| Basic Information | |
|---|---|
| Family ID | F060191 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSVSDL |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.50 % |
| % of genes near scaffold ends (potentially truncated) | 96.99 % |
| % of genes from short scaffolds (< 2000 bps) | 93.23 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.729 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.804 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.820 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.113 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.94% β-sheet: 0.00% Coil/Unstructured: 76.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13434 | Lys_Orn_oxgnase | 17.29 |
| PF07992 | Pyr_redox_2 | 6.02 |
| PF01402 | RHH_1 | 4.51 |
| PF02657 | SufE | 1.50 |
| PF07969 | Amidohydro_3 | 1.50 |
| PF00398 | RrnaAD | 0.75 |
| PF08240 | ADH_N | 0.75 |
| PF02635 | DrsE | 0.75 |
| PF02913 | FAD-oxidase_C | 0.75 |
| PF09391 | DUF2000 | 0.75 |
| PF13738 | Pyr_redox_3 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2166 | Sulfur transfer protein SufE, Fe-S cluster assembly | Posttranslational modification, protein turnover, chaperones [O] | 1.50 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.73 % |
| Unclassified | root | N/A | 8.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573003|GZIR7W402FZ4JL | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 539 | Open in IMG/M |
| 3300000955|JGI1027J12803_108176861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 647 | Open in IMG/M |
| 3300000956|JGI10216J12902_114771634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300000956|JGI10216J12902_115716160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 614 | Open in IMG/M |
| 3300004114|Ga0062593_103252577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 521 | Open in IMG/M |
| 3300004281|Ga0066397_10052648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 739 | Open in IMG/M |
| 3300005147|Ga0066821_1004306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 855 | Open in IMG/M |
| 3300005172|Ga0066683_10591021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300005187|Ga0066675_10777592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300005334|Ga0068869_101870517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300005341|Ga0070691_10927915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300005434|Ga0070709_10274120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1223 | Open in IMG/M |
| 3300005435|Ga0070714_101326236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 702 | Open in IMG/M |
| 3300005436|Ga0070713_102229257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 530 | Open in IMG/M |
| 3300005439|Ga0070711_100020537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 4258 | Open in IMG/M |
| 3300005563|Ga0068855_101969579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300005602|Ga0070762_10657152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 700 | Open in IMG/M |
| 3300005712|Ga0070764_10314735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 907 | Open in IMG/M |
| 3300005764|Ga0066903_101085949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1473 | Open in IMG/M |
| 3300005834|Ga0068851_10293921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 932 | Open in IMG/M |
| 3300005843|Ga0068860_101579205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 678 | Open in IMG/M |
| 3300005921|Ga0070766_10838130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 628 | Open in IMG/M |
| 3300006175|Ga0070712_101612169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300006175|Ga0070712_101638757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300006176|Ga0070765_100581182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1056 | Open in IMG/M |
| 3300006579|Ga0074054_11676751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 831 | Open in IMG/M |
| 3300006804|Ga0079221_11499512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 541 | Open in IMG/M |
| 3300006893|Ga0073928_10152661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1861 | Open in IMG/M |
| 3300006969|Ga0075419_10601754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 772 | Open in IMG/M |
| 3300007265|Ga0099794_10345736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 773 | Open in IMG/M |
| 3300009098|Ga0105245_10168776 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300009162|Ga0075423_10778534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1012 | Open in IMG/M |
| 3300009523|Ga0116221_1027443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2867 | Open in IMG/M |
| 3300009698|Ga0116216_10616898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 653 | Open in IMG/M |
| 3300010371|Ga0134125_10683965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1132 | Open in IMG/M |
| 3300010379|Ga0136449_103153982 | Not Available | 638 | Open in IMG/M |
| 3300010868|Ga0124844_1238770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
| 3300012206|Ga0137380_10278157 | Not Available | 1503 | Open in IMG/M |
| 3300012350|Ga0137372_10931271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300012357|Ga0137384_10747144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 793 | Open in IMG/M |
| 3300012357|Ga0137384_10898959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 714 | Open in IMG/M |
| 3300012358|Ga0137368_10859148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300012359|Ga0137385_11393641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300012473|Ga0157340_1018172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 571 | Open in IMG/M |
| 3300012517|Ga0157354_1032386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 673 | Open in IMG/M |
| 3300012917|Ga0137395_11090453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300012955|Ga0164298_10351490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 934 | Open in IMG/M |
| 3300013297|Ga0157378_10873961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 928 | Open in IMG/M |
| 3300013308|Ga0157375_10664761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1197 | Open in IMG/M |
| 3300014056|Ga0120125_1028061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1201 | Open in IMG/M |
| 3300015201|Ga0173478_10246021 | Not Available | 779 | Open in IMG/M |
| 3300016294|Ga0182041_10065129 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
| 3300016371|Ga0182034_11146831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
| 3300016404|Ga0182037_11301767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 641 | Open in IMG/M |
| 3300017821|Ga0187812_1218975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 607 | Open in IMG/M |
| 3300017926|Ga0187807_1113558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300017993|Ga0187823_10204289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 650 | Open in IMG/M |
| 3300017995|Ga0187816_10388716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300018040|Ga0187862_10594798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 656 | Open in IMG/M |
| 3300018081|Ga0184625_10667828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300018085|Ga0187772_10183410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1399 | Open in IMG/M |
| 3300019888|Ga0193751_1156146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 812 | Open in IMG/M |
| 3300020021|Ga0193726_1270012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
| 3300020170|Ga0179594_10205830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| 3300020582|Ga0210395_10307736 | Not Available | 1191 | Open in IMG/M |
| 3300021078|Ga0210381_10187197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 717 | Open in IMG/M |
| 3300021178|Ga0210408_10449394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1026 | Open in IMG/M |
| 3300021181|Ga0210388_10375703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1250 | Open in IMG/M |
| 3300021344|Ga0193719_10112790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1182 | Open in IMG/M |
| 3300021401|Ga0210393_10647434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 862 | Open in IMG/M |
| 3300021406|Ga0210386_10269582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1455 | Open in IMG/M |
| 3300021406|Ga0210386_10699652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 873 | Open in IMG/M |
| 3300021432|Ga0210384_11438303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300021432|Ga0210384_11817622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 515 | Open in IMG/M |
| 3300021445|Ga0182009_10721361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300021475|Ga0210392_10441543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 953 | Open in IMG/M |
| 3300021559|Ga0210409_10465719 | Not Available | 1126 | Open in IMG/M |
| 3300022498|Ga0242644_1024728 | Not Available | 620 | Open in IMG/M |
| 3300022709|Ga0222756_1009894 | Not Available | 1076 | Open in IMG/M |
| 3300022724|Ga0242665_10308636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 556 | Open in IMG/M |
| 3300022756|Ga0222622_11059058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300022899|Ga0247795_1001142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4444 | Open in IMG/M |
| 3300024279|Ga0247692_1014211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1220 | Open in IMG/M |
| 3300025907|Ga0207645_10413383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 908 | Open in IMG/M |
| 3300025911|Ga0207654_11278666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300025922|Ga0207646_10046920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3876 | Open in IMG/M |
| 3300025927|Ga0207687_11363111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 610 | Open in IMG/M |
| 3300025927|Ga0207687_11874641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 513 | Open in IMG/M |
| 3300025935|Ga0207709_10015207 | All Organisms → cellular organisms → Bacteria | 4266 | Open in IMG/M |
| 3300025939|Ga0207665_11004942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300026356|Ga0257150_1043158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
| 3300026374|Ga0257146_1021320 | Not Available | 1053 | Open in IMG/M |
| 3300026557|Ga0179587_10802771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300027173|Ga0208097_1008250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1113 | Open in IMG/M |
| 3300027765|Ga0209073_10094798 | Not Available | 1046 | Open in IMG/M |
| 3300027855|Ga0209693_10414259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 650 | Open in IMG/M |
| 3300027879|Ga0209169_10531625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 617 | Open in IMG/M |
| 3300027882|Ga0209590_10320948 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300027882|Ga0209590_10387528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 902 | Open in IMG/M |
| 3300027903|Ga0209488_10891157 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300028379|Ga0268266_12028141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 549 | Open in IMG/M |
| 3300028708|Ga0307295_10185792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 586 | Open in IMG/M |
| 3300028711|Ga0307293_10134829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 786 | Open in IMG/M |
| 3300028719|Ga0307301_10292277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300028773|Ga0302234_10231056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 798 | Open in IMG/M |
| 3300028789|Ga0302232_10415484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
| 3300028809|Ga0247824_10954493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300028819|Ga0307296_10290082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 891 | Open in IMG/M |
| 3300030659|Ga0316363_10333537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300031170|Ga0307498_10052992 | Not Available | 1106 | Open in IMG/M |
| 3300031231|Ga0170824_101749864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 643 | Open in IMG/M |
| 3300031234|Ga0302325_11414458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 903 | Open in IMG/M |
| 3300031543|Ga0318516_10162895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1282 | Open in IMG/M |
| 3300031544|Ga0318534_10618029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 615 | Open in IMG/M |
| 3300031547|Ga0310887_10377188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 829 | Open in IMG/M |
| 3300031549|Ga0318571_10279233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
| 3300031668|Ga0318542_10188773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1036 | Open in IMG/M |
| 3300031681|Ga0318572_10738890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300031716|Ga0310813_11602704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 608 | Open in IMG/M |
| 3300031719|Ga0306917_10099433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2084 | Open in IMG/M |
| 3300031736|Ga0318501_10633461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 588 | Open in IMG/M |
| 3300031771|Ga0318546_10039920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2860 | Open in IMG/M |
| 3300031794|Ga0318503_10174572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 695 | Open in IMG/M |
| 3300031831|Ga0318564_10080618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1438 | Open in IMG/M |
| 3300031832|Ga0318499_10226746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300031833|Ga0310917_10196260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1349 | Open in IMG/M |
| 3300031854|Ga0310904_10442404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 860 | Open in IMG/M |
| 3300031860|Ga0318495_10289763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 730 | Open in IMG/M |
| 3300031954|Ga0306926_11798318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
| 3300031962|Ga0307479_11353526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 672 | Open in IMG/M |
| 3300032001|Ga0306922_10657416 | Not Available | 1106 | Open in IMG/M |
| 3300032010|Ga0318569_10047279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1850 | Open in IMG/M |
| 3300032896|Ga0335075_11075661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 712 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.01% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.75% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE2_03118370 | 2189573003 | Grass Soil | MTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQ |
| JGI1027J12803_1081768612 | 3300000955 | Soil | VSETSDETWERDDCVRRTVVLPTELAERLAAEAERRGLSV |
| JGI10216J12902_1147716341 | 3300000956 | Soil | LSETPEEVWESDDCVRRTVVLPTELAERLAAEAERRG |
| JGI10216J12902_1157161602 | 3300000956 | Soil | LSETPDDVWESDDCVRRTVVIPTELAERLAAEAERRGLS |
| Ga0062593_1032525772 | 3300004114 | Soil | LSETPDDVWESDDCVRRTVVLPTELAERLAAEAERRGLSISDLLSEY |
| Ga0066397_100526481 | 3300004281 | Tropical Forest Soil | VSETTGEVWESDDCVHRTVVMPIALAERLAARAEQRGLSV |
| Ga0066821_10043061 | 3300005147 | Soil | VTEVPDEAWESDDRVRRTMVMPAGLAERLAARAEQRGLSV |
| Ga0066683_105910212 | 3300005172 | Soil | LSETPDEVWERDDCVRRTVVLPMELAERLAAEAERRGLSVSDLLI |
| Ga0066675_107775921 | 3300005187 | Soil | VSETPDEVWERDDCVRRTIVLPTEFAERLAAEAERRGLSVSDLLIEY |
| Ga0068869_1018705172 | 3300005334 | Miscanthus Rhizosphere | VTEVPDEAWESDDCVRRTMVMPAVLAERLAARAEQRGLSVSD |
| Ga0070691_109279151 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LSETPEDVWESDDCVRRTVVLPIELAERLAAEAERRGLSVS |
| Ga0070709_102741202 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LSETPEEVWESDDCVRRTVVLPTELAERLAAEAERRGLSVSDLLI |
| Ga0070714_1013262362 | 3300005435 | Agricultural Soil | VTEVPDEAWESDDCVRRTMVMPAGLAERLAARAEQRGLSVSDLLT |
| Ga0070713_1022292571 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEVPDEAWESDDRVRRTMVMPAGLAERLAARAEQRGLSVSDLL |
| Ga0070711_1000205371 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LTEVPDEAWESDDCVHRTMVMPAALAERLATRAEQRGLSVS |
| Ga0068855_1019695792 | 3300005563 | Corn Rhizosphere | VSEVPDEAWESDDFVRRTVVIPAVLAERLAARAEQ |
| Ga0070762_106571521 | 3300005602 | Soil | MSETPGEVWECDDCVRRTVVLPTELAERLAAQAQHRGLSVSDLLA |
| Ga0070764_103147352 | 3300005712 | Soil | VSEVPDEVWESDDRVRRTIVLPTRLAERLAARAEQRGLS |
| Ga0066903_1010859492 | 3300005764 | Tropical Forest Soil | LSESPAEAWESDDSVRRTVVLPTVLAERLAARAEQRGL |
| Ga0068851_102939212 | 3300005834 | Corn Rhizosphere | LSETPEDVWESDDCVRRTVVLPIELAERLAAEAERRGLSVSD |
| Ga0068860_1015792052 | 3300005843 | Switchgrass Rhizosphere | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAERR |
| Ga0070766_108381301 | 3300005921 | Soil | MSETPGEVWECDDCVRRTVVLPTELAERLAAQAQHRGLSVSD |
| Ga0070712_1016121691 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LSEVPDEVWERDDCVRRSVILPTELAERLAAEAERRGLSVSDL |
| Ga0070712_1016387572 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LSETPDEVWESDDCVHRTVVLPTELAERLAAEAERRGLSI |
| Ga0070765_1005811821 | 3300006176 | Soil | VSEVPDEAWESDDFVRRTMVMPALLAERLAARAEQRG |
| Ga0074054_116767511 | 3300006579 | Soil | LSETPGEVWESDDCVRRTVVMPAVLAERLAAQAEQRDLSVSDLLA |
| Ga0079221_114995121 | 3300006804 | Agricultural Soil | LSETPDDVWESDDCVRRTVVLPTELAERLAAEAELRGLSISDLLIE* |
| Ga0073928_101526611 | 3300006893 | Iron-Sulfur Acid Spring | VSEVPDEVWESDDRVRRMLVLPAALAERLAARAEQRG |
| Ga0075419_106017541 | 3300006969 | Populus Rhizosphere | LSETPDDVWESDDCVRRTVVIPTELAERLAAEAERRG |
| Ga0099794_103457361 | 3300007265 | Vadose Zone Soil | VSETPGDVWESDDCVRRTVVMPIVLAERLAVQAERRGLS |
| Ga0105245_101687761 | 3300009098 | Miscanthus Rhizosphere | LSETPDEAWESDDCVRRTVVLPTELAERLAAEAEKRGISISDL |
| Ga0075423_107785342 | 3300009162 | Populus Rhizosphere | LSETPDDVWESDDCVRRTVVLPTELAERLAAEAERRG |
| Ga0116221_10274434 | 3300009523 | Peatlands Soil | VSELPDEVWESDDCVRRTVVLPAVLTERLAARAEQRGLSFSDLLVEY |
| Ga0116216_106168981 | 3300009698 | Peatlands Soil | VSETPEQAWECDDCVRRTVVLPTELAERLAAQAQRRGLSFSDLLTEY |
| Ga0134125_106839651 | 3300010371 | Terrestrial Soil | LSETPEDVWESDDCVRRTVVLPIELAERLAAEAAR |
| Ga0136449_1031539822 | 3300010379 | Peatlands Soil | VSEVPDEAWESDDCVRRTIVLPAVLAERLADRAERRGLSVSDLLA |
| Ga0124844_12387701 | 3300010868 | Tropical Forest Soil | VSVSEEADLVWERDDWVRRTVVLPVAMAERLAAVA |
| Ga0137380_102781571 | 3300012206 | Vadose Zone Soil | VSETPDEVWERDDCVRRTIVLPTEFAERLAAEAERR |
| Ga0137372_109312711 | 3300012350 | Vadose Zone Soil | VPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSISD |
| Ga0137384_107471441 | 3300012357 | Vadose Zone Soil | VTEVPDEAWESDDCVRRTVVMPAGLAERLAARAEQRGLS |
| Ga0137384_108989592 | 3300012357 | Vadose Zone Soil | VTEVPDEAWESDDCVRRTVVMPTVLAERLAARAEQRGLSISDLL |
| Ga0137368_108591481 | 3300012358 | Vadose Zone Soil | VPDEAWESDDCVRRTVVMPAGLAERLAARAEQRGLSVSDLLTEY |
| Ga0137385_113936412 | 3300012359 | Vadose Zone Soil | LSETPGEIWESDDCVRRTVVLPTVLAERLAAQAERRGLSVSDLL |
| Ga0157340_10181722 | 3300012473 | Arabidopsis Rhizosphere | VPDEAWESDDRVRRTMVMPAGLAERLAARAEQRGL |
| Ga0157354_10323861 | 3300012517 | Unplanted Soil | VPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSVS |
| Ga0137395_110904531 | 3300012917 | Vadose Zone Soil | MSETPGEAWESDDYVLRTVVMPAALAEQLAAIADQ |
| Ga0164298_103514901 | 3300012955 | Soil | VSETSDEVWESDDCVRRTIVIPAELAERLAAEADRRGLSVSDLLS |
| Ga0157378_108739612 | 3300013297 | Miscanthus Rhizosphere | LSETPDEVWERDDCVRRTVVLPTELAERLAMEAERRGLSVSDLLIEY |
| Ga0157375_106647611 | 3300013308 | Miscanthus Rhizosphere | LSETPDEAWESDDCVRRTVVLPTELAERLAAEAEKRGLSISDLL |
| Ga0120125_10280611 | 3300014056 | Permafrost | MSNPPDEVWESDDCVRRTVVMPIVLAEHLAARAERRGLSVSDLLAE |
| Ga0173478_102460211 | 3300015201 | Soil | VSETSDETWERDDCVRRTVVLPTELAERLAAEAERRG |
| Ga0182041_100651291 | 3300016294 | Soil | LSEVPDEAWESDDCVRRTVVMPAALAERLAARAEQ |
| Ga0182034_111468312 | 3300016371 | Soil | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSVSDLLAEY |
| Ga0182037_113017672 | 3300016404 | Soil | VSETPSEAWEGDDSVRRTVVMPAALAERLAAEAERRELSVS |
| Ga0187812_12189752 | 3300017821 | Freshwater Sediment | VSEVPDEVWESDDCVRRTVVLPAPLAERLAARAEQR |
| Ga0187807_11135582 | 3300017926 | Freshwater Sediment | VSELPDEAWESDDCVRRTVVLPTVLTERLAARAETAWSFVQ |
| Ga0187823_102042891 | 3300017993 | Freshwater Sediment | VTEVPDEAWESDDCVRRTMVMPAGLAERLAARAEQRGLSVSDLL |
| Ga0187816_103887162 | 3300017995 | Freshwater Sediment | VSEDEVWESDDCVRRTVVLPTVLTERLAARAETAWSFVQ |
| Ga0187862_105947982 | 3300018040 | Peatland | VSETPGEAWECDDCVRRTVVLPTELAERLAAQAQRRGLSFSDLLTEY |
| Ga0184625_106678281 | 3300018081 | Groundwater Sediment | VSETPDEGWERDDCIRRTIVLPTELAERLAAEAERRGL |
| Ga0187772_101834101 | 3300018085 | Tropical Peatland | VSEGPDEVWESDDCVRRTIVLPAVLAERLAGRAERRGLSVSDLLA |
| Ga0193751_11561462 | 3300019888 | Soil | MSNPPDEVWESDDCVRRTVVMPIVLAEQLAAEAERRGLSVSDLLA |
| Ga0193726_12700121 | 3300020021 | Soil | VSDIPDQAWETDDCVRRTVVLPIPLAERLAARAEQRGL |
| Ga0179594_102058302 | 3300020170 | Vadose Zone Soil | LSETTDDVWDSDDCVRRTVVIPTELAERLAAEAERRGLSVSDLLI |
| Ga0210395_103077362 | 3300020582 | Soil | VSEVPDEVWESDDAVRRTLVLPARLAERLAARAEQRGLSFSDLLVEY |
| Ga0210381_101871972 | 3300021078 | Groundwater Sediment | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAQR |
| Ga0210408_104493941 | 3300021178 | Soil | MRGRQLTEVPDEAWESDDCVYRTMVMPAALAERLATRAEQRGLSV |
| Ga0210388_103757031 | 3300021181 | Soil | VSELPDDVWESDDCVRRTVVIPARLAERVAARAEQRGLSF |
| Ga0193719_101127902 | 3300021344 | Soil | LSETPDEVWESDELVRRTIVIPRELAERLAAEAERR |
| Ga0210393_106474341 | 3300021401 | Soil | VSEVPDEVWESDDCVRRTLVLPARLAERLAARAEQRGLSFSDLLVEY |
| Ga0210386_102695821 | 3300021406 | Soil | VAEPPGEVWESDDYVRRTVVMPVVLFARLAASAERRGVSINDL |
| Ga0210386_106996522 | 3300021406 | Soil | VSELPEDVWESDDCVRRMLVLPARLAERLAAQAEQRGL |
| Ga0210384_114383032 | 3300021432 | Soil | VAEPPGEVWESDDYVRRTVVMPVVLFARLAASAERRGVSISDLLVEF |
| Ga0210384_118176222 | 3300021432 | Soil | MRGRQLTEVPDEAWESDDCVYRTMVMPAALAERLATRAEQRGLSVSELLTE |
| Ga0182009_107213612 | 3300021445 | Soil | VTEVPDEAWESDDCVRRTVVMPAGLAERLAARAEQRGLSVSDLL |
| Ga0210392_104415432 | 3300021475 | Soil | VTEVPDEAWESDDRVRRTMVMPAGLAERLAARAEQRGLSVSD |
| Ga0210409_104657192 | 3300021559 | Soil | VSEVPDEVWESDDCVRRTLVLPTRLAERLAARAEQRGLSFSDL |
| Ga0242644_10247283 | 3300022498 | Soil | EVPDEVWESDDCVRRMLVLPARLAERLAARAEQRGL |
| Ga0222756_10098941 | 3300022709 | Soil | VSEVPDEVWESDDCVRRMLVLPARLAERLAAQAEQRGLSFSDLLV |
| Ga0242665_103086361 | 3300022724 | Soil | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRG |
| Ga0222622_110590581 | 3300022756 | Groundwater Sediment | VSETTGEVWESDDCVRRTVVMPIALAERLAARAEQRDLSVSDL |
| Ga0247795_10011427 | 3300022899 | Soil | VSETSDETWERDDCVRRTVVLPTELAERLAAEAERRGLSVSDLL |
| Ga0247692_10142111 | 3300024279 | Soil | LSETPDDVWESDDCVRRTVVLPTELAERLAAEAELR |
| Ga0207645_104133831 | 3300025907 | Miscanthus Rhizosphere | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAERRGLS |
| Ga0207654_112786662 | 3300025911 | Corn Rhizosphere | LSETPDEAWESDDCVRRTVVFPTELAERLAAEAEK |
| Ga0207646_100469206 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LSESPPEAWESDDSVRRTVVMPTVLAERLAARAEQRGLSVSDL |
| Ga0207687_113631111 | 3300025927 | Miscanthus Rhizosphere | LSETPDEAWESDDCVRRTVVLPTELAERLAAEAEKRGL |
| Ga0207687_118746411 | 3300025927 | Miscanthus Rhizosphere | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAERRGLSVS |
| Ga0207709_100152075 | 3300025935 | Miscanthus Rhizosphere | LSETPEDVWESDDCVRRTVVLPIELAERLAAEAERRGLSVSDLLIEY |
| Ga0207665_110049422 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAERRGLSVSDLL |
| Ga0257150_10431582 | 3300026356 | Soil | VSEVPDEVWESDDCVRRTLVLPARLAERLAARAEQRGLSFSDLLV |
| Ga0257146_10213202 | 3300026374 | Soil | VPDEAWESDDCVHRTVVMPAVLAERLAARADQRGLSISDLLTEY |
| Ga0179587_108027711 | 3300026557 | Vadose Zone Soil | VSEPAYEAWEHDDYVHRSVVLPAALAERLAAEAERR |
| Ga0208097_10082501 | 3300027173 | Forest Soil | VSEVPDEVWESDDRVRRTIVLPTRLAERLAARAEQRGLSFSDLL |
| Ga0209073_100947982 | 3300027765 | Agricultural Soil | LSETSDEVWERDDCVRRTVVLPTELADRLAAEAER |
| Ga0209693_104142591 | 3300027855 | Soil | VSEDEVWESDDCVRRTVVLPTLLAERIAAQAEQRGLSFSDLL |
| Ga0209169_105316252 | 3300027879 | Soil | VSEVPDEVWESDDRVRRTIVLPTRLAERLAARAEQ |
| Ga0209590_103209483 | 3300027882 | Vadose Zone Soil | LPETPGEVWESDDCVRRTIVLPTAVAERLAVQAGRRGLSVSDLLA |
| Ga0209590_103875282 | 3300027882 | Vadose Zone Soil | VSELPGEVWESDDSVCRTVVMAAELAERLAVQAERRG |
| Ga0209488_108911572 | 3300027903 | Vadose Zone Soil | VSETYDEVWESDDCVRRTIVIPIELAERLAAEADRRGVSVSDLLSEY |
| Ga0268266_120281412 | 3300028379 | Switchgrass Rhizosphere | LSETPEDVWESDDCVRRTVVLPIELAERLAAEAERRG |
| Ga0307295_101857922 | 3300028708 | Soil | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAQRRGLSVSDLLIEY |
| Ga0307293_101348292 | 3300028711 | Soil | VSETTGEVWESDDCVRRTVVMPIALAERLAARAEQRDLSVS |
| Ga0307301_102922772 | 3300028719 | Soil | VTEVPDEAWESDDCVRRTMVMPAVLAERLAARAEQ |
| Ga0302234_102310562 | 3300028773 | Palsa | LSATPEEVWEEDDCVRRTVVIPVMLAERLAAQADRRRLSVSDLL |
| Ga0302232_104154841 | 3300028789 | Palsa | MSEVPGEVWESDDWVRRTLVLPALLAERLAARAEQR |
| Ga0247824_109544932 | 3300028809 | Soil | LSETPDEVWERDDCVRRTVVLPTELAERLATEAERRGLSVSDLLIE |
| Ga0307296_102900821 | 3300028819 | Soil | LSETPDEVWESDELVRRTIAIPRRLAERLAAEAERRDLGINDLIV |
| Ga0316363_103335371 | 3300030659 | Peatlands Soil | VSELPDEAWESDDCVRRTVVLPAVLTERLAARAERRGLSFSD |
| Ga0307498_100529922 | 3300031170 | Soil | VTEVPDEAWESDDCVRRTMVMPTVLAERLAARAEQRGLSVSD |
| Ga0170824_1017498641 | 3300031231 | Forest Soil | LSETPDEVWESDDCVRRTVVLPTELAERLAAEAEKH |
| Ga0302325_114144581 | 3300031234 | Palsa | MSEVPGEVWESDDWVRRTLVLPALLAERLAARAEQRGLSFSDLLVE |
| Ga0318516_101628951 | 3300031543 | Soil | MSEVPDDVWESDDWVRRTIVLPAALAERLADRAERRGLSVSDLLAEY |
| Ga0318534_106180292 | 3300031544 | Soil | VSETPGEAWESDDCVRRTVVIRAVLAEQLAATAERRGLSVSDLLAE |
| Ga0310887_103771882 | 3300031547 | Soil | LSETPDDVWESDDCVRRTVVLPTELAERLAAEAELRGL |
| Ga0318571_102792331 | 3300031549 | Soil | VSEVPDEAWESDDCVRRMVVMPVALAERLAARAEQRGLSVSDLLAEY |
| Ga0318542_101887731 | 3300031668 | Soil | MSGVPDDVWESDDCVRRTIVLPAVLAERLADRAGQRGLSV |
| Ga0318572_107388902 | 3300031681 | Soil | VSEVPDEAWESDDCVRRTIVLPAVLAERLAGRAEQRGVSVSDL |
| Ga0310813_116027042 | 3300031716 | Soil | LSETPEDVWESDDCVRRTVVLPTELAERLAAEAQRR |
| Ga0306917_100994331 | 3300031719 | Soil | MSEVPDDVWESDDWVRRTIVLPAALAERLADRAERRGLSVSDLLAE |
| Ga0318501_106334611 | 3300031736 | Soil | VSEDEVWESDDCVRRTVVLPALLAERLAARAEQRG |
| Ga0318546_100399205 | 3300031771 | Soil | VSETPTEAWESDDSVRRTVVMPTELAERLAAEAER |
| Ga0318503_101745721 | 3300031794 | Soil | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSVSDLLTEY |
| Ga0318564_100806181 | 3300031831 | Soil | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSVSDL |
| Ga0318499_102267462 | 3300031832 | Soil | MSGVPDDVWESDDCVRRTIVLPAVLAERLADRAGQRGLS |
| Ga0310917_101962602 | 3300031833 | Soil | MSGVPDDVWESDDCVRRTIVLPAVLAERLADRAGQ |
| Ga0310904_104424042 | 3300031854 | Soil | LSETPEEVWESDDCVRRTVVLPTELAERLAAEAERRGLSVSDLLIEY |
| Ga0318495_102897631 | 3300031860 | Soil | MSEVPDDVWESDDWVRRTIVLPAALAERLADRAERR |
| Ga0306926_117983182 | 3300031954 | Soil | LSETPGEAWESDDCVRRTVVMPAALAERLAATAERRGLSVGDLLA |
| Ga0307479_113535262 | 3300031962 | Hardwood Forest Soil | VSENPDLVWESDDCVRRTVIMQAALAERLAAEAERR |
| Ga0306922_106574161 | 3300032001 | Soil | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLS |
| Ga0318569_100472793 | 3300032010 | Soil | VTEVPDEAWESDDCVRRTVVMPAVLAERLAARAEQRGLSVSDLLT |
| Ga0335075_110756611 | 3300032896 | Soil | VSEVPDEAWESDDCVRRTVVLPALLAERLAARAEQRGLSFSDLLVE |
| ⦗Top⦘ |