| Basic Information | |
|---|---|
| Family ID | F060259 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 48 residues |
| Representative Sequence | ILVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEGMLDSPA |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.74 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.023 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.639 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (75.188 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF02585 | PIG-L | 3.76 |
| PF08335 | GlnD_UR_UTase | 1.50 |
| PF07813 | LTXXQ | 0.75 |
| PF00534 | Glycos_transf_1 | 0.75 |
| PF08220 | HTH_DeoR | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 3.76 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 3.01 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 1.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.25 % |
| Unclassified | root | N/A | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000787|JGI11643J11755_11648026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300000955|JGI1027J12803_107835681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300002120|C687J26616_10102323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300003267|soilL1_10022503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2900 | Open in IMG/M |
| 3300003319|soilL2_10003320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 5823 | Open in IMG/M |
| 3300004157|Ga0062590_102355604 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005093|Ga0062594_100649955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300005294|Ga0065705_10244469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300005295|Ga0065707_10159811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1574 | Open in IMG/M |
| 3300005328|Ga0070676_10223589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300005331|Ga0070670_101425861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300005332|Ga0066388_105719928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300005336|Ga0070680_100144539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1995 | Open in IMG/M |
| 3300005338|Ga0068868_102283833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300005364|Ga0070673_101403066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300005367|Ga0070667_101203438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300005434|Ga0070709_10464435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300005438|Ga0070701_10146497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300005438|Ga0070701_10647434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300005440|Ga0070705_101073695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300005444|Ga0070694_100750880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300005444|Ga0070694_101641680 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005456|Ga0070678_100428620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300005466|Ga0070685_10846673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300005466|Ga0070685_11218749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005468|Ga0070707_102068607 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005543|Ga0070672_101432756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300005545|Ga0070695_100380023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300005545|Ga0070695_101745971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005548|Ga0070665_100098241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2932 | Open in IMG/M |
| 3300005548|Ga0070665_101497134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300005563|Ga0068855_100745115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300005577|Ga0068857_100151744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2099 | Open in IMG/M |
| 3300005577|Ga0068857_101997452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300005578|Ga0068854_100183052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300005598|Ga0066706_10646640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 839 | Open in IMG/M |
| 3300005617|Ga0068859_100524892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1279 | Open in IMG/M |
| 3300005617|Ga0068859_101557975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300005618|Ga0068864_100815826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300005840|Ga0068870_10834268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005841|Ga0068863_101999316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300005842|Ga0068858_100134891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2316 | Open in IMG/M |
| 3300005843|Ga0068860_100167870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2119 | Open in IMG/M |
| 3300006173|Ga0070716_101569012 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006806|Ga0079220_11978790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300006844|Ga0075428_101251913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300006844|Ga0075428_102603746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300006845|Ga0075421_102679195 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006846|Ga0075430_100617273 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300006852|Ga0075433_10039796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4066 | Open in IMG/M |
| 3300006871|Ga0075434_100829240 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006871|Ga0075434_102273498 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006876|Ga0079217_10878241 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006894|Ga0079215_10568659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300006918|Ga0079216_10033915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2073 | Open in IMG/M |
| 3300007255|Ga0099791_10438051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300009100|Ga0075418_10211905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2062 | Open in IMG/M |
| 3300009101|Ga0105247_10840488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300009148|Ga0105243_10117873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2233 | Open in IMG/M |
| 3300009148|Ga0105243_10394802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1283 | Open in IMG/M |
| 3300009148|Ga0105243_10493442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300009148|Ga0105243_11068840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300009148|Ga0105243_11515463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300009148|Ga0105243_12938229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300009162|Ga0075423_12972619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300009174|Ga0105241_10404365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300009174|Ga0105241_11027166 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300009174|Ga0105241_12104555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300009176|Ga0105242_12181882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300009545|Ga0105237_10454020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
| 3300009553|Ga0105249_12678843 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010042|Ga0126314_10307217 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300010042|Ga0126314_11309156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300010371|Ga0134125_13139843 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010397|Ga0134124_12856795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300010400|Ga0134122_10389572 | Not Available | 1227 | Open in IMG/M |
| 3300010400|Ga0134122_12572808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300010401|Ga0134121_12975267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012015|Ga0120187_1012353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300012285|Ga0137370_10646223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012582|Ga0137358_11004468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300012927|Ga0137416_10236514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1485 | Open in IMG/M |
| 3300012989|Ga0164305_12154322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300013296|Ga0157374_10370329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1426 | Open in IMG/M |
| 3300013306|Ga0163162_10889967 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300014745|Ga0157377_10212404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300014968|Ga0157379_11599754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300015371|Ga0132258_11174952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1940 | Open in IMG/M |
| 3300015372|Ga0132256_102978475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300015374|Ga0132255_100747921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300018422|Ga0190265_12472607 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300018432|Ga0190275_13344002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300018466|Ga0190268_11186441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300018476|Ga0190274_12846035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300021445|Ga0182009_10460202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300024290|Ga0247667_1018992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300025904|Ga0207647_10800289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300025908|Ga0207643_10718699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300025910|Ga0207684_10163984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
| 3300025911|Ga0207654_10697387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300025917|Ga0207660_10239685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1428 | Open in IMG/M |
| 3300025926|Ga0207659_11231443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300025930|Ga0207701_10849509 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025933|Ga0207706_10552564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300025933|Ga0207706_11471705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300025934|Ga0207686_11379207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300025935|Ga0207709_10308866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300025939|Ga0207665_11573136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300025960|Ga0207651_11087807 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025960|Ga0207651_12001664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300025972|Ga0207668_11188361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300025981|Ga0207640_11023702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300026035|Ga0207703_10138653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
| 3300026078|Ga0207702_10085466 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300026089|Ga0207648_10083178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2792 | Open in IMG/M |
| 3300026095|Ga0207676_10798491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300026095|Ga0207676_11368483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300026095|Ga0207676_12111915 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300026121|Ga0207683_11506923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300027424|Ga0209984_1070136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300027691|Ga0209485_1007185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2300 | Open in IMG/M |
| 3300028379|Ga0268266_11756341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300028380|Ga0268265_11219215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300028380|Ga0268265_11246825 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300028792|Ga0307504_10270956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1140092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300031731|Ga0307405_11676913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031852|Ga0307410_11152164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300031901|Ga0307406_10098238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
| 3300031911|Ga0307412_10264195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300031995|Ga0307409_102975226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300032002|Ga0307416_100454896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
| 3300032005|Ga0307411_11412648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.77% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.01% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.26% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J11755_116480261 | 3300000787 | Soil | VELRRKHAKDLHRFAILVGEGRISAXMQXRVREMXQTFLEXARVKLEGEXPLEPEGMLDQPA* |
| JGI1027J12803_1078356811 | 3300000955 | Soil | AILVGESAISAEMQKRVREMIKTFLERARVKLEGEAPIEQEPVLDSAV* |
| C687J26616_101023232 | 3300002120 | Soil | ALVGETAISTEMQKRVRTMIKVFLERARVKLEGESGEPEGSLQTVP* |
| soilL1_100225033 | 3300003267 | Sugarcane Root And Bulk Soil | RISAEMQKRVREMIKTFLERARVKLEAEESLDAEGMLDSPA* |
| soilL2_100033204 | 3300003319 | Sugarcane Root And Bulk Soil | EMQKRVREMIVTFLERARVKLEGEDGGNLEQDAMLDQPA* |
| Ga0062590_1023556041 | 3300004157 | Soil | ESAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEAMADSPA* |
| Ga0062594_1006499552 | 3300005093 | Soil | GRISAEMQKRVREMIVTFLERARVKLETEEPLEQEGLLDSPA* |
| Ga0065705_102444691 | 3300005294 | Switchgrass Rhizosphere | HARELHRLAALVGEGAISSEMQKRVAEMIKTFLERAQAKLEGESALEQEATS* |
| Ga0065707_101598112 | 3300005295 | Switchgrass Rhizosphere | ARELHRLAALVGEGAISSEMQKRVAEMIKTFLERAQAKLEGESALEQEATS* |
| Ga0070676_102235891 | 3300005328 | Miscanthus Rhizosphere | VGEGRINAEMQKRVREMIVTFLERARVQLEGEEGGNLEQDAMLDQPA* |
| Ga0070670_1014258611 | 3300005331 | Switchgrass Rhizosphere | KHAKELHRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA* |
| Ga0066388_1057199282 | 3300005332 | Tropical Forest Soil | RRKHAKDLHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEPVMLDSPA |
| Ga0070680_1001445392 | 3300005336 | Corn Rhizosphere | EGRINAEMQKRVREMIVTFLERARVQLEGEEGGNLEQDAMLDQPA* |
| Ga0068868_1022838332 | 3300005338 | Miscanthus Rhizosphere | ISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA* |
| Ga0070673_1014030661 | 3300005364 | Switchgrass Rhizosphere | RKHAKDLHRFAVLVGEGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA* |
| Ga0070667_1012034381 | 3300005367 | Switchgrass Rhizosphere | VGEGRISAEMQDRVREMIKTFLERARVKLEGETSVDPEPILDTPA* |
| Ga0070709_104644351 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA* |
| Ga0070701_101464971 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | QHAKDLHRFAILVGESAISSEMQKRVREMIKTFLERARVKLEAETGDQEPILDTPA* |
| Ga0070701_106474341 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA* |
| Ga0070705_1010736951 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SAEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA* |
| Ga0070694_1007508801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPHARDLHRFAALVGESAISSEMQKRVSEMIKTFLERARVKLEGESSLEQEA* |
| Ga0070694_1016416801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA* |
| Ga0070678_1004286201 | 3300005456 | Miscanthus Rhizosphere | ILVGESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA* |
| Ga0070685_108466732 | 3300005466 | Switchgrass Rhizosphere | LVGEGRISAEMQKRVREMIVTFLERARVKLETEEPLEQEGLLDSPA* |
| Ga0070685_112187492 | 3300005466 | Switchgrass Rhizosphere | ELRRKHAKDLHRFAVLVGEGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA* |
| Ga0070707_1020686072 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SAEMQKRVREMIKTFLERARVKLEGEEPLDQEAMLDSPA* |
| Ga0070672_1014327562 | 3300005543 | Miscanthus Rhizosphere | DLHRFAMLLGESAISAEMQKRVREMIKTFLARAQERLESETLPEQEPALDTAS* |
| Ga0070695_1003800231 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA* |
| Ga0070695_1017459711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRKHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETDPSVDQEVLADSPA |
| Ga0070665_1000982411 | 3300005548 | Switchgrass Rhizosphere | SSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA* |
| Ga0070665_1014971341 | 3300005548 | Switchgrass Rhizosphere | FAVLVGEGRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA* |
| Ga0068855_1007451151 | 3300005563 | Corn Rhizosphere | HAKDLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLETEEPLEQEGLLDSPA* |
| Ga0068857_1001517442 | 3300005577 | Corn Rhizosphere | ISNEMQKRVREMIKTFLERARVKLEEEPEQDELLESPA* |
| Ga0068857_1019974521 | 3300005577 | Corn Rhizosphere | VELRRAHARELHRLAALVGEGAISSEMQKRVAEMIKTFLERAQAKLEGESTLEQEATS* |
| Ga0068854_1001830522 | 3300005578 | Corn Rhizosphere | FAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS* |
| Ga0066706_106466403 | 3300005598 | Soil | DLHRLAALVGEGAISAEMQKRVREMIKIFLERAQAKLEGETGCEQEAV* |
| Ga0068859_1005248922 | 3300005617 | Switchgrass Rhizosphere | SHARDLHRFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGESNLEQEA* |
| Ga0068859_1015579751 | 3300005617 | Switchgrass Rhizosphere | FAILVGESAISAEMQKRVREMIKTFLERARVKLEELEGEEPMEQGEMLDSPA* |
| Ga0068864_1008158262 | 3300005618 | Switchgrass Rhizosphere | GESAISSEMQKRVREMIKTFLERARVKLESEPVIEQEPILDSPA* |
| Ga0068870_108342682 | 3300005840 | Miscanthus Rhizosphere | ESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA* |
| Ga0068863_1019993161 | 3300005841 | Switchgrass Rhizosphere | RISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA* |
| Ga0068858_1001348911 | 3300005842 | Switchgrass Rhizosphere | QKRVREMIVTFLERARVKLEAEEPLEQEGLLDSPA* |
| Ga0068860_1001678701 | 3300005843 | Switchgrass Rhizosphere | KRVKEMIKTFLERARVKLETEPVIEQEPILDSPA* |
| Ga0070716_1015690121 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LHRLAILVGEGRISIEMQKRVREMIKTFLERARVKLEGEELDQEPLLDSPA* |
| Ga0079220_119787902 | 3300006806 | Agricultural Soil | EMQKRVREMIKTFLERARVKLETEEPLDSEGMLDSPA* |
| Ga0075428_1012519131 | 3300006844 | Populus Rhizosphere | KRVREMIKTFLERARVKLEEEGGNLDQEAMLDQPA* |
| Ga0075428_1026037461 | 3300006844 | Populus Rhizosphere | SAEMQKRVREMIKTFLERARVKLEGEESLEQEAMLDSPA* |
| Ga0075421_1026791951 | 3300006845 | Populus Rhizosphere | KDLHRFAILVGEGRISAEMQKRVREMIQTFLERARVKLEGEQPLEPEGMLDQPA* |
| Ga0075430_1006172731 | 3300006846 | Populus Rhizosphere | SAEMQKRVREMIKTFLERARVKLEGEETLDQEAMLDSPA* |
| Ga0075433_100397961 | 3300006852 | Populus Rhizosphere | HRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEEPLDLEPIEQEA* |
| Ga0075434_1008292402 | 3300006871 | Populus Rhizosphere | RRKHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA* |
| Ga0075434_1022734981 | 3300006871 | Populus Rhizosphere | VGESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA* |
| Ga0079217_108782412 | 3300006876 | Agricultural Soil | AKELHRFAVLVGEGRINAEMQKRVREMIVTFLERARVKLEGEEPLEQEAMLDQPA* |
| Ga0079215_105686592 | 3300006894 | Agricultural Soil | EMQKRVREMIKTFLERARVKLEGEEPLEQEAMADSPA* |
| Ga0079216_100339151 | 3300006918 | Agricultural Soil | SAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEAMADSPA* |
| Ga0099791_104380512 | 3300007255 | Vadose Zone Soil | DLHRLAILLGEGAISAEMQKRVREMIKTFLERARVKLEGESVDPEAVLDSAV* |
| Ga0075418_102119052 | 3300009100 | Populus Rhizosphere | EMQKRVREMIKTFLERARVKLEGEESLEQEGMLDSPA* |
| Ga0105247_108404881 | 3300009101 | Switchgrass Rhizosphere | VGEGRISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA* |
| Ga0105243_101178732 | 3300009148 | Miscanthus Rhizosphere | ISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA* |
| Ga0105243_103948021 | 3300009148 | Miscanthus Rhizosphere | AHARELHRLAALVGEGAISSEMQKRAAEMIKTFLERAQAKLEGESALEQEATS* |
| Ga0105243_104934421 | 3300009148 | Miscanthus Rhizosphere | LHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETDPSVDQEVLADSPA* |
| Ga0105243_110688401 | 3300009148 | Miscanthus Rhizosphere | ILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA* |
| Ga0105243_115154631 | 3300009148 | Miscanthus Rhizosphere | ISAEMQKRVREMIVTFLERARVKLETEEPLEQEGLLDSPA* |
| Ga0105243_129382291 | 3300009148 | Miscanthus Rhizosphere | SAISAEMQKRVREMIKTFLERARVKLEELEGEEPMEQGDMLDSPA* |
| Ga0075423_129726192 | 3300009162 | Populus Rhizosphere | AISAEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA* |
| Ga0105241_104043652 | 3300009174 | Corn Rhizosphere | EGRISSEMQKRVREMIKTFLERAREKLETETSVDQEALADSPA* |
| Ga0105241_110271663 | 3300009174 | Corn Rhizosphere | KHAKELHRFAVLVGESAISAEMQKRVREMIKTFLERARVKLEGEELDQEPLLDSPA* |
| Ga0105241_121045552 | 3300009174 | Corn Rhizosphere | LVGEGRISNEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA* |
| Ga0105242_121818821 | 3300009176 | Miscanthus Rhizosphere | FAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGESNLEQEA* |
| Ga0105237_104540201 | 3300009545 | Corn Rhizosphere | DLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDPEVLADSPA* |
| Ga0105249_126788431 | 3300009553 | Switchgrass Rhizosphere | EMQKRVREMIQTFLERARVKLEGEQPMEPEGMLDQPA* |
| Ga0126314_103072172 | 3300010042 | Serpentine Soil | LHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLEGEEPLEQEAMLDSPA* |
| Ga0126314_113091561 | 3300010042 | Serpentine Soil | DLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLEGEESLEQEAMLDSPA* |
| Ga0134125_131398432 | 3300010371 | Terrestrial Soil | HARDLHRFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGESSVELEA* |
| Ga0134124_128567952 | 3300010397 | Terrestrial Soil | TISAEMQKRVREMIKTFLERARVKLEGEEQIDQTEMLDSPA* |
| Ga0134122_103895722 | 3300010400 | Terrestrial Soil | SAEMQKRVREMIKTFLARAQERLEDETLPEQEPALDTAS* |
| Ga0134122_125728081 | 3300010400 | Terrestrial Soil | AILVGEGRISNEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA* |
| Ga0134121_129752672 | 3300010401 | Terrestrial Soil | HARDLHRFAVLLGESAISAEMQKRVREMIKTFLARAQERLEDETLPEQEPALDTAS* |
| Ga0120187_10123531 | 3300012015 | Terrestrial | RLAVLLGESAISAEMQKRVSEMIKTFLERARVKLEGETLNEQEAEAV* |
| Ga0137370_106462231 | 3300012285 | Vadose Zone Soil | EGAISAEMQKRVGEMIRTFLERARVKLESLESDTVLDPEAEAI* |
| Ga0137358_110044682 | 3300012582 | Vadose Zone Soil | EMQKRVRDMIKTFLERARVKLEGENSCDPEAVLDSAV* |
| Ga0137416_102365141 | 3300012927 | Vadose Zone Soil | QHVELRRPHARDLHRFAALVGEGAISSEMQKRVSEMIKTFLERARVKLEGEASLEQEA* |
| Ga0164305_121543222 | 3300012989 | Soil | EMQKRVREMIKTFLERAREKLETETSVDQEALADSPA* |
| Ga0157374_103703292 | 3300013296 | Miscanthus Rhizosphere | VGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA* |
| Ga0163162_108899672 | 3300013306 | Switchgrass Rhizosphere | RRKHAKDLHRFAILVGESTISAEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA* |
| Ga0157377_102124042 | 3300014745 | Miscanthus Rhizosphere | AEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA* |
| Ga0157379_115997541 | 3300014968 | Switchgrass Rhizosphere | RLAILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDSEGMLDSPA* |
| Ga0132258_111749521 | 3300015371 | Arabidopsis Rhizosphere | GESAISSEMQKRVREMIKTFLERARVKLEAEPGDQEPILDTPA* |
| Ga0132256_1029784752 | 3300015372 | Arabidopsis Rhizosphere | HRFAVLVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEPLLDSPA* |
| Ga0132255_1007479212 | 3300015374 | Arabidopsis Rhizosphere | RKHAKDLHRFAILVGESAISSEMQKRVREMIKTFLERARVKLEAEPAIEQEPILDSPA* |
| Ga0190265_124726071 | 3300018422 | Soil | QHVELRRSHARDLHRLAALIGEGAISSEMQKRVSEMIKTFLERARVKLEGESLGEQEAEA |
| Ga0190275_133440021 | 3300018432 | Soil | KDLHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEAMLDSPA |
| Ga0190268_111864412 | 3300018466 | Soil | RFAILVGEGRISAEMQKRVREMIVTFLERARVKLEGEEPLEQDAMLDQPA |
| Ga0190274_128460351 | 3300018476 | Soil | EMQKRVREMIKTFLERARVKLEEESLEQEAMLDSPA |
| Ga0182009_104602021 | 3300021445 | Soil | AEMQKRVREMIKTFLERARVKLEGDEQIESEGMLDSPA |
| Ga0247667_10189921 | 3300024290 | Soil | EGRISNEMQKRVREMIKTFLERARVKLETEEPIEPDGLLDSPA |
| Ga0207647_108002892 | 3300025904 | Corn Rhizosphere | GRISSEMQKRVREMIKTFLERAREKLETEPGLEQEPILDTPA |
| Ga0207643_107186991 | 3300025908 | Miscanthus Rhizosphere | ESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA |
| Ga0207684_101639841 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AILVGESAISGEMQKRVREMIKTFLERARVKLEGEESLEQEAMADSPA |
| Ga0207654_106973871 | 3300025911 | Corn Rhizosphere | LAILVGEGRISAEMQKRVREMIKTFLERARVKLEEEPEQEEMLESPA |
| Ga0207660_102396852 | 3300025917 | Corn Rhizosphere | RFAMLLGESAISAEMQKRVREMIKTFLARAQERLESDTLPEQEPALDPAS |
| Ga0207659_112314431 | 3300025926 | Miscanthus Rhizosphere | LHRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA |
| Ga0207701_108495091 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AILVGEGRINAEMQKRVREMIVTFLERARVQLEGEEGGNLEQDAMLDQPA |
| Ga0207706_105525641 | 3300025933 | Corn Rhizosphere | LVGEGRISAEMQDRVREMIKTFLERARVKLESETSVDPEPILDTPA |
| Ga0207706_114717052 | 3300025933 | Corn Rhizosphere | ELHRFATLVGEGRISAEMQKRVREMIITFLERARVKLEGEEGGNLEQDAMIDQPA |
| Ga0207686_113792071 | 3300025934 | Miscanthus Rhizosphere | RKHARDLHRFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS |
| Ga0207709_103088662 | 3300025935 | Miscanthus Rhizosphere | SAEMQKRVREMIKTFLERARVKLEGEETLDQEAMLDSPA |
| Ga0207665_115731362 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LVGESAISAEMQKRVREMIKTFLERARVKLEGEELDQEPLLDSPA |
| Ga0207651_110878071 | 3300025960 | Switchgrass Rhizosphere | QKRVREMIKTFLVRAQERLENETLPEQEPALDTAS |
| Ga0207651_120016642 | 3300025960 | Switchgrass Rhizosphere | GESAISAEMQKRVREMIKTFLERARVKLEELEGEEPIDQAEMLDSPA |
| Ga0207668_111883612 | 3300025972 | Switchgrass Rhizosphere | GEGRISAEMQDRVREMIKTFLERARVKLEGETSVDPEPILDTPA |
| Ga0207640_110237022 | 3300025981 | Corn Rhizosphere | DLHRFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS |
| Ga0207703_101386532 | 3300026035 | Switchgrass Rhizosphere | LHRLAILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA |
| Ga0207702_100854662 | 3300026078 | Corn Rhizosphere | KHAKDLHRFAILVGEGRISSEMQKRVREMIKTFLERAREKLETETSVDPEVLADSPA |
| Ga0207648_100831782 | 3300026089 | Miscanthus Rhizosphere | ARDLHRFAVLLGESAISAEMQKRVREMIKTFLVRAQERLENETLPEQEPALDTAS |
| Ga0207676_107984911 | 3300026095 | Switchgrass Rhizosphere | GETAISAEMQKRVREMIKTFLERARVKLEALEGEESLEQEPLLDSPA |
| Ga0207676_113684832 | 3300026095 | Switchgrass Rhizosphere | MEPHRLAILVGEGRISNEMQKRVREMIKTFLERARVKLEEEPEQEELLESPA |
| Ga0207676_121119151 | 3300026095 | Switchgrass Rhizosphere | ELRRKHAKDLHRFAVLVGEGRINAEMQKRVREMIKTFLERARVKLEGEEGDLDQEGMLDQPA |
| Ga0207683_115069231 | 3300026121 | Miscanthus Rhizosphere | ILVGESAISSEMQKRVKEMIKTFLERARVKLETEPVIEQEPILDSPA |
| Ga0209984_10701361 | 3300027424 | Arabidopsis Thaliana Rhizosphere | ISAEMQKRVREMIKTFLARAQERLESDTLPEQEPALDTAS |
| Ga0209485_10071852 | 3300027691 | Agricultural Soil | QKRVHEMIKTFLERARVKLEGEEPLEQEAMADSPA |
| Ga0268266_117563411 | 3300028379 | Switchgrass Rhizosphere | VGEGRISAEMQDRVREMIKTFLERARVKLEGETSVDPEPILDTPA |
| Ga0268265_112192152 | 3300028380 | Switchgrass Rhizosphere | HRLAILVGEGRISAEMQKRVREMIKTFLERARVKLEAEESLDLDSEGMLDSPA |
| Ga0268265_112468252 | 3300028380 | Switchgrass Rhizosphere | ISAEMQKRVREMIKTFLARAQERLESETLPEQEPALDTAS |
| Ga0307504_102709562 | 3300028792 | Soil | RPHARDLHRFAALVGEGAISSEMQKRVGEMIKTFLERARVKLEGESAVEQEAATFCRS |
| (restricted) Ga0255311_11400922 | 3300031150 | Sandy Soil | RKHAKDLHRFAILVGEGAISSEMQKRVREMIKTFLERARVKLEAESVIEQEPILDTPA |
| Ga0307405_116769131 | 3300031731 | Rhizosphere | LHRFAILVGESAISNEMQKRVREMIKTFLERARVKLEGEEPLEQEAMLDSPA |
| Ga0307410_111521642 | 3300031852 | Rhizosphere | ILVGESAISNEMQKRVREMIKTFLERARVKLEGEEPLEQEAMLDSPA |
| Ga0307406_100982382 | 3300031901 | Rhizosphere | KDLHRFAILVGESAISAEMQKRVREMIKTFLERARVKLEGEETIEQEAMADSPA |
| Ga0307412_102641951 | 3300031911 | Rhizosphere | MQKRVREMIKTFLERARVKLEGEETIEQEAMADSPA |
| Ga0307409_1029752261 | 3300031995 | Rhizosphere | AISNEMQKRVREMIKTFLERARVKLEGEETIEQEAMADSPA |
| Ga0307416_1004548961 | 3300032002 | Rhizosphere | DLHRFAILVGEGAISAEMQKRVREMIKTFLERARVKLETEEPLDQEAILDSPA |
| Ga0307411_114126482 | 3300032005 | Rhizosphere | ILVGESAISAEMQKRVREMIKTFLERARVKLEGEESLEQEGMLDSPA |
| ⦗Top⦘ |