| Basic Information | |
|---|---|
| Family ID | F060235 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LPEKKVRFDDFELDYGRFQLCRRGSPVRLEGLPLQLLMF |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.98 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 90.98 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.977 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.526 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.805 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.120 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 20.90% Coil/Unstructured: 68.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13180 | PDZ_2 | 12.03 |
| PF01464 | SLT | 3.01 |
| PF00589 | Phage_integrase | 2.26 |
| PF04613 | LpxD | 2.26 |
| PF00072 | Response_reg | 1.50 |
| PF00132 | Hexapep | 1.50 |
| PF01259 | SAICAR_synt | 0.75 |
| PF00486 | Trans_reg_C | 0.75 |
| PF02627 | CMD | 0.75 |
| PF01174 | SNO | 0.75 |
| PF04773 | FecR | 0.75 |
| PF06764 | DUF1223 | 0.75 |
| PF14534 | DUF4440 | 0.75 |
| PF07228 | SpoIIE | 0.75 |
| PF00480 | ROK | 0.75 |
| PF16927 | HisKA_7TM | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.26 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.50 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.75 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.75 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.75 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.75 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.75 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.98 % |
| Unclassified | root | N/A | 9.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10164520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
| 3300001867|JGI12627J18819_10014510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3153 | Open in IMG/M |
| 3300001867|JGI12627J18819_10224009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 758 | Open in IMG/M |
| 3300001867|JGI12627J18819_10480633 | Not Available | 510 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10435962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 531 | Open in IMG/M |
| 3300004091|Ga0062387_101452000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300004092|Ga0062389_100310244 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300005177|Ga0066690_10266902 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005332|Ga0066388_101796639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1090 | Open in IMG/M |
| 3300005332|Ga0066388_107471618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300005518|Ga0070699_102180143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 506 | Open in IMG/M |
| 3300005526|Ga0073909_10232549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 812 | Open in IMG/M |
| 3300005536|Ga0070697_101178831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300005542|Ga0070732_10176439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1275 | Open in IMG/M |
| 3300005610|Ga0070763_10026971 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300005610|Ga0070763_10128267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1306 | Open in IMG/M |
| 3300006052|Ga0075029_100548673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300006052|Ga0075029_100648488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 709 | Open in IMG/M |
| 3300006052|Ga0075029_101182253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 533 | Open in IMG/M |
| 3300006059|Ga0075017_100609068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 835 | Open in IMG/M |
| 3300006162|Ga0075030_101389075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300006174|Ga0075014_100665784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300006174|Ga0075014_100837503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300006176|Ga0070765_100264192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1582 | Open in IMG/M |
| 3300006642|Ga0075521_10059768 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300006864|Ga0066797_1106162 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300009029|Ga0066793_10069820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2009 | Open in IMG/M |
| 3300009038|Ga0099829_10638364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300009519|Ga0116108_1194387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300009520|Ga0116214_1100277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1065 | Open in IMG/M |
| 3300009839|Ga0116223_10404453 | Not Available | 803 | Open in IMG/M |
| 3300010048|Ga0126373_11117709 | Not Available | 854 | Open in IMG/M |
| 3300010048|Ga0126373_12839627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300010358|Ga0126370_11121844 | Not Available | 726 | Open in IMG/M |
| 3300010358|Ga0126370_11346229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010379|Ga0136449_100520905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2056 | Open in IMG/M |
| 3300010396|Ga0134126_11053214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300011120|Ga0150983_12534657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300012206|Ga0137380_11739660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300012207|Ga0137381_10287344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1431 | Open in IMG/M |
| 3300012359|Ga0137385_10636856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300012927|Ga0137416_11061733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300013297|Ga0157378_12011689 | Not Available | 628 | Open in IMG/M |
| 3300014200|Ga0181526_10025409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3860 | Open in IMG/M |
| 3300014654|Ga0181525_10550232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300017928|Ga0187806_1279902 | Not Available | 583 | Open in IMG/M |
| 3300017937|Ga0187809_10311212 | Not Available | 583 | Open in IMG/M |
| 3300017942|Ga0187808_10561242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300017943|Ga0187819_10244830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300017948|Ga0187847_10855428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300017955|Ga0187817_10535834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300017966|Ga0187776_10077616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1938 | Open in IMG/M |
| 3300017970|Ga0187783_10511834 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300017995|Ga0187816_10140504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300018007|Ga0187805_10073356 | Not Available | 1541 | Open in IMG/M |
| 3300018009|Ga0187884_10059772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300018024|Ga0187881_10068942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
| 3300018042|Ga0187871_10154831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300018042|Ga0187871_10373992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300018042|Ga0187871_10384285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300018042|Ga0187871_10736411 | Not Available | 549 | Open in IMG/M |
| 3300018043|Ga0187887_10885970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300018044|Ga0187890_10596672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300018047|Ga0187859_10712345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300018090|Ga0187770_10162511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1707 | Open in IMG/M |
| 3300018090|Ga0187770_10611007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300018482|Ga0066669_10705463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300020579|Ga0210407_10532854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300020583|Ga0210401_10273529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1549 | Open in IMG/M |
| 3300021171|Ga0210405_10914329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021171|Ga0210405_10918526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300021181|Ga0210388_10203094 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300021402|Ga0210385_10284572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300021402|Ga0210385_10689086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300021420|Ga0210394_10290899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300021432|Ga0210384_11409107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300021475|Ga0210392_10865239 | Not Available | 676 | Open in IMG/M |
| 3300021559|Ga0210409_10084854 | All Organisms → cellular organisms → Bacteria | 2929 | Open in IMG/M |
| 3300025507|Ga0208188_1109322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300025507|Ga0208188_1111523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300025898|Ga0207692_10281271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1007 | Open in IMG/M |
| 3300025915|Ga0207693_11326538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300026309|Ga0209055_1176909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300026469|Ga0257169_1058301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300026508|Ga0257161_1078859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300026547|Ga0209156_10356190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027559|Ga0209222_1023472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300027567|Ga0209115_1007989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2210 | Open in IMG/M |
| 3300027625|Ga0208044_1138237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027678|Ga0209011_1009566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3261 | Open in IMG/M |
| 3300027698|Ga0209446_1057317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300027737|Ga0209038_10109614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300027824|Ga0209040_10129077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1391 | Open in IMG/M |
| 3300027842|Ga0209580_10161029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
| 3300027842|Ga0209580_10228893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300027867|Ga0209167_10148338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300027869|Ga0209579_10322708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300027894|Ga0209068_10933261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300027911|Ga0209698_10267554 | Not Available | 1361 | Open in IMG/M |
| 3300028859|Ga0302265_1181784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300029914|Ga0311359_10233625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1580 | Open in IMG/M |
| 3300029952|Ga0311346_10285251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
| 3300029995|Ga0302210_10224780 | Not Available | 528 | Open in IMG/M |
| 3300030041|Ga0302274_10133619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300030659|Ga0316363_10149145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300030991|Ga0073994_12073463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300031028|Ga0302180_10270519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300031128|Ga0170823_11881917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300031249|Ga0265339_10323119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300031344|Ga0265316_10525743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| 3300031446|Ga0170820_10178916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031474|Ga0170818_100771990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300031616|Ga0307508_10916367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300031715|Ga0307476_10051614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2804 | Open in IMG/M |
| 3300031715|Ga0307476_11162529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031720|Ga0307469_10538868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300031740|Ga0307468_101840017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300031753|Ga0307477_10335092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1042 | Open in IMG/M |
| 3300031753|Ga0307477_10662771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300031754|Ga0307475_10094397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2325 | Open in IMG/M |
| 3300031823|Ga0307478_11028094 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300032174|Ga0307470_11706570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300032261|Ga0306920_104282279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300032261|Ga0306920_104412224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300032770|Ga0335085_10348310 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300032783|Ga0335079_12229258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300032954|Ga0335083_11017448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300032955|Ga0335076_11723827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300033004|Ga0335084_10095516 | All Organisms → cellular organisms → Bacteria | 3087 | Open in IMG/M |
| 3300033412|Ga0310810_10460241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
| 3300033433|Ga0326726_10138114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2213 | Open in IMG/M |
| 3300033888|Ga0334792_144172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300033983|Ga0371488_0092655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.53% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.01% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.26% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029995 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101645202 | 3300001593 | Forest Soil | VRFDDFELDYARFQLYRASKPVRLEGLPLQLLMFLVDKRG |
| JGI12627J18819_100145101 | 3300001867 | Forest Soil | MAEKKVRFGEFELDFGQFQLSRAGGQVRLEGLPLQLLMYLVDHQRQLVT |
| JGI12627J18819_102240091 | 3300001867 | Forest Soil | MAEKKVRFGEFELDFGRFQLFRSGQPVRLEGLPLQLLMFL |
| JGI12627J18819_104806331 | 3300001867 | Forest Soil | LAMSAKRVRFDEYELDFGRFQLLRHGEPVRLEGLPLQLLMFL |
| JGIcombinedJ51221_104359621 | 3300003505 | Forest Soil | LVSVPEKRVRFADFELDFGRFQLLRSGRPLRVEGLPLQLLMFMIENPQ |
| Ga0062387_1014520002 | 3300004091 | Bog Forest Soil | LPDKKIRFDDFELDYGRFQLTRCGRLVKLEGLPLQLLMFV |
| Ga0062389_1003102442 | 3300004092 | Bog Forest Soil | MMSDKNGNAGKTIRFDDFQLDFARFQLCHRGKPVRLEGLPLQLLMFMVENR |
| Ga0066690_102669021 | 3300005177 | Soil | LPDKKVRFDDFELDYGRFQLCRGGCPVRLEGLPLQLLMFMVEKRGQLVT |
| Ga0066388_1017966393 | 3300005332 | Tropical Forest Soil | MPAKKVQFDEFELDFGRFQLFHKGEPVRLEGLPLQLLMFLIEN |
| Ga0066388_1074716181 | 3300005332 | Tropical Forest Soil | MTGKKARFGQFEVDFGRFQLFRAGEPVRLEGLPLRLLMYLIDHHGELV |
| Ga0070699_1021801431 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VPEKKVRFDDFELDFGRFQLSKSGCSLKLEGLPLQLLMFLVEQ |
| Ga0073909_102325491 | 3300005526 | Surface Soil | MPEKKVRFAEFELDFGRFQLYRNGQPVRLEGLPLQLLMFLID |
| Ga0070697_1011788311 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VPEKKVRFDDFVVDFGRFQLSRSGCPLKLEGLPLQLLMLLVEQQGQL |
| Ga0070732_101764393 | 3300005542 | Surface Soil | MPEKRVRFGDFDLDFGRFQLLRTGAPVRLEGLPLQLLMFLIDNHRKLVT |
| Ga0070763_100269715 | 3300005610 | Soil | MAEKRVCFGEFELDFGHFLLYRQGQPVRLEGLPLQLL |
| Ga0070763_101282673 | 3300005610 | Soil | MPEKKVCFADFELDFGRFQLYRAGRPVRLEGLPLQLLMF |
| Ga0075029_1005486731 | 3300006052 | Watersheds | MADRRIRFAEFELDFAHFQLYRGGDPVRLEGLPLQLLMYLVEHHK |
| Ga0075029_1006484881 | 3300006052 | Watersheds | MHEKRVLFGKFTLDFGRYQLCRCGHPVRLECLPLQLLMLLIENQSQLVTRER |
| Ga0075029_1011822531 | 3300006052 | Watersheds | LPEKKIRFDDFELDYGRFLLCRRSSPVRLEGLPLQLLMF |
| Ga0075017_1006090681 | 3300006059 | Watersheds | LPEKKIRFDDFELDYSRFQLIRDGRPIRLESLPLQLLMFLVE |
| Ga0075030_1013890751 | 3300006162 | Watersheds | MPEKRVLFGKFTLDFGRYQLYRCGRPVRLEGLPLQLLMFLIENQSQLV |
| Ga0075014_1006657842 | 3300006174 | Watersheds | MPEKKVRFDDFVLDFGRFQLSRGGQPVRLEGLPLQLLMFLI |
| Ga0075014_1008375033 | 3300006174 | Watersheds | VPEKKVRFDDFVLDFGRFQLTRGGQLVRLEGLPLQLLMFL |
| Ga0070765_1002641921 | 3300006176 | Soil | LPDKKVRFDDFELDYGRFQLCRCGRPVRLEGLPLQLLM |
| Ga0075521_100597682 | 3300006642 | Arctic Peat Soil | LPDKKIRFDDFELDYGRFLLCRGSSLIRLEGLPLQLLMFLVEK |
| Ga0066797_11061622 | 3300006864 | Soil | VPEKKVRFDDFQLDYGRFQLCRRGIPVRLEGLPLQLLMFLVEKRGQLVT |
| Ga0066793_100698201 | 3300009029 | Prmafrost Soil | VPEKKVRFDDFQLDYGRFQLCRRGIPVRLEGLPLQLLMFL |
| Ga0099829_106383642 | 3300009038 | Vadose Zone Soil | LPDKKVRFDDFELDYSRFQLCRCGRPVRLESLPLQLLMFMVE |
| Ga0116108_11943872 | 3300009519 | Peatland | VPEKKVRFDDFQLDYGRFQLYRQGIPVRLEGLPLQLLMFLV |
| Ga0116214_11002771 | 3300009520 | Peatlands Soil | LPEKKVRFDDFQLDYGRFQLCRRGIPVRLEGLPLQLLMF |
| Ga0116223_104044531 | 3300009839 | Peatlands Soil | MAEKKVRFAQFELDYARFELCRNGNRLRLESLPLQLLMF |
| Ga0126373_111177091 | 3300010048 | Tropical Forest Soil | MPNTKIARFLDFELDFGLFQLRWKGEDVKIERLPLQLLMLLVENQGQVVT |
| Ga0126373_128396271 | 3300010048 | Tropical Forest Soil | VAEKKVRFAEFELDFGRFELYRAGQPVRLEGLPLQLLM |
| Ga0126370_111218442 | 3300010358 | Tropical Forest Soil | MPVKIVRFAEFELDFGRFQLFRAGDLVRLEGLPLQILMLL |
| Ga0126370_113462291 | 3300010358 | Tropical Forest Soil | MPGKKLRFDGFELDFSRFQLFRDGEPVRLEGLPLQLLMF |
| Ga0136449_1005209052 | 3300010379 | Peatlands Soil | VLEKKIRFADFELDYGRFQLCRLGRPVRLEGLPLQLLLFL |
| Ga0134126_110532141 | 3300010396 | Terrestrial Soil | MQGLRLRFAEFELDCERYQLCRNGQPLRLEGIPLQLLIF |
| Ga0150983_125346572 | 3300011120 | Forest Soil | VPEKKVRFDDFQLDYGRFQLCRRGIPIRLEGLPLQLLMFLVEKR |
| Ga0137380_117396602 | 3300012206 | Vadose Zone Soil | MPEKKVRFAEFELDFGRFQLYRSGLPVRLEGLPLQLLMFLIENS |
| Ga0137381_102873443 | 3300012207 | Vadose Zone Soil | MPEKKVRFAEFELDFGRFQLYRSGQPVRLEGLPLQLLMFLI |
| Ga0137385_106368561 | 3300012359 | Vadose Zone Soil | MRVVSVPEKKVRFDDFVLDFGRFQLIRKGCPLKLEGLP |
| Ga0137416_110617331 | 3300012927 | Vadose Zone Soil | LPDKKIRFDDFELDYGRFQLYCCGSPVRLEGLPLQLLMFMVEK |
| Ga0157378_120116891 | 3300013297 | Miscanthus Rhizosphere | MPEKKVRFAEFELDFGRFQLYRNGQAVRLEGLPLQL |
| Ga0181526_100254096 | 3300014200 | Bog | VPQKKVRFDDFQLDYGRFQLYRHGIPVRLEGLPLQLLMFL |
| Ga0181525_105502321 | 3300014654 | Bog | MAEKRVCFGEFELDFGYFLLYRKGQPVRLEGLPLQLLMHLVEHQRQLVTREQIAE |
| Ga0187806_12799021 | 3300017928 | Freshwater Sediment | MADKRVCFSEFELDFGQFQLYRNGERVGLEGLPLQLLMCLVENQKQLVTREQIADA |
| Ga0187809_103112122 | 3300017937 | Freshwater Sediment | MPEKKVRFADFELDFGCFQLRRSGEPVHLEGLPLQLLMLLVE |
| Ga0187808_105612421 | 3300017942 | Freshwater Sediment | MPEKKISFGEFVLDFARFQLYRCGHPIRLESLPLQ |
| Ga0187819_102448301 | 3300017943 | Freshwater Sediment | VPENAKKLQFDDFQLGFGRFQLCRHGKPVRLEGLPLQLLMFLVENQG |
| Ga0187847_108554282 | 3300017948 | Peatland | VPEKKISFDDFQLDYARFQLCRQGIPVRLEGLPLQLLMFLVEHR |
| Ga0187817_105358341 | 3300017955 | Freshwater Sediment | VPEKKVRFDDFQLDYDRFQLCRCGTPVRLEGLPLQLLMF |
| Ga0187776_100776163 | 3300017966 | Tropical Peatland | MRDDSVPDRRVRFDDYLLDFTRFQLSRNGLPLKLEGLPLQLLMFLV |
| Ga0187783_105118342 | 3300017970 | Tropical Peatland | MAEKKARFGQFELDFGRFQLLRAGEPVRLEGLPLRLLMYLIDHHGQLV |
| Ga0187816_101405042 | 3300017995 | Freshwater Sediment | VPEKKVRFDDFHLDYGRFQLCRRGIPVRLEGLALQ |
| Ga0187805_100733561 | 3300018007 | Freshwater Sediment | MPDKEKKVRFDEFELDFGHFQLYRSGRPVRLEGLPLQLLMYLVDNQRQLVTREQIADA |
| Ga0187884_100597722 | 3300018009 | Peatland | LPEKKVRFDDFELDYGRFQLCRRGSPVRLEGLPLQLLMF |
| Ga0187881_100689422 | 3300018024 | Peatland | LPEKKIRFDDFELDYGRFQLSRRGRPVRLEGLPLQLLMFLVE |
| Ga0187871_101548311 | 3300018042 | Peatland | LPDKKVRFDEFELDYARFQLCRNGIPIRLEGLPLQLLMF |
| Ga0187871_103739921 | 3300018042 | Peatland | VPDKKVRFDDFELDYGRFTLSRNGRSVKLEGLPLQLHMFVV |
| Ga0187871_103842851 | 3300018042 | Peatland | LPDKKIRFDEFELDYARFQLHRAGNTVRLEGLPLQLLMFLVEKRGQL |
| Ga0187871_107364112 | 3300018042 | Peatland | LPEKRIRFGDFQVDYGSYQLCRRGIPVRLEGLPLQLLMFLVDNRGQLV |
| Ga0187887_108859701 | 3300018043 | Peatland | LPDKKVRFDDFEIDYGRFQLARCGKTVRLEGLPLQLLMFLV |
| Ga0187890_105966721 | 3300018044 | Peatland | LALPDKKIRFDEFELDYSRFQLCGAGKPIRLEGLPLQ |
| Ga0187859_107123451 | 3300018047 | Peatland | LPDKKIRFDEFELDYSRFQLCGAGKPIRLEGLPLQLLMFLVDKRGQLV |
| Ga0187770_101625112 | 3300018090 | Tropical Peatland | VPEKKIIFDDFELDFGRFQLRRRGKPIPLEGLPLQ |
| Ga0187770_106110072 | 3300018090 | Tropical Peatland | MAEKGKKVRFCEFELDFGHFQLYRKGEPVPLEGLPLQLLMFLVEHPRQLVTRQ |
| Ga0066669_107054633 | 3300018482 | Grasslands Soil | MPGLRLRFAEFELDCERYQLCRNGQPMRLEGIPLQLLIFLAEH |
| Ga0210407_105328542 | 3300020579 | Soil | LPDKKVRFDDFELDYGRFQLCRCGRPVRLEGLPLQLLMFMVEKRGQLVT |
| Ga0210401_102735291 | 3300020583 | Soil | MPEKKVLFGRFVLDFGRYQLYRSGRPVRLEGLPLQLLMLLIENRSQLVTRERIA |
| Ga0210405_109143292 | 3300021171 | Soil | VLEKKVRFDDFQLDYGRFQLCRRGTPVRLEGLPLQLLMFLVEKRGQLV |
| Ga0210405_109185262 | 3300021171 | Soil | LTEKKIRFDDFQLDYGRFQLCRRGIPVRLEGMPLQLLMFLVEKRGQLVT |
| Ga0210388_102030941 | 3300021181 | Soil | VPEKKIRFDDFQLDYARFQLCRRGLPVRLEGLPLQLLMFL |
| Ga0210385_102845721 | 3300021402 | Soil | VPEKKIRFDDFQLDYARFQLCRRGLPVRLEGLPLQLLMFLVDQRGQLV |
| Ga0210385_106890862 | 3300021402 | Soil | LTEKKIRFDDFQLDYGRFQLCRRGIPVRLEGMPLQLLMFLVEKRG |
| Ga0210394_102908993 | 3300021420 | Soil | VPEKTVRFDDFHLDYGRFQLCRRGTPIRLEGLPLQLLM |
| Ga0210384_114091071 | 3300021432 | Soil | LPEKIIRFDNFGLDYSRFQLSRNGCPVRLEGLPLQLLMFLVEKRGE |
| Ga0210392_108652391 | 3300021475 | Soil | LAGKRIRFDDFELDYTRFQLSRTGRAIRLEGLPLQL |
| Ga0210409_100848544 | 3300021559 | Soil | MPDKKVRFAEFELDFGRFQLYRGGQPVRLEGLPLQ |
| Ga0208188_11093221 | 3300025507 | Peatland | LPDKLEKKVRFDDFELDYARFQLYRAGSPVRLEGLPLQ |
| Ga0208188_11115231 | 3300025507 | Peatland | LPEKKVRFDDFQLDYGRFQFCRRGIPVRLEGLPLQLL |
| Ga0207692_102812711 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQKKVRFDQFELDYGRFQLFRKGAPVRLESLPMQLLMLLIDNQPN |
| Ga0207693_113265382 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEKKIRFGEFELDFGRFQLNRGGAPVRLEGLPLQL |
| Ga0209055_11769091 | 3300026309 | Soil | LPDKKVRFDDFELDYGRFQLYRSGSPVRLEGLPLQLLMF |
| Ga0257169_10583011 | 3300026469 | Soil | LPDKKVRFDDFELDYGRFQLCRCGRPVRLEGLPLQ |
| Ga0257161_10788591 | 3300026508 | Soil | LPDKKVRFDDFELDYGRFQLCRCGRPVRLEGLPLQLLMFMVEKRGQL |
| Ga0209156_103561902 | 3300026547 | Soil | MSQKKVRFDQFELDYARFQLFRKGAPVRLESLPMQLLMLLVDN |
| Ga0209222_10234722 | 3300027559 | Forest Soil | LPDKSDKKISFDDFALDYGRFQLYRNGNAVRLEGLPLQLLMFLVEKRGQ |
| Ga0209115_10079894 | 3300027567 | Forest Soil | MPEKKVRFSEFELDFARFQLSRGGQPVRLEGLPLQLLMFL |
| Ga0208044_11382371 | 3300027625 | Peatlands Soil | LPEKKVRFDDFQLDYGRFQLCRRGIPVRLEGLPLQLLMFLVEKRGQMVT |
| Ga0209011_10095661 | 3300027678 | Forest Soil | LPDKKVRFDDFELDYSRFQLCRGGSPVRLEGLPLQLLMFMVEKRGQLV |
| Ga0209446_10573171 | 3300027698 | Bog Forest Soil | LPDQPDKPDKKVRFDDFEVDYGHFQLCRCGSPIRLEGLPLQLLMFLVEKRGQLVT |
| Ga0209038_101096142 | 3300027737 | Bog Forest Soil | LPDKRVRFDDFELDYARFQLCRNGCPVRLEGLPLQLLMFMVE |
| Ga0209040_101290771 | 3300027824 | Bog Forest Soil | MAKKVQFGGFELDFGRFLLSREGKPVPLEGLPLQLLLFLVENPGQ |
| Ga0209580_101610293 | 3300027842 | Surface Soil | MPEKRVRFGDFDLDFGRFQLLRTGAPVRLEGLPLQLLMFLIDNHRKLVTREQIADAL |
| Ga0209580_102288931 | 3300027842 | Surface Soil | MAEKKVRFGEFELDFGRFQLFRSGQPVRLEGLPLQLLMFLIENQCQLVTREQ |
| Ga0209167_101483383 | 3300027867 | Surface Soil | LAEKKVRFDDFDLDYARFQLCRRGIPVRLEGLPLQLLMFLVEKKGQ |
| Ga0209579_103227082 | 3300027869 | Surface Soil | MPEKKVRFAEFELDFGRFQLYRNGQPVRLEGLPLQ |
| Ga0209068_109332611 | 3300027894 | Watersheds | LPDKKVRFDDFQLDYGRFQLCRKGSPVRLEGLPLQLLMFL |
| Ga0209698_102675543 | 3300027911 | Watersheds | MHEKRVLFGKFTLDFGRYQLCRCGHPVRLECLPLQLLMLLIENQSQLVT |
| Ga0302265_11817841 | 3300028859 | Bog | LPDKKVRFDDFEIDYGRFQLARCGKTVRLEGLPLQLLMFLVENRGQ |
| Ga0311359_102336252 | 3300029914 | Bog | LPDKKVRFDDFEIDYGRFQLARCGKTVRLEGLPLQLLMFLVEN |
| Ga0311346_102852511 | 3300029952 | Bog | LPDKKVRFDDFEIDYGRFQLARCGKTVRLEGLPLQLLMFLVENRGQL |
| Ga0302210_102247801 | 3300029995 | Fen | MVSRYVRFGEFELDFDAFQLRRQGSAVKMETLPLRLLMFLIE |
| Ga0302274_101336192 | 3300030041 | Bog | LPDKKVRFDDFEIDYGRFQLARCGKTVRLEGLPLQLLMFLVENRG |
| Ga0316363_101491451 | 3300030659 | Peatlands Soil | LPEKKVRFDDFQLDYGRFQLCRRGIPVRLEGLPLQLLMFLVEKRGQMV |
| Ga0073994_120734631 | 3300030991 | Soil | MRDVSVAEHKIRFDDFLLDFGRFQLSRGGRTLKLEDCPCNC |
| Ga0302180_102705191 | 3300031028 | Palsa | LPDKKIRFDEFEIDYARFQLYNAGKPVRLEGLPLQLLMFLVEKRGQL |
| Ga0170823_118819171 | 3300031128 | Forest Soil | LPDKKVRFDDFELDYARFQLYRCGRPVRLEGLPLQLLMF |
| Ga0265339_103231192 | 3300031249 | Rhizosphere | MSEKKVRFAEFELDFGRFQLSRGSSPVRLEGLPLQLLMYLVDHH |
| Ga0265316_105257431 | 3300031344 | Rhizosphere | MPENKVRFGEFELDFGRYQLFCKGQPVRLEGLPLQLLMYL |
| Ga0170820_101789161 | 3300031446 | Forest Soil | LPDKKVRFDDFELDYARFQLYRCGRPVRLEGLPLQLLMFMVEKR |
| Ga0170818_1007719901 | 3300031474 | Forest Soil | LPDKKVRFDDFELDYARFQLYRCGRPVRLEGLPLQLLMFMV |
| Ga0307508_109163671 | 3300031616 | Ectomycorrhiza | LPDKRVRFDDFELDYARFQLSRSGCPIRLEGLPLQLLMFLVE |
| Ga0307476_100516144 | 3300031715 | Hardwood Forest Soil | MPEKKVGFGEFELDFGRYQLCRRGQAVRLEGLPLQLLMFLIENQRK |
| Ga0307476_111625292 | 3300031715 | Hardwood Forest Soil | VPDKKVRFDDFQLDYGRFQLCRGGIPIRLEGLPLQ |
| Ga0307469_105388681 | 3300031720 | Hardwood Forest Soil | VPEKKVRFDDFVLDFGRFQLIRKGCPLKLEGLPLQLLMFLIEKQ |
| Ga0307468_1018400171 | 3300031740 | Hardwood Forest Soil | VPEKKVRFDDFVLDFGRFQLTRSGCPLKLEGLPLQLLMFLIEKQ |
| Ga0307477_103350921 | 3300031753 | Hardwood Forest Soil | VPEKKVRFEDFQLDYGRFQLSHRGVPVRLEGLPLQLLMLLVENRGRLV |
| Ga0307477_106627711 | 3300031753 | Hardwood Forest Soil | MAEKKVRFGEFELDFGRFQLFRSGQPVRLEGLPLQLLMFLIENQCQLVTR |
| Ga0307475_100943973 | 3300031754 | Hardwood Forest Soil | LPDKKICFDDFEVDYGRFQLYRSGRPIRLEGLPLQLL |
| Ga0307478_110280942 | 3300031823 | Hardwood Forest Soil | VPEKKVRFDDFQLDYSRFQLCRRGIPVRLEGLPLQLLMFLVEK |
| Ga0307470_117065701 | 3300032174 | Hardwood Forest Soil | LPDKKVRFEEFELDYGRFQLSRAGSPVRLEGLPLQLMMFLVD |
| Ga0306920_1042822791 | 3300032261 | Soil | VAEKKVRFAEFELDFGRFELYRAGQPVRLEGLPLQ |
| Ga0306920_1044122241 | 3300032261 | Soil | VPDKKVRFGEFELDFSRFQLCRQGAPVRLEGLPLQLLMFLIDNH |
| Ga0335085_103483103 | 3300032770 | Soil | MPAKKVRFSEFELDFGRFQLVRGGRPVRLEGLPLQLLMYLVEHHRQLVT |
| Ga0335079_122292582 | 3300032783 | Soil | MPDKKARFDDFELDFSRFQLYRNGQPVRLEGLPLQLLMFLIEHR |
| Ga0335083_110174481 | 3300032954 | Soil | MSAKKVRFDDYELDFGRFQLSRGGQPVRLEGLPLQLLMFLVENQR |
| Ga0335076_117238271 | 3300032955 | Soil | MPDKKARFDDFELDFSRFQLYRNGQPVRLEGLPLQLLMFLIEHRQQLV |
| Ga0335084_100955165 | 3300033004 | Soil | MAGKKVRFGEFELDFGHYQLYRSGRAVRLEGLPLQLLMYLVD |
| Ga0310810_104602414 | 3300033412 | Soil | MLEKKVRFSEFQLDFGRFQLCRDGQPVRLEGLPLQLLMFL |
| Ga0326726_101381141 | 3300033433 | Peat Soil | VSEKKIRFDDFLLDFGRFQLCRGGEPVRLEGLPLQALMFLIEQKG |
| Ga0334792_144172_492_611 | 3300033888 | Soil | MPEKKVCFDDFQLDYGRFQLCRRGIPVRLEGLPLQLLKFL |
| Ga0371488_0092655_2_115 | 3300033983 | Peat Soil | MTDKKVCFEDFELDFGRFQLCHRGKPVPLEGLPLQLLI |
| ⦗Top⦘ |