available | 583 | Open in IMG/M |
| 3300005545|Ga0070695_100448761 | Not Available | 988 | Open in IMG/M |
| 3300005545|Ga0070695_100678993 | Not Available | 816 | Open in IMG/M |
| 3300005545|Ga0070695_100968284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 690 | Open in IMG/M |
| 3300005545|Ga0070695_101386548 | Not Available | 583 | Open in IMG/M |
| 3300005546|Ga0070696_100661600 | Not Available | 848 | Open in IMG/M |
| 3300005546|Ga0070696_100764340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 793 | Open in IMG/M |
| 3300005546|Ga0070696_101556700 | Not Available | 567 | Open in IMG/M |
| 3300005577|Ga0068857_101350673 | Not Available | 692 | Open in IMG/M |
| 3300005577|Ga0068857_102375262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 521 | Open in IMG/M |
| 3300005615|Ga0070702_101022539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 655 | Open in IMG/M |
| 3300005615|Ga0070702_101434363 | Not Available | 566 | Open in IMG/M |
| 3300005617|Ga0068859_102674501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 548 | Open in IMG/M |
| 3300005618|Ga0068864_102625203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 510 | Open in IMG/M |
| 3300005840|Ga0068870_10501815 | Not Available | 809 | Open in IMG/M |
| 3300005840|Ga0068870_10781560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 665 | Open in IMG/M |
| 3300005840|Ga0068870_11380348 | Not Available | 516 | Open in IMG/M |
| 3300005841|Ga0068863_102732389 | Not Available | 502 | Open in IMG/M |
| 3300005844|Ga0068862_100532527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300005844|Ga0068862_100743335 | Not Available | 954 | Open in IMG/M |
| 3300006169|Ga0082029_1635114 | Not Available | 622 | Open in IMG/M |
| 3300006237|Ga0097621_100006208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8473 | Open in IMG/M |
| 3300006237|Ga0097621_100648388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300006791|Ga0066653_10329872 | Not Available | 770 | Open in IMG/M |
| 3300006844|Ga0075428_101001243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 885 | Open in IMG/M |
| 3300006844|Ga0075428_101685336 | Not Available | 662 | Open in IMG/M |
| 3300006845|Ga0075421_100426903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300006846|Ga0075430_100805672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 774 | Open in IMG/M |
| 3300006852|Ga0075433_10850106 | Not Available | 796 | Open in IMG/M |
| 3300006852|Ga0075433_11573657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 567 | Open in IMG/M |
| 3300006853|Ga0075420_100611678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300006881|Ga0068865_101140694 | Not Available | 688 | Open in IMG/M |
| 3300006894|Ga0079215_10005526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3566 | Open in IMG/M |
| 3300006904|Ga0075424_102848139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 503 | Open in IMG/M |
| 3300006918|Ga0079216_10389986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 870 | Open in IMG/M |
| 3300006954|Ga0079219_11619280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 594 | Open in IMG/M |
| 3300006969|Ga0075419_11058888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 593 | Open in IMG/M |
| 3300009100|Ga0075418_11318148 | Not Available | 783 | Open in IMG/M |
| 3300009147|Ga0114129_10577826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300009148|Ga0105243_10286841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300009148|Ga0105243_13129108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 501 | Open in IMG/M |
| 3300009156|Ga0111538_10688475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
| 3300009156|Ga0111538_13055627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 584 | Open in IMG/M |
| 3300009174|Ga0105241_11633694 | Not Available | 624 | Open in IMG/M |
| 3300009176|Ga0105242_10232443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1653 | Open in IMG/M |
| 3300009176|Ga0105242_12912260 | Not Available | 529 | Open in IMG/M |
| 3300009551|Ga0105238_12752819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 528 | Open in IMG/M |
| 3300009553|Ga0105249_10119979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2498 | Open in IMG/M |
| 3300009553|Ga0105249_13515426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 505 | Open in IMG/M |
| 3300009610|Ga0105340_1403984 | Not Available | 609 | Open in IMG/M |
| 3300010040|Ga0126308_10128972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1579 | Open in IMG/M |
| 3300010046|Ga0126384_10534717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300010047|Ga0126382_11279368 | Not Available | 662 | Open in IMG/M |
| 3300010359|Ga0126376_12696429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 546 | Open in IMG/M |
| 3300010375|Ga0105239_13445577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 514 | Open in IMG/M |
| 3300010399|Ga0134127_11914368 | Not Available | 670 | Open in IMG/M |
| 3300010400|Ga0134122_12133907 | Not Available | 602 | Open in IMG/M |
| 3300010401|Ga0134121_13149606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 509 | Open in IMG/M |
| 3300011119|Ga0105246_10765881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 853 | Open in IMG/M |
| 3300012210|Ga0137378_11430409 | Not Available | 604 | Open in IMG/M |
| 3300012210|Ga0137378_11718052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 533 | Open in IMG/M |
| 3300012922|Ga0137394_11071693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 668 | Open in IMG/M |
| 3300013296|Ga0157374_12743639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 520 | Open in IMG/M |
| 3300013297|Ga0157378_10630379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300013297|Ga0157378_11057541 | Not Available | 847 | Open in IMG/M |
| 3300014325|Ga0163163_13057019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 522 | Open in IMG/M |
| 3300014325|Ga0163163_13299307 | Not Available | 503 | Open in IMG/M |
| 3300014326|Ga0157380_12185403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 617 | Open in IMG/M |
| 3300015371|Ga0132258_12570879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300015372|Ga0132256_100785255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1069 | Open in IMG/M |
| 3300018081|Ga0184625_10106540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1451 | Open in IMG/M |
| 3300018469|Ga0190270_10976636 | Not Available | 871 | Open in IMG/M |
| 3300018476|Ga0190274_12796712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 584 | Open in IMG/M |
| 3300025900|Ga0207710_10168748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300025908|Ga0207643_10249248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300025908|Ga0207643_10517744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 764 | Open in IMG/M |
| 3300025911|Ga0207654_10814612 | Not Available | 675 | Open in IMG/M |
| 3300025913|Ga0207695_10706142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300025918|Ga0207662_10140071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1532 | Open in IMG/M |
| 3300025923|Ga0207681_11332381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 603 | Open in IMG/M |
| 3300025926|Ga0207659_10897974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 762 | Open in IMG/M |
| 3300025932|Ga0207690_11185172 | Not Available | 637 | Open in IMG/M |
| 3300025935|Ga0207709_11532021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 553 | Open in IMG/M |
| 3300025935|Ga0207709_11705947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 524 | Open in IMG/M |
| 3300025938|Ga0207704_11134066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 665 | Open in IMG/M |
| 3300025940|Ga0207691_10852070 | Not Available | 764 | Open in IMG/M |
| 3300025942|Ga0207689_10164892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1826 | Open in IMG/M |
| 3300025942|Ga0207689_11659762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 530 | Open in IMG/M |
| 3300025960|Ga0207651_10357059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300025960|Ga0207651_11020413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 740 | Open in IMG/M |
| 3300026075|Ga0207708_10224966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
| 3300026088|Ga0207641_10741123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300026089|Ga0207648_10143777 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300026095|Ga0207676_12204937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 549 | Open in IMG/M |
| 3300026116|Ga0207674_11500987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 643 | Open in IMG/M |
| 3300027266|Ga0209215_1007468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300027880|Ga0209481_10513975 | Not Available | 619 | Open in IMG/M |
| 3300027909|Ga0209382_11206021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 774 | Open in IMG/M |
| 3300028381|Ga0268264_10898704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 889 | Open in IMG/M |
| 3300030496|Ga0268240_10020921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300031824|Ga0307413_12081317 | Not Available | 513 | Open in IMG/M |
| 3300031901|Ga0307406_10890236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 757 | Open in IMG/M |
| 3300031908|Ga0310900_10979485 | Not Available | 694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 10.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.26% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_124380681 | 3300000789 | Soil | MSDSSAISPDAPASESSSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAP |
| JGI10214J12806_117442131 | 3300000891 | Soil | MSDSSVLAPDVTTSDSTSYKLPISSMVRAVCEAANGGPDLLYEVMIKMSLM |
| JGI11615J12901_103469201 | 3300000953 | Soil | MSDPSVLTLETPVFESSSPKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVE |
| JGI1027J12803_1075849831 | 3300000955 | Soil | MSDSQLAQDVQVSDSSLAKLPISSIVRAVCQAASDGPELLYEVMIKMSLMVEA |
| JGI24033J26618_10144122 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLSPDAPVSEPSSLQLPISSIVRAVCEAANG |
| Ga0055468_100486981 | 3300003993 | Natural And Restored Wetlands | MSESSVLSPAAPVSGSSSLQLPISSIVRAVCEAANGGPDLLYEVLIKMSLMVEATAPTYGLSIWA |
| Ga0055490_100532512 | 3300004052 | Natural And Restored Wetlands | MSDSLVRSPGASTSDSDSLQLPISSIVRAVCEAAKGGPDLLYEVMIKLSLMVEATAPTYGLSIWATSDS |
| Ga0062589_1024762051 | 3300004156 | Soil | MSDSSALSQDAPASESSSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSLKVEATVTT |
| Ga0062592_1020107141 | 3300004480 | Soil | MSDSSVLSPDAPASDSNSLQLPIGSIVRAVCEAANGGPDLLYEVMIKMSLMVEATA |
| Ga0062591_1016999991 | 3300004643 | Soil | MSDSAVKSPDAPASESSSSLLPISSIVRAVCQAAGGGPDVLYEVMIKMSLM |
| Ga0062591_1022987631 | 3300004643 | Soil | MSDSSVLSPDAPVSESSSLRLPISSIVRAVCEAANGGPDLLYEVMIKVSLMVEATAPTYGLSIW |
| Ga0065712_103499781 | 3300005290 | Miscanthus Rhizosphere | VSDFSVVSPDVPVSESASSLLPISSIVRAVCQAASGGPDVLYEVMIKMSLMVEATAP |
| Ga0065707_100564842 | 3300005295 | Switchgrass Rhizosphere | MSDLSVLSPDAPASESSSPKLPISSIVRAVCEAASGGPDLL |
| Ga0065707_103813221 | 3300005295 | Switchgrass Rhizosphere | MPDYSVLAPDAPRSDSNSFQLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVEA |
| Ga0070670_1003953361 | 3300005331 | Switchgrass Rhizosphere | MSDSAVKSPDAPASESSSSLLPISSIVRAVCQAASGGPDV |
| Ga0070677_105580421 | 3300005333 | Miscanthus Rhizosphere | MSDSAVTGPDAPASESSSSQLPISSIVRAVCQAASGGPDLLYEVMIKMSLMVEATAPTY |
| Ga0068869_1006956241 | 3300005334 | Miscanthus Rhizosphere | VSDFSVVSPDVPVSESASSLLPISSIVRAVCQAASGGPDVLYEVMIKMSLMVEATA |
| Ga0068869_1019188151 | 3300005334 | Miscanthus Rhizosphere | MSDSSVLSPDVPISESSSLRLPISSIVRAVCEAANGGPDLLYEVMIKMS |
| Ga0070680_1007199411 | 3300005336 | Corn Rhizosphere | MSDSAVTGPDAPASESSSSRLPISSIVRAVCQAASGGPDALYEVMIKMSLMVEATAPT |
| Ga0068868_1012785891 | 3300005338 | Miscanthus Rhizosphere | MSDSAVTGPDAPASESSSSQLPISSIVRAVCQAASGGPDLLYEVMIKMSLMVEA |
| Ga0070687_1000599931 | 3300005343 | Switchgrass Rhizosphere | MSDSSVLAPDVTTSDSTSYKLPISSMVRAVCEAANGGPDLLYEVMIKMSLMVEA |
| Ga0070692_102930752 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSAISPDAPASESSSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYGLSIWATSDSG |
| Ga0070692_104110981 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLSPDAPVSEPSSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSLM |
| Ga0070692_106032442 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSAVKRPDAPASESSSLLPISSIVRAVCQAASGGPDLLYEVMIKMSLM |
| Ga0070692_107502641 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLSPDAPVSESSSLRLPISSIVRAVCEAANGGPDLLYEVMIKVSLMV |
| Ga0070692_111203071 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSLPGLDVPASESSSLELPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEA |
| Ga0070701_102460101 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSLPGLDVPASESSSLELPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEAT |
| Ga0070694_1006948072 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPSVLSLDAPASESSSPRLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPT |
| Ga0068867_1009102381 | 3300005459 | Miscanthus Rhizosphere | MSDSSVVSPDVPVSESNSLRLPISSIVRAVCEAANGGPDLLYEVMIKVSLMVEATA |
| Ga0070706_1009378313 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLSPDAPVSETSSLRLPIGSIVRAVCEAANGGPDLLYEVMIKVSLMVE |
| Ga0070697_1015992141 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDPSVLSPEIPVFESSSPKLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVEATAPTYG |
| Ga0070695_1004487612 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLAPDVTTSDSTSYKLPISSMVRAVCEAANGGPDLLYE |
| Ga0070695_1006789932 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSAVTSPDAPASESSSSLLPISSIVRAVCQAASGGPDVLYEVMIKMSLM |
| Ga0070695_1009682841 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLSPDAPVSESSSLRLPISSIVRAVCEAANGGPDLLYEVMIKVSLMVEATAPTYG |
| Ga0070695_1013865481 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVPSPAAPASDSSSPPLPISSIVRAVCEAAKGGPDRLYEVMIKMSLMVEATA |
| Ga0070696_1006616002 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSAVTSPDGPASESSSSLLPISSIVRAVCQAASGGPDLLYEVMI |
| Ga0070696_1007643401 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDLSVLSPEIPAFESSFPKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEAT |
| Ga0070696_1015567001 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLDQDAPASDSQSSQLPITSIVRAVCEAASGGPDLLYEVMIKMSLMVE |
| Ga0068857_1013506731 | 3300005577 | Corn Rhizosphere | MSDPSVLSPETPVFESSSPKLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVEATA |
| Ga0068857_1023752622 | 3300005577 | Corn Rhizosphere | MSDSAVKRPDAPASESSSLLPISSIVRAVCQAASDGPDLLYEVMIKMSLMVEATAP |
| Ga0070702_1010225391 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSAVKSPDGPASESSSSLLPISSIVRAVCQAASGGPDVLYEVMIKMSLMVEA |
| Ga0070702_1014343631 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSDFSVVSPDVPVSESASSLLPISSIVRAVCQAASGGPD |
| Ga0068859_1026745011 | 3300005617 | Switchgrass Rhizosphere | MSDSSVVSPDAPVSESGSSQLPISSIVRAVCQAASGGPDVLYEVMIKMSLMVEATAP |
| Ga0068864_1026252032 | 3300005618 | Switchgrass Rhizosphere | MSDPSVLSLETPVFESSSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYGLSI* |
| Ga0068870_105018151 | 3300005840 | Miscanthus Rhizosphere | MSDSSVLSPEAPVSESSSPKLPISSIVRAVCEAASGGPDLLYEVMIKMSLM |
| Ga0068870_107815601 | 3300005840 | Miscanthus Rhizosphere | MSDSSVLSPDTPVSEPSSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSL |
| Ga0068870_113803481 | 3300005840 | Miscanthus Rhizosphere | MSDPSVLSPDAPVSELNSLKLPISSIVRAVCEAANGGPDLLYEVMIK |
| Ga0068863_1027323891 | 3300005841 | Switchgrass Rhizosphere | MSDSLTQNVRVSDSGLLKLPISSIVRAVCEAANGGPELLYEVMIKVSLMVEAT |
| Ga0068862_1005325271 | 3300005844 | Switchgrass Rhizosphere | MSDSAVIGPDAPASESSSSQLPISSIVRAVCQAASGGPDLLYE |
| Ga0068862_1007433351 | 3300005844 | Switchgrass Rhizosphere | MSDSSVLAPDVPTSDSKSYQLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVEATAPTYG |
| Ga0082029_16351142 | 3300006169 | Termite Nest | MSDSAVTGPDAPASESSSSQLPISSIVRAVCQAASGGPDALYEVMIKMSL |
| Ga0097621_1000062081 | 3300006237 | Miscanthus Rhizosphere | MSDPSVLSLDAPASESSSPRLPISSIVRAVCEAANGGPDLLYEVMIKMS |
| Ga0097621_1006483881 | 3300006237 | Miscanthus Rhizosphere | VSDFSVVSPDVPVSESASSLLPISSIVRAVCQAASGGPDVLY |
| Ga0066653_103298721 | 3300006791 | Soil | MSDSAALASDLKTSDSSPVSLPISSIVRAVCEGASGGPDLLYEVM |
| Ga0075428_1010012431 | 3300006844 | Populus Rhizosphere | MSDSSVLNPEAPASDSNTLNLPISSMVRAVCEAANGGPDLLYEVMIKMSL |
| Ga0075428_1016853361 | 3300006844 | Populus Rhizosphere | MSDSSVVDLQVPASESLSLQLPISSIVRAVCEAANGGPELLYEVMIKMSLMV |
| Ga0075421_1004269031 | 3300006845 | Populus Rhizosphere | MSDSSVVDFQAPASEALSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMV |
| Ga0075430_1008056721 | 3300006846 | Populus Rhizosphere | MSDSSVLDPDAPASDSLSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVE |
| Ga0075433_108501062 | 3300006852 | Populus Rhizosphere | MSDSSVPSPEAPASDSHSLQLPISSIVRAVCEAANGGPDLLYEVMIK |
| Ga0075433_115736571 | 3300006852 | Populus Rhizosphere | MSDSSVLAPDVTTSDSNSYQLPISSIVRAVCEAANGGPDLLYEVMIKMSLM |
| Ga0075420_1006116781 | 3300006853 | Populus Rhizosphere | MSDSSVLNPEAPASDSNTLNLPISSMVRAVCEAANGGPDLLYEVMIKMSLMV |
| Ga0068865_1011406942 | 3300006881 | Miscanthus Rhizosphere | MSDSAVKSPDAPASESSSSLLPISSIVRAVCQAASGGPDLLYEVMI |
| Ga0079215_100055261 | 3300006894 | Agricultural Soil | MSDSSVLAPDVATSDSNSYQLPIGSIVRAVCEAAKGGPDLLYEVMIKMSL |
| Ga0075424_1028481391 | 3300006904 | Populus Rhizosphere | MSESSVLNPDPPVSDSNSLQLPISSIIRAVCEAANGGPDLLYEVMIKMSLLVESTAPTYG |
| Ga0079216_103899861 | 3300006918 | Agricultural Soil | MSDSSVLAPDVATSDSNSYQLPIGSIVRAVCEAAKGGPDLLYEVMIKMSLMVD |
| Ga0079219_116192801 | 3300006954 | Agricultural Soil | MSDSSVVSPDAPVSESGTSQLPISSIIRAVCQAANGGPDVLYEVMIKMSLMVEATAPTYG |
| Ga0075419_110588881 | 3300006969 | Populus Rhizosphere | MSDSSVVDLQAPASESLSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYG |
| Ga0075418_113181482 | 3300009100 | Populus Rhizosphere | MSDPSVLAADVPTSDSNPFQLPISSIVRAVCEAASGGPDLLYEVMIKMSLMV |
| Ga0114129_105778263 | 3300009147 | Populus Rhizosphere | MSDPSVLAADVPTSDSNPFQLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVDATAP |
| Ga0105243_102868411 | 3300009148 | Miscanthus Rhizosphere | MSDPSVLSLDAPASESSSPKLPISSIVRAVCEAANGGPDLLYEVMIKMSLM |
| Ga0105243_131291081 | 3300009148 | Miscanthus Rhizosphere | MSDSAVTGPDAPASESSSSQLPISSIVRAVCQAASGGPDLLYEVMIKMSLMVEATAP |
| Ga0111538_106884752 | 3300009156 | Populus Rhizosphere | MSDSSVVDFQAPASEALSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVE |
| Ga0111538_130556272 | 3300009156 | Populus Rhizosphere | MSDSSVVDLQAPASESLSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVE |
| Ga0105241_116336941 | 3300009174 | Corn Rhizosphere | MSDSSVLNPEAPASDLSSVQLPISSIVRAVCEAANGGPDLLYEVMMKM |
| Ga0105242_102324433 | 3300009176 | Miscanthus Rhizosphere | MSDLSVLSPEIPAFESSFPKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATA |
| Ga0105242_129122601 | 3300009176 | Miscanthus Rhizosphere | MSVSLELDSAAETPIPGSLQLPISSIVRAVCEAANEGPDLLYEVM |
| Ga0105238_127528191 | 3300009551 | Corn Rhizosphere | MSDSSVVSPDAPVSESGSSQLPIGSIVRAVCQAASGGPDVLYEVMIKMSLMVEA |
| Ga0105249_101199791 | 3300009553 | Switchgrass Rhizosphere | MSDPSVLAADVPTSDSNPFQLPISSIVRAVCEAASGGPDLLYEVMIKMSLM |
| Ga0105249_135154261 | 3300009553 | Switchgrass Rhizosphere | MSDPSVLSLDAPASESSSPRLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVE |
| Ga0105340_14039841 | 3300009610 | Soil | MSDSTALASDLKPSDSSSVKLPISSIVRAVCEGASGGPDLLYEVMIKMSLMVEATAP |
| Ga0126308_101289722 | 3300010040 | Serpentine Soil | MSDSSVLSPDAPVSESNSLQLPISSIVRAVCEAAKGGPDLLYEVMIKMSLMVEA |
| Ga0126384_105347171 | 3300010046 | Tropical Forest Soil | MSDSAVTGPDAHASESSSSQLLPISSIVRAVCQAAGGGPDLLYEVMIKMSLM |
| Ga0126382_112793681 | 3300010047 | Tropical Forest Soil | MSDSAVTSPDAPASESQLPISSIVRAVCQAASGGPDLL |
| Ga0126376_126964291 | 3300010359 | Tropical Forest Soil | MSDSSVLSPDTPVSESSSLRLPISSIVRAVCEAANGGPDLLYEVMIKVSLM |
| Ga0105239_134455771 | 3300010375 | Corn Rhizosphere | MSDSSLLSPGAEIAEPSFQQLPISSIIRNVCEAANGGPDMLYEALIKMSLMVEATAPTYGLSIWAMAV |
| Ga0134127_119143681 | 3300010399 | Terrestrial Soil | MSDSPALSQDAPASESSSLQLPISSIVRAVCEAADGGPDLLYEVMIKMSLKVE |
| Ga0134122_121339071 | 3300010400 | Terrestrial Soil | MSDSSVLNPEAPASDSNSVQLPISSIVRAVCEAASG |
| Ga0134121_131496061 | 3300010401 | Terrestrial Soil | MSDSSVLSPDAPISESNSLRLPISSIVRAVCEAANGGPDLLYEVMIKVSLMVEA |
| Ga0105246_107658811 | 3300011119 | Miscanthus Rhizosphere | MSDSAVTSPDAPASESSSSLLPISSIVRAVCQAASGGPDLLYEVMIKMSLMVEATA |
| Ga0137378_114304091 | 3300012210 | Vadose Zone Soil | MSDSSELDLAAEIAVPSSVKLPISSIVRALCEAANAGPDLLY |
| Ga0137378_117180521 | 3300012210 | Vadose Zone Soil | MSDSSELDLGAEISVPTSIRLPISSIVRALCEAANAGPDLLYEVMMKMSLM |
| Ga0137394_110716931 | 3300012922 | Vadose Zone Soil | MSDSLEVDSAAETPISRSLQLPISSIVRAVCEAANGGPDLLYEVMIKMSL |
| Ga0157374_127436391 | 3300013296 | Miscanthus Rhizosphere | MSDSAVTGPDAPASESSSSQLPISSIVRAVCQAASGGPDVLYEVMIKMSLMVE |
| Ga0157378_106303792 | 3300013297 | Miscanthus Rhizosphere | MSDSAVTDPDAPASESSSSQLPISSIVRAVCQAASGGPDLLYEVMIKMSLMVEAT |
| Ga0157378_110575411 | 3300013297 | Miscanthus Rhizosphere | MSDSSVLAPDVTTSDSNYYQLPISSIVRAVCEAANGGPDLLYE |
| Ga0163163_130570191 | 3300014325 | Switchgrass Rhizosphere | MSDSSVLAPDVTTSDSNSYQLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVEATAPTYGLS |
| Ga0163163_132993071 | 3300014325 | Switchgrass Rhizosphere | MSDSAVIGPEAPASESSSSQLPISSIVRAVCQAASGGPDLLY |
| Ga0157380_121854031 | 3300014326 | Switchgrass Rhizosphere | MSDPSVLSLDAPASESSSPRLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYG |
| Ga0132258_125708792 | 3300015371 | Arabidopsis Rhizosphere | MSDSANLGLVSQFKDSSPARLPISSIVRAVCEAATQGPERLYEVMMKMSLMVEATAP |
| Ga0132256_1007852551 | 3300015372 | Arabidopsis Rhizosphere | MSDSSVLAPGAPTSDSKSVQLPISSIVRAVCEAASGGPDLLYEV |
| Ga0184625_101065401 | 3300018081 | Groundwater Sediment | MSDSTALASDLKPSDSSSVKLPISSIVRAVCEGASGGPDLLYEVMIKMSLMVEATAPTYG |
| Ga0190270_109766362 | 3300018469 | Soil | MSDSSALASGVQSSESGSVKLPISSIVRAVCEGASGGPDLLYEVMIKMSLMVE |
| Ga0190274_127967121 | 3300018476 | Soil | MSDSSVQSPAAPASDAGPRQLPISSIVRAVCEAANGGPDVLYEVMIKMSLMVEATVPSYG |
| Ga0207710_101687481 | 3300025900 | Switchgrass Rhizosphere | MSDSSVVSPDVPVSESSSTRLPISSIVRAVCEAANGGPDQLYEVMIKVSLMVEATAPTY |
| Ga0207643_102492481 | 3300025908 | Miscanthus Rhizosphere | MSDSSVLSPEAPVSESSSPKLPISSIVRAVCEAASGGPDLLYEVMIKMSLMVESTAPTYGLSI |
| Ga0207643_105177441 | 3300025908 | Miscanthus Rhizosphere | MSDSSVVSPDVPVSESNSLRLPISSIVRAVCEAANGGPDRLYEVMIKVSLMVEATAPTYGLSI |
| Ga0207654_108146121 | 3300025911 | Corn Rhizosphere | MSDPSVLSLETPVFESSSPKLPISSIVRAVCEAASGGPDLLYEVMIKM |
| Ga0207695_107061421 | 3300025913 | Corn Rhizosphere | MSDSAVTGPDAPASESSSSQLLPISSIVRAVCQAASGGPDRLYEVMI |
| Ga0207662_101400711 | 3300025918 | Switchgrass Rhizosphere | MSDSAVKSPDAPASESSSSLLPISSIVRAVCQAASGGPDVLYEVMIK |
| Ga0207681_113323812 | 3300025923 | Switchgrass Rhizosphere | MSDSSVLNPEAPASDLSSVQLPISSIVRAVCEAANGGPDLLYEVMMKMSL |
| Ga0207659_108979741 | 3300025926 | Miscanthus Rhizosphere | MSDSSVLAPDVPTSDSKSYQLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEA |
| Ga0207690_111851721 | 3300025932 | Corn Rhizosphere | MSDSSVLAPDVPTSDSKSYQLPISSIVRAVCEAANGGPDLLY |
| Ga0207709_115320212 | 3300025935 | Miscanthus Rhizosphere | MSDPSVLSLETPVFESSSPKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVE |
| Ga0207709_117059471 | 3300025935 | Miscanthus Rhizosphere | MSDSAVKSPEAPASESSSSLLPISSIVRAVCQAASGGPDVLYEVMIKMSRMVEA |
| Ga0207704_111340661 | 3300025938 | Miscanthus Rhizosphere | MSDSAVTGPDAPASESSSSLLPISSIVRAVCQAASGGPDALYEVMIKMSLMVEATAPTYG |
| Ga0207691_108520701 | 3300025940 | Miscanthus Rhizosphere | MSDSAVTSPDAPASESSSSLLPISSIVRAVCQAASGGPDLLYEVMIKM |
| Ga0207689_101648924 | 3300025942 | Miscanthus Rhizosphere | MSDSSVLAPGAATSDSKSVQLPISSIVRAVCEAASGGPDLLYEV |
| Ga0207689_116597621 | 3300025942 | Miscanthus Rhizosphere | MSDSSVLSPDVPISESSSLRLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYGLSI |
| Ga0207651_103570591 | 3300025960 | Switchgrass Rhizosphere | MSDSSVLAPDVTTSDSTSYKLPISSMVRAVCEAANGGPDLLYEVMIKMSLMVEAT |
| Ga0207651_110204132 | 3300025960 | Switchgrass Rhizosphere | MSDSSVLAPDVPTSDSKSYQLPISSIVRAVCEAANGGPDLLYEVMIKMSL |
| Ga0207708_102249661 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDSSVLAPDVPTSDSNSYQLPISSMVRAVCEAANGGPDLLYEVMIKMSLMVEATAP |
| Ga0207641_107411231 | 3300026088 | Switchgrass Rhizosphere | MSDSAVIGPDAPASESSSSQLPISSIVRAVCQAASGGPDLLYEVMIKMSLMVEATAPT |
| Ga0207648_101437772 | 3300026089 | Miscanthus Rhizosphere | MSDSAVTSPDAPASESSSSLLPISSIVRAVCQAASGGPDVLYEVMIKMSLMVEAT |
| Ga0207676_122049371 | 3300026095 | Switchgrass Rhizosphere | MSDPSVLSLETPVFESSSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYGLSI |
| Ga0207674_115009871 | 3300026116 | Corn Rhizosphere | MSDPSVLSPEIPAFESSFPKLPISSIVRAVCEAANGGPDLLYEVMIKMSL |
| Ga0209215_10074681 | 3300027266 | Forest Soil | MSDPSVLSPDVPASESSSQKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTY |
| Ga0209481_105139751 | 3300027880 | Populus Rhizosphere | MSDFSVFAPDAPTSDSNSFKLPISSIVRAVCEAASGGPDLLYE |
| Ga0209382_112060211 | 3300027909 | Populus Rhizosphere | MSDSSVLAPDVPTSDSNSSKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYGLSIWST |
| Ga0268264_108987041 | 3300028381 | Switchgrass Rhizosphere | MSDPSVLTLETPVFESSSPKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPTYG |
| Ga0268240_100209212 | 3300030496 | Soil | MSDSSVVSPDVPVSESNSLRLPISSIVRAVCEAANGGPDVLYEVMIKVSLMVEATAPTYG |
| Ga0307413_120813171 | 3300031824 | Rhizosphere | MSDSSVLDPETPASASQSLQLPISSIVRAVCEAANGGPDLLYE |
| Ga0307406_108902361 | 3300031901 | Rhizosphere | MSDSSVLSPDAPASESSSLKLPISSIVRAVCEAANGGPDLLYEVMIKMSLMVEATAPT |
| Ga0310900_109794851 | 3300031908 | Soil | MSDSAVIGPDAPASESSSSQLPISSIVRAVCQAASGGPDLL |
| ⦗Top⦘ |