| Basic Information | |
|---|---|
| Family ID | F060263 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 46 residues |
| Representative Sequence | DAVVEFSDLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.74 % |
| % of genes from short scaffolds (< 2000 bps) | 90.23 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.812 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.865 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 25.71% Coil/Unstructured: 74.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF01424 | R3H | 69.92 |
| PF14849 | YidC_periplas | 10.53 |
| PF02096 | 60KD_IMP | 9.02 |
| PF00825 | Ribonuclease_P | 0.75 |
| PF01609 | DDE_Tnp_1 | 0.75 |
| PF01809 | YidD | 0.75 |
| PF00012 | HSP70 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1847 | Predicted RNA-binding protein Jag (SpoIIIJ-associated), conains KH and R3H domains | General function prediction only [R] | 69.92 |
| COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 9.02 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG0594 | RNase P protein component | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.75 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.75 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.75 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120817009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1675 | Open in IMG/M |
| 3300004091|Ga0062387_100515718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300004091|Ga0062387_101006513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300004092|Ga0062389_102055821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300005166|Ga0066674_10043697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2008 | Open in IMG/M |
| 3300005184|Ga0066671_10835279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005332|Ga0066388_103983781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300005332|Ga0066388_105468863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300005332|Ga0066388_108726693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005436|Ga0070713_100557444 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005439|Ga0070711_100769053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300005445|Ga0070708_101988487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005468|Ga0070707_101536790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300005540|Ga0066697_10470648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300005545|Ga0070695_101040668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300005546|Ga0070696_100117589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1921 | Open in IMG/M |
| 3300005561|Ga0066699_11270496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005610|Ga0070763_10693404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300006173|Ga0070716_101342559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300006175|Ga0070712_100345395 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300006881|Ga0068865_101363129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
| 3300006893|Ga0073928_10123451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2131 | Open in IMG/M |
| 3300006904|Ga0075424_100383386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300009088|Ga0099830_11400693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300009143|Ga0099792_10137836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300009143|Ga0099792_10343432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300009638|Ga0116113_1171192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300009672|Ga0116215_1038760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2182 | Open in IMG/M |
| 3300010043|Ga0126380_10354935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300010046|Ga0126384_11634198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300010047|Ga0126382_12181470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300010326|Ga0134065_10177042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300010341|Ga0074045_10946743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300010360|Ga0126372_10598809 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300010366|Ga0126379_10067657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3030 | Open in IMG/M |
| 3300010379|Ga0136449_100427357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2336 | Open in IMG/M |
| 3300010379|Ga0136449_101003544 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300012189|Ga0137388_10710185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300012202|Ga0137363_11330003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300012203|Ga0137399_10937387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300012205|Ga0137362_10827016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300012210|Ga0137378_11257295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300012211|Ga0137377_10197015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1934 | Open in IMG/M |
| 3300012363|Ga0137390_10328512 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300012582|Ga0137358_10617653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300012918|Ga0137396_10690339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300012923|Ga0137359_10759242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300012925|Ga0137419_10873426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300012930|Ga0137407_10311053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1442 | Open in IMG/M |
| 3300012955|Ga0164298_11105940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300014162|Ga0181538_10677536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300015052|Ga0137411_1177087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300015089|Ga0167643_1038801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300016294|Ga0182041_10374124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1204 | Open in IMG/M |
| 3300016294|Ga0182041_11932190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300016357|Ga0182032_10182480 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300016371|Ga0182034_10133083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1841 | Open in IMG/M |
| 3300016387|Ga0182040_10307946 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300016404|Ga0182037_10098421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2099 | Open in IMG/M |
| 3300016404|Ga0182037_10365465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1179 | Open in IMG/M |
| 3300017823|Ga0187818_10044027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1917 | Open in IMG/M |
| 3300017926|Ga0187807_1246624 | All Organisms → cellular organisms → Bacteria → PVC group | 585 | Open in IMG/M |
| 3300017928|Ga0187806_1346210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300017955|Ga0187817_10150597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1479 | Open in IMG/M |
| 3300017955|Ga0187817_10296973 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300017955|Ga0187817_10470447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300018060|Ga0187765_10121054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
| 3300018088|Ga0187771_11145625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300018088|Ga0187771_11847327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300019788|Ga0182028_1454044 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300020199|Ga0179592_10308512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300020579|Ga0210407_10521285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300020579|Ga0210407_10575628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300020579|Ga0210407_11428427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300020580|Ga0210403_11227416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300021086|Ga0179596_10689581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300021168|Ga0210406_10075469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2891 | Open in IMG/M |
| 3300021171|Ga0210405_11239490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300021403|Ga0210397_10296039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300021406|Ga0210386_11006525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300021420|Ga0210394_11412029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300021432|Ga0210384_10041471 | All Organisms → cellular organisms → Bacteria | 4223 | Open in IMG/M |
| 3300021478|Ga0210402_11151258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300021479|Ga0210410_11119129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300025922|Ga0207646_11412216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300026295|Ga0209234_1038429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1820 | Open in IMG/M |
| 3300026334|Ga0209377_1106017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300026514|Ga0257168_1088069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300026551|Ga0209648_10579788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300026555|Ga0179593_1052673 | All Organisms → cellular organisms → Bacteria | 2811 | Open in IMG/M |
| 3300027063|Ga0207762_1022990 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300027376|Ga0209004_1005840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1695 | Open in IMG/M |
| 3300027537|Ga0209419_1065071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300027648|Ga0209420_1013048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2861 | Open in IMG/M |
| 3300027678|Ga0209011_1188827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300027824|Ga0209040_10186503 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300027829|Ga0209773_10183817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
| 3300027862|Ga0209701_10340262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300027867|Ga0209167_10821924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300027903|Ga0209488_10518286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300027910|Ga0209583_10230265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 807 | Open in IMG/M |
| 3300030043|Ga0302306_10063204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
| 3300031545|Ga0318541_10190713 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031573|Ga0310915_10783814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300031724|Ga0318500_10146535 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300031754|Ga0307475_11560368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300031823|Ga0307478_10279018 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300031823|Ga0307478_11328260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300031833|Ga0310917_10332855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1029 | Open in IMG/M |
| 3300031833|Ga0310917_10761344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300031860|Ga0318495_10256184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300031897|Ga0318520_10916193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300031942|Ga0310916_11473669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300031947|Ga0310909_10729172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300031947|Ga0310909_10828273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300031954|Ga0306926_11900948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300031959|Ga0318530_10108826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300031962|Ga0307479_11526643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300032001|Ga0306922_10347502 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300032043|Ga0318556_10230406 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300032065|Ga0318513_10574333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300032160|Ga0311301_10351304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2306 | Open in IMG/M |
| 3300032174|Ga0307470_10821282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300032180|Ga0307471_101075654 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300032180|Ga0307471_102237316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300032205|Ga0307472_100560453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300032205|Ga0307472_102246567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300032783|Ga0335079_11713667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300032828|Ga0335080_10878156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300032829|Ga0335070_10311420 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300032954|Ga0335083_10044884 | All Organisms → cellular organisms → Bacteria | 4738 | Open in IMG/M |
| 3300033004|Ga0335084_11873759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300033561|Ga0371490_1087539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1208170093 | 3300002568 | Soil | EGGDAIVEISDLRFPHLRPDRPASFTYRVRFNAAGNVLEQGWAKDKP* |
| Ga0062387_1005157181 | 3300004091 | Bog Forest Soil | FPVTYFHREGPEAVVEITDLRFARLRPDRSPSFTYQVRFAADGRVLSQGWRKP* |
| Ga0062387_1010065132 | 3300004091 | Bog Forest Soil | HKEGSDAVVEILDKRFPQIRPDRPAPFTYRVRFDAAGNVLIQGWER* |
| Ga0062389_1020558212 | 3300004092 | Bog Forest Soil | DRFPVTYFHPEGSEAVVEITDLRFARLRPDRTPSFTYQVRFAADGQLLSQGWLKPKK* |
| Ga0066674_100436971 | 3300005166 | Soil | RFHQEGDVAVVEISDLRFPRVRPGRPASFTYRVRLGTDGNVLSQGWATR* |
| Ga0066671_108352792 | 3300005184 | Soil | TESVVEILDLRFPPIRPDRPASFTYRVRFDADGKVLSQGWERQ* |
| Ga0066388_1039837812 | 3300005332 | Tropical Forest Soil | VVEFLDLRFPQIRRNRPAAFTYRVRFDSSGNLVSKGWVRND* |
| Ga0066388_1054688631 | 3300005332 | Tropical Forest Soil | FHKDGSDAVVEFFDLRFPQIRRDRPASFTYRVRFAPDGTILSQGWVRR* |
| Ga0066388_1087266931 | 3300005332 | Tropical Forest Soil | TRFRHEGADSVVEFSDLRFAQIRKDRPASFTYQVRFSADGTILSQGWLRR* |
| Ga0070713_1005574443 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEIADLRFPQINPNRPASFTYRVRFATDQTVLSQGWVRPN* |
| Ga0070711_1007690531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DAIVEISDLRFPHLRPDRPASFTYRVRFDAAGNVLEQGWIKDKR* |
| Ga0070708_1019884871 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VEISDLRFPQMRPDRPASFTYRVRFAPDGVVLSQGWVNPKE* |
| Ga0070707_1015367902 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PDAIVEISDLRFPQLRPDRPSSFTYRVRFAPDQTVLSQGWVKPK* |
| Ga0066697_104706481 | 3300005540 | Soil | VEISDLRFPQGRSGRPPSFTYRVRFGSDGNVLSQGWATR* |
| Ga0070695_1010406682 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FHKEGSVAIVEVSDLRFPHLRPDRPASFTYQVRFDAAGKILEQGWVKDRRVRNSK* |
| Ga0070696_1001175893 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IVEVSDLRFPHLRPDRPASFTYQVRFDAAGKILEQGWVKDRRVRNSK* |
| Ga0066699_112704961 | 3300005561 | Soil | RFPVTGFHKEGNQAIVEIRDVRFAQIRRDRPSSFTYRVCFDASGNLLSQGWATR* |
| Ga0070763_106934041 | 3300005610 | Soil | EFLDLRFPQIRRDRPASFTYRVRFDANSSVISQGWVRN* |
| Ga0070716_1013425592 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVVEIADLRFPQINPNRPASFTYRVRFAADQTVLSQGWVRPN* |
| Ga0070712_1003453951 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEFSDLRFPTIRKDRPAGFTYQVKFAPDGTVLSQGWVRR* |
| Ga0068865_1013631291 | 3300006881 | Miscanthus Rhizosphere | EAVVEILDLRFAKVRPDRPASFTYRVRFDKAGKIVDQGWVRE* |
| Ga0073928_101234513 | 3300006893 | Iron-Sulfur Acid Spring | RFHKEGGDAVVEISDLRFPHVRPDRPAAFTYRVLFSATGTVLSQGWDK* |
| Ga0075424_1003833861 | 3300006904 | Populus Rhizosphere | RFPVTRFHKEGSVAIVEVSDLRFPHLRPDRPASFTYQVRFDGAGKILEQGWVKDRRVRNSK* |
| Ga0099830_114006932 | 3300009088 | Vadose Zone Soil | TEGDAAVVEISDLRFPQTRPDRPASFTYLVRFARDGSVLSQGWHRPRR* |
| Ga0099792_101378363 | 3300009143 | Vadose Zone Soil | TRFRTEGGNAVVEISDLRFPKTRPDRPASFTYQVRFAGDGSVLSQGWVRPR* |
| Ga0099792_103434321 | 3300009143 | Vadose Zone Soil | RFPVIRFHKEGPDAIVEISDLRFPQMRPDRPSSFTYRVHFASDQTVLSQGWVKPK* |
| Ga0116113_11711922 | 3300009638 | Peatland | PLTRFHQEGDDAVVEISDKRFPQLRPDRPAPFTYRVRFAANGQVVAEGWER* |
| Ga0116215_10387601 | 3300009672 | Peatlands Soil | DEAVVEFSDLRFPHIRPDRPASFTYRVRFSGDGRVISQGWVRR* |
| Ga0126380_103549351 | 3300010043 | Tropical Forest Soil | RFHKEGGDAVVEILDLRFAKVRPDRPASFTYRVRFDAAGKVTEQGWVRE* |
| Ga0126384_116341982 | 3300010046 | Tropical Forest Soil | IVEIHDARFPQIRSDRAASFTYRVRFAQDGSLLSQGWLRPN* |
| Ga0126382_121814701 | 3300010047 | Tropical Forest Soil | DAVVEILDLRFAKVRPDRPASFTYRVRFDAAGKVLAQGWLRD* |
| Ga0134065_101770422 | 3300010326 | Grasslands Soil | VTRFHQEGDVAVVEISDLRFPRVRPGRPASFTYRVRLGTDGNVLSQGWATR* |
| Ga0074045_109467431 | 3300010341 | Bog Forest Soil | KEGGDAIVEFSDKRFPQIRRDRPGSFTYRVRFSADGKAISQGWVRR* |
| Ga0126372_105988091 | 3300010360 | Tropical Forest Soil | EILDLRFARVRPDRPASFTYRVRFGSGGNVVHQGWVRE* |
| Ga0126379_100676571 | 3300010366 | Tropical Forest Soil | PVTRFRKDGNDAVVEFSDLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR* |
| Ga0136449_1004273571 | 3300010379 | Peatlands Soil | PVTRFHKEGDQAIVEISDLRFPRARPGRPASFTYRVTFAPDGTVLSKGWVTQ* |
| Ga0136449_1010035444 | 3300010379 | Peatlands Soil | PVTRFHKEGDQAIVEISDLRFPRARPGRPASFTYRVTFAPGGSVLSKGWVTQ* |
| Ga0137388_107101851 | 3300012189 | Vadose Zone Soil | SRFPVTRFHKEGDVAVVEISDLRFPQARPGRPAAFTYRVRFSTDGNVLSQGWVKR* |
| Ga0137363_113300032 | 3300012202 | Vadose Zone Soil | FHKEGSDAIVEISDLRFPHVRPDRPASFTYQVRFGANGTVLSQGWSK* |
| Ga0137399_109373871 | 3300012203 | Vadose Zone Soil | EGPDAIVEISDLRFPQMRPDRPSSFTYRVRFASDQTVLSQGWVKPK* |
| Ga0137362_108270162 | 3300012205 | Vadose Zone Soil | KEGEVAVVEISDIRFVQTRRDRPASFTYRVRFSPAGSVLSQGWVRR* |
| Ga0137378_112572951 | 3300012210 | Vadose Zone Soil | IADLRFPQTRRDRPAGFTYRVRFGSDGSVLSKGWVTR* |
| Ga0137377_101970153 | 3300012211 | Vadose Zone Soil | RFPVTRFHQEGDVAVVEISDLRFPRVRPGRPASFTYRVRLGTDGNVLSQGWATR* |
| Ga0137390_103285121 | 3300012363 | Vadose Zone Soil | VVEISDLRFPQTRPDRPASFTYRVRFATDGSVRSQGWLRPR* |
| Ga0137358_106176531 | 3300012582 | Vadose Zone Soil | TRFHKEGEIAVVEIADVRFVQIRRDRPAAFTYRVRFGSDGNVLSQGWATR* |
| Ga0137396_106903391 | 3300012918 | Vadose Zone Soil | RFHKEGADAIVEISDLRFPQMRPDRPASFTYRVRFAADETVLSQGWIRPR* |
| Ga0137359_107592421 | 3300012923 | Vadose Zone Soil | RFPVIRFHKEGPDAIVEISDLRFPQMRPDRPSSFTYRVRFASDQTVLSQGWVKPK* |
| Ga0137419_108734261 | 3300012925 | Vadose Zone Soil | FHKEGPDAIVEISDLRFPQMRPDRPSSFTYRVRLASDQTVLSEGWVKPK* |
| Ga0137407_103110533 | 3300012930 | Vadose Zone Soil | FHKEGDVAVVEISDLRFPQGRTGRPPSFTYRVRFGSDGNVLSQGWATR* |
| Ga0164298_111059401 | 3300012955 | Soil | KEGPDAVVEFSDLRFPTIRKDRPAGFTYQVKFAPDGTVLSQGWVRR* |
| Ga0181538_106775362 | 3300014162 | Bog | VTQFHKEGGDAIVEFSDKRFPQPRRDRPASFTYRVRFSSDGKAISQGWVRR* |
| Ga0137411_11770871 | 3300015052 | Vadose Zone Soil | AIVEISDLRFPRMRPDRPGGFTYRVRFDANGNVLSKGWRGR* |
| Ga0167643_10388011 | 3300015089 | Glacier Forefield Soil | ARFPVTRFHKEGSVAVVEISDLRFPHVRPDRPASFTYRVRFAADGTVLSQGWLK* |
| Ga0182041_103741243 | 3300016294 | Soil | FYKEGAEAVVEFSDLRFPQIRRDRPASLTYRVRFSPEGAVLSQGWVRR |
| Ga0182041_119321902 | 3300016294 | Soil | DLRFPQIRRDRPAAFTYQVRFSPDGAVLSQGWLRR |
| Ga0182032_101824801 | 3300016357 | Soil | QVRKLNDAVVEFSDLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR |
| Ga0182034_101330833 | 3300016371 | Soil | DLRFAKVRPDRPASFTYRVRFDADGRVLAQGWVRE |
| Ga0182040_103079463 | 3300016387 | Soil | QAVVEISDLRFASLRHDRPAAFTYRVRFSPEGEVLSKGWVRR |
| Ga0182037_100984211 | 3300016404 | Soil | KDGNEAVVEFSDLRFPQIRRDRAASFTYRVRFAPNGTVLSQGWVRR |
| Ga0182037_103654653 | 3300016404 | Soil | EFSDLRFPQIRRDRPASFTYRVRFSPEGAVLSQGWVRR |
| Ga0187818_100440273 | 3300017823 | Freshwater Sediment | EISDLRFARTRPGRPSAFTYRVRFAADGNVISQGWVTR |
| Ga0187807_12466242 | 3300017926 | Freshwater Sediment | MEGSEAVVEISDKRFAQLRRDRPGSFTYRVRFSPGGKVISQGWERQ |
| Ga0187806_13462102 | 3300017928 | Freshwater Sediment | SDKRFPQIRRDRPGSFTYQVRFSSAGKVLSQGWLRR |
| Ga0187817_101505971 | 3300017955 | Freshwater Sediment | EGGDAIVEISDLRFPHVRPDRPASFTYLIRFGVTGNVLSQGWVKPR |
| Ga0187817_102969731 | 3300017955 | Freshwater Sediment | DMRFASLRPDRPSSFTYRVRFSESGEVLSQGWVRR |
| Ga0187817_104704472 | 3300017955 | Freshwater Sediment | RFHMEGDEAVVEFSDMRFPHIRPDRPASFTYRVRFSSSRSVIAQGWVRR |
| Ga0187765_101210544 | 3300018060 | Tropical Peatland | RLPDVQKVLWFSRFPVTRFHREGPEAVVEFSDLRFAQIRKDRPNSFTYQVRFSADGALLSQGWLR |
| Ga0187771_111456251 | 3300018088 | Tropical Peatland | VTRFHMEGDEAVVEISDLRFASLRRDRASAFTFRVRFSADGQVLSQGWVPR |
| Ga0187771_118473272 | 3300018088 | Tropical Peatland | HKEGAEAVVEFSDMRFASMRRDRPGAFTYRVRFGGDGKVLSQGWVRR |
| Ga0182028_14540442 | 3300019788 | Fen | VTLFHKEGDEAVVEFSDLRFPHIRPDRPASFTYRVRFSGDGSVIAQGWVRR |
| Ga0179592_103085122 | 3300020199 | Vadose Zone Soil | EGEEAIVEILDLRFPQMRPDKPASFTYRVRFATDGAVISQGWLKPR |
| Ga0210407_105212852 | 3300020579 | Soil | PVTRFRKEGDEAVVEISDMRFSSRRPGRAPSFTYRVRFAGDGGVLSQGWVRP |
| Ga0210407_105756281 | 3300020579 | Soil | VSDLRFVQVRRDRPASFTYRVQFSPDGNVLSKGWVTK |
| Ga0210407_114284271 | 3300020579 | Soil | FHREGTDAIVEISDLRFPQMRPDRPASFTYRVRLAADQTVLSQGWVRPM |
| Ga0210403_112274161 | 3300020580 | Soil | DIRFQSALRDRPSSFTYRVRFAADGSVLSKGWVTM |
| Ga0179596_106895812 | 3300021086 | Vadose Zone Soil | DVAVVEISDLRFPRVRPGRPASFTYRVRLGTDGNVLSQGWATR |
| Ga0210406_100754691 | 3300021168 | Soil | FHKEGEDAIVEISDLRFPRARPGRPASFTYRVRFAPDGTVLSKGWVTQ |
| Ga0210405_112394902 | 3300021171 | Soil | GDDAIVEIADLRFPHVRPDRPAAFTYRVRFAANGNVVSQGWVRP |
| Ga0210397_102960391 | 3300021403 | Soil | VEFSDLRFPTIRKDRPAGFTYQVKFAPDGTVLSQGWVRR |
| Ga0210386_110065252 | 3300021406 | Soil | ARFPVTRFHKEGPDAVVEFSDLRFPTIRKDRPAGFTYQVKFAPDGTVLSQGWVRR |
| Ga0210394_114120291 | 3300021420 | Soil | FHKEGTEAVVEISDLRFPQLKPGHPSSFTYRVRFAQDGTVISEGWVKT |
| Ga0210384_100414711 | 3300021432 | Soil | DAIVEISDLRFPQMRPDRPSSFTYRVRLAADQTVLSQGWVKPR |
| Ga0210402_111512581 | 3300021478 | Soil | TSDLRFPHLRPDRPASFTYRVRFDVAGNVLEQGWVKDKK |
| Ga0210410_111191291 | 3300021479 | Soil | LWFSRFPVTRFHKEGGDAVVEISDLRFPHLRSDRPAAFTYRVRFSATGAVLSQGWAK |
| Ga0207646_114122161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PDAIVEISDLRFPQLRPDRPSSFTYRVRFAPDQTVLSQGWVKPK |
| Ga0209234_10384291 | 3300026295 | Grasslands Soil | HQEGDVAVVEISDLRFPRVRPGRPASFTYRVRLGTDGNVLSQGWATR |
| Ga0209377_11060174 | 3300026334 | Soil | FHKEGDIAVVEISDIRFVQTRRDRPASFTYRVRFNPAGNVLSQGWVRR |
| Ga0257168_10880691 | 3300026514 | Soil | FPVTRFHKEGADAVVEISDLRFPQMKPDRPAPFTYTVRLAADQTVLSQGWARPR |
| Ga0209648_105797881 | 3300026551 | Grasslands Soil | ISDLRFPTIRKDRPAGFTYQVKFAPDGTVLSQGWVRR |
| Ga0179593_10526731 | 3300026555 | Vadose Zone Soil | EFLDVRFPQIRRDRPPSFEYRVRFSADGEVLSQGWVKSRQV |
| Ga0207762_10229901 | 3300027063 | Tropical Forest Soil | DGNDAVVEFSDLRFPQIRRDRPASFTYRVRFAPDGTILSQGWVRR |
| Ga0209004_10058401 | 3300027376 | Forest Soil | VEILELRFPPMRPDRPASFTYRVRFAADGKVISQGWETK |
| Ga0209419_10650711 | 3300027537 | Forest Soil | AVVEISDLRFPHVKPDRPAAFTYRVLFGATGTVLSQGWDK |
| Ga0209420_10130481 | 3300027648 | Forest Soil | FPVTRFHKEGGDAIVEIADIRFPHERPDRPASFTYQVRFSSTGTLLSQGWEK |
| Ga0209011_11888272 | 3300027678 | Forest Soil | FPVTRFHKEGSDAIVEIADLRFPHVRPDRPASFTYRVRFGLDGRLRSQGWVRR |
| Ga0209040_101865031 | 3300027824 | Bog Forest Soil | TRFHREGSDAIVEISDLRFPQTRRDRVPSFTYRIRFSDAGRVLSQGWVTR |
| Ga0209773_101838173 | 3300027829 | Bog Forest Soil | FPVTQFHKEGNDAVVEFSDKRFAQIRRDRPIPFLYRVRFSADGKTISQGWVK |
| Ga0209701_103402623 | 3300027862 | Vadose Zone Soil | EGSNVIVEFSDLRFPQVRPDRPASFTYRVRFSQEGAVLSQGWVKQ |
| Ga0209167_108219241 | 3300027867 | Surface Soil | WFDRFPVTYFHREGSEAVVEITDLRFARLRPDRTAAFTYQVRFAADGRVLSQGWRKP |
| Ga0209488_105182861 | 3300027903 | Vadose Zone Soil | HKEGEEAIVEILDLRFPQMRPDKPASFTYRVRFATDGAVISQGWLKPR |
| Ga0209583_102302651 | 3300027910 | Watersheds | IVEISDLRFPKIRPDRPAGFTYRVRFGPEGRVVSKGWVRR |
| Ga0302306_100632044 | 3300030043 | Palsa | PVTQFHKEGVDAVVEISDKRFPQIRPDRPAAFTYRVRFGSSGQVVSQGWER |
| Ga0318541_101907131 | 3300031545 | Soil | FSDLRFPQIRRDRPASFTYRVRFAPNGAVLSQGWVRR |
| Ga0310915_107838141 | 3300031573 | Soil | EGQEAVIEILDLRFARVRTDRPAAFTYQVRFDAAGKVVSQGWERE |
| Ga0318500_101465351 | 3300031724 | Soil | EFSDLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR |
| Ga0307475_115603682 | 3300031754 | Hardwood Forest Soil | GTDAVVEISDLRFPQMRPDRPASFTYRVRLAADQTVLSQGWVRPM |
| Ga0307478_102790181 | 3300031823 | Hardwood Forest Soil | KEGGEAVVEISDLRFPQMRPDRPASFTYRVRFAAEGTVVSQGWIKPK |
| Ga0307478_113282601 | 3300031823 | Hardwood Forest Soil | EGGDAVVEISDLRFPHVRTDRPAAFTYRVLFGATGAVLSQGWDK |
| Ga0310917_103328553 | 3300031833 | Soil | RFHKEGGDAVVEFSDLRFPQIRPDRPASFTYRVRFSQNGDVVSQGWVRR |
| Ga0310917_107613442 | 3300031833 | Soil | DLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR |
| Ga0318495_102561842 | 3300031860 | Soil | ARFPVTRFRKDGNDAVVEFSDLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR |
| Ga0318520_109161932 | 3300031897 | Soil | RFHKEGQEAVIEILDLRFARVRTDRPAAFTYQVRFDAAGKVVSQGWERE |
| Ga0310916_114736691 | 3300031942 | Soil | VEILDLRFAKVRPDRPASFTYRVRFDADGRVLAQGWVRE |
| Ga0310909_107291723 | 3300031947 | Soil | KDGNDAVVEFSDLRFPQIRRDRPASFTYRVRFAPDGMILSQGWVRR |
| Ga0310909_108282731 | 3300031947 | Soil | RENTGAVVEFSDLRFPQVRRDRPAAFTYGVRFDALGNVVSKGWLRD |
| Ga0306926_119009482 | 3300031954 | Soil | DAVVEFSDLRFAQIRRDRPASFTYRVRFAPDGAVLSQGWVRR |
| Ga0318530_101088262 | 3300031959 | Soil | VTRFHKEGQEAVIEILDLRFARVRTDRPAAFTYQVRFDAAGKVVSQGWERE |
| Ga0307479_115266432 | 3300031962 | Hardwood Forest Soil | PVTRFHKEGADAVVEISDLRFPQMKPDRLPSFTYRVRFASDGAVLSQGWVRPR |
| Ga0306922_103475023 | 3300032001 | Soil | DQAVVEISDLRFASLRHDRPAAFTYRVRFSPEGEVLSKGWVRR |
| Ga0318556_102304061 | 3300032043 | Soil | RFPVTRFHKDGNDAVVEFSDLRFAQIRRDRPASFTYRVRFAPDGALLSQGWVRR |
| Ga0318513_105743332 | 3300032065 | Soil | AQAVVEFSDLRFPQIRRDRPASFTYRVRFSPEGAVLSQGWVRR |
| Ga0311301_103513041 | 3300032160 | Peatlands Soil | GDQAIVEISDLRFPRARPGRPASFTYRVTFAPGGSVLSKGWVTQ |
| Ga0307470_108212822 | 3300032174 | Hardwood Forest Soil | SVVEILDLRFPAIRPDRPASFTYRVRFDAAGKVLSQGWVRE |
| Ga0307471_1010756543 | 3300032180 | Hardwood Forest Soil | AVVEISDLRFPQTRPDRPASFTYRVRFAPDGSVRSQGWLRPL |
| Ga0307471_1022373161 | 3300032180 | Hardwood Forest Soil | HVENGAPVVEISDLRFAKIRPDRPNRFTYQVRFDTSGNVISQGWLGR |
| Ga0307472_1005604533 | 3300032205 | Hardwood Forest Soil | EFSDLRFPTIRKDRPAGFTYQVKFAPDGTVLSQGWVRR |
| Ga0307472_1022465672 | 3300032205 | Hardwood Forest Soil | TDAIVEISDLRFPQMRPDRPASFTYRVRLAADQTVLSQGWVRPM |
| Ga0335079_117136671 | 3300032783 | Soil | QKVLWFMRFPVTQFHKEGGDAVVEFSDKRFPQIRRDRPGGFTYQVRFAGDGKTITQGWLR |
| Ga0335080_108781563 | 3300032828 | Soil | EEAVVEFSDLRFPQIRRDRPASFTYRVRFAADGTLLSQGWVRR |
| Ga0335070_103114201 | 3300032829 | Soil | DVRFPQIRRDRPPSFEYQVRFSADGEVLSEGWLKR |
| Ga0335083_100448847 | 3300032954 | Soil | VTRFHREGPDAVVEFSDLRFAQIRKDRPNSFTYQVRFASDGALLSQGWLR |
| Ga0335084_118737592 | 3300033004 | Soil | VLWFSRFPVTRFHKEGREAVVEFTDLRFAQIRKDRPASFTYQVRFSAEGSLVSQGWLRR |
| Ga0371490_10875391 | 3300033561 | Peat Soil | EFSDLRFPHIRPDRPASFTYRVRFSADGKVIAQGWVRR |
| ⦗Top⦘ |