NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060183

Metagenome / Metatranscriptome Family F060183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060183
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 41 residues
Representative Sequence QPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL
Number of Associated Samples 108
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.75 %
% of genes near scaffold ends (potentially truncated) 98.50 %
% of genes from short scaffolds (< 2000 bps) 81.95 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.489 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(33.835 % of family members)
Environment Ontology (ENVO) Unclassified
(36.842 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.617 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 26.87%    Coil/Unstructured: 73.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF00180Iso_dh 8.27
PF069833-dmu-9_3-mt 5.26
PF02789Peptidase_M17_N 3.76
PF04185Phosphoesterase 3.01
PF00311PEPcase 1.50
PF07715Plug 1.50
PF07485DUF1529 1.50
PF14333DUF4389 1.50
PF08327AHSA1 1.50
PF10282Lactonase 1.50
PF04127DFP 0.75
PF07885Ion_trans_2 0.75
PF02310B12-binding 0.75
PF00082Peptidase_S8 0.75
PF00753Lactamase_B 0.75
PF12704MacB_PCD 0.75
PF00069Pkinase 0.75
PF02687FtsX 0.75
PF13505OMP_b-brl 0.75
PF01266DAO 0.75
PF04014MazE_antitoxin 0.75
PF13540RCC1_2 0.75
PF09365DUF2461 0.75
PF028262-Hacid_dh_C 0.75
PF02371Transposase_20 0.75
PF00903Glyoxalase 0.75
PF13699DUF4157 0.75
PF00440TetR_N 0.75
PF03167UDG 0.75
PF00365PFK 0.75
PF05299Peptidase_M61 0.75
PF00582Usp 0.75
PF13564DoxX_2 0.75
PF01152Bac_globin 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 5.26
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 5.26
COG0260Leucyl aminopeptidaseAmino acid transport and metabolism [E] 3.76
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.01
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 3.01
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 1.50
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.75
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.75
COG0452Phosphopantothenoylcysteine synthetase/decarboxylase CoaBCCoenzyme transport and metabolism [H] 0.75
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.75
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.75
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.75
COG3547TransposaseMobilome: prophages, transposons [X] 0.75
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.75
COG3975Predicted metalloprotease, contains C-terminal PDZ domainGeneral function prediction only [R] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.49 %
UnclassifiedrootN/A4.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11602438All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300001661|JGI12053J15887_10593556All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300002562|JGI25382J37095_10187036All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300002908|JGI25382J43887_10046019All Organisms → cellular organisms → Bacteria2373Open in IMG/M
3300002912|JGI25386J43895_10072962All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300002912|JGI25386J43895_10149259All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005172|Ga0066683_10920865All Organisms → cellular organisms → Bacteria → FCB group500Open in IMG/M
3300005176|Ga0066679_10486403All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005406|Ga0070703_10323929All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005434|Ga0070709_10224389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1341Open in IMG/M
3300005471|Ga0070698_100009082All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes10685Open in IMG/M
3300005529|Ga0070741_10304979All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300005540|Ga0066697_10214972All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300005553|Ga0066695_10508193All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005555|Ga0066692_10005489All Organisms → cellular organisms → Bacteria5614Open in IMG/M
3300005556|Ga0066707_10628794All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005556|Ga0066707_10816758All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005556|Ga0066707_10857939All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005574|Ga0066694_10152356All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300005574|Ga0066694_10333296All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005840|Ga0068870_10268255All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300006034|Ga0066656_10956645All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006175|Ga0070712_102054751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300006755|Ga0079222_10435765All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300006794|Ga0066658_10726451All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300006797|Ga0066659_11740402All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006800|Ga0066660_10724380All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300006854|Ga0075425_100096728All Organisms → cellular organisms → Bacteria3352Open in IMG/M
3300006854|Ga0075425_102232773All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006871|Ga0075434_102056906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales576Open in IMG/M
3300006914|Ga0075436_100122298All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300007076|Ga0075435_100215497All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300007076|Ga0075435_100376118All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300007076|Ga0075435_101711679All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300007265|Ga0099794_10192014All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1044Open in IMG/M
3300009012|Ga0066710_102596406All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300009089|Ga0099828_10259361All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1560Open in IMG/M
3300009090|Ga0099827_10620998All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300009090|Ga0099827_10794949All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300009137|Ga0066709_103352021All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes582Open in IMG/M
3300010045|Ga0126311_11819967All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium516Open in IMG/M
3300010047|Ga0126382_10888825Not Available769Open in IMG/M
3300010301|Ga0134070_10201412All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300010325|Ga0134064_10176715All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300010326|Ga0134065_10084557All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300010329|Ga0134111_10285385All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300010335|Ga0134063_10412543All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes664Open in IMG/M
3300010336|Ga0134071_10497773All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes629Open in IMG/M
3300010371|Ga0134125_12496252All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010399|Ga0134127_10316726All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1509Open in IMG/M
3300010399|Ga0134127_12805208All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300011270|Ga0137391_11332557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium565Open in IMG/M
3300011444|Ga0137463_1184950All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300011445|Ga0137427_10001107All Organisms → cellular organisms → Bacteria12486Open in IMG/M
3300012096|Ga0137389_10831402All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300012189|Ga0137388_10033696All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4016Open in IMG/M
3300012189|Ga0137388_11828397All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300012198|Ga0137364_10034931All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300012198|Ga0137364_10324539All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300012198|Ga0137364_10855682All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes687Open in IMG/M
3300012198|Ga0137364_10975437All Organisms → cellular organisms → Bacteria → FCB group641Open in IMG/M
3300012199|Ga0137383_10025876All Organisms → cellular organisms → Bacteria → Acidobacteria4096Open in IMG/M
3300012200|Ga0137382_10454305All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300012203|Ga0137399_10068858All Organisms → cellular organisms → Bacteria2647Open in IMG/M
3300012203|Ga0137399_10160995All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300012203|Ga0137399_11730681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes514Open in IMG/M
3300012204|Ga0137374_10839586All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012205|Ga0137362_10761997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium830Open in IMG/M
3300012205|Ga0137362_11258519All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012206|Ga0137380_10401313All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300012207|Ga0137381_11355365All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012207|Ga0137381_11752065All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012210|Ga0137378_10035242All Organisms → cellular organisms → Bacteria4455Open in IMG/M
3300012212|Ga0150985_119225306All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes547Open in IMG/M
3300012285|Ga0137370_10583352All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300012285|Ga0137370_10879677All Organisms → cellular organisms → Bacteria → FCB group554Open in IMG/M
3300012349|Ga0137387_10051072All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2757Open in IMG/M
3300012349|Ga0137387_10753652All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes704Open in IMG/M
3300012349|Ga0137387_11113602All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012349|Ga0137387_11196973All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300012351|Ga0137386_10665003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300012357|Ga0137384_11479274All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012360|Ga0137375_10021069All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis7560Open in IMG/M
3300012398|Ga0134051_1144502All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes505Open in IMG/M
3300012532|Ga0137373_10014378All Organisms → cellular organisms → Bacteria → Proteobacteria8094Open in IMG/M
3300012683|Ga0137398_10002761All Organisms → cellular organisms → Bacteria7600Open in IMG/M
3300012685|Ga0137397_10099418All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2132Open in IMG/M
3300012922|Ga0137394_11111931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium654Open in IMG/M
3300012925|Ga0137419_11052991All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300012929|Ga0137404_10114194All Organisms → cellular organisms → Bacteria2198Open in IMG/M
3300012929|Ga0137404_11735172All Organisms → cellular organisms → Bacteria → FCB group580Open in IMG/M
3300012930|Ga0137407_10027532All Organisms → cellular organisms → Bacteria4378Open in IMG/M
3300012931|Ga0153915_13015832Not Available548Open in IMG/M
3300012937|Ga0162653_100040149All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300012972|Ga0134077_10045964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1598Open in IMG/M
3300012972|Ga0134077_10221774All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300012972|Ga0134077_10343087All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012976|Ga0134076_10127525All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300014157|Ga0134078_10527541All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300014166|Ga0134079_10015687Not Available2376Open in IMG/M
3300015264|Ga0137403_10151085All Organisms → cellular organisms → Bacteria2288Open in IMG/M
3300015358|Ga0134089_10572700All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes502Open in IMG/M
3300017654|Ga0134069_1223416All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300017656|Ga0134112_10354445All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300018075|Ga0184632_10158727All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300018482|Ga0066669_11554805All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes602Open in IMG/M
3300019259|Ga0184646_1376683All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300019789|Ga0137408_1123186All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3190Open in IMG/M
3300020579|Ga0210407_11248905All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300021073|Ga0210378_10130806All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300024219|Ga0247665_1004513Not Available1459Open in IMG/M
3300025885|Ga0207653_10060351All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300025928|Ga0207700_11518851All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300026089|Ga0207648_10758687All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300026296|Ga0209235_1134561All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300026296|Ga0209235_1181013All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300026298|Ga0209236_1027610All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3077Open in IMG/M
3300026301|Ga0209238_1175430Not Available632Open in IMG/M
3300026318|Ga0209471_1331756All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300026325|Ga0209152_10375384All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes551Open in IMG/M
3300026332|Ga0209803_1279758All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300026532|Ga0209160_1049620All Organisms → cellular organisms → Bacteria2439Open in IMG/M
3300026548|Ga0209161_10356145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300026550|Ga0209474_10024814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4574Open in IMG/M
3300027765|Ga0209073_10504017Not Available511Open in IMG/M
3300027882|Ga0209590_10249413All Organisms → cellular organisms → Bacteria → Proteobacteria1132Open in IMG/M
3300027909|Ga0209382_10243914All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300028536|Ga0137415_10508286All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1013Open in IMG/M
3300028796|Ga0307287_10139562All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300028814|Ga0307302_10599827All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes547Open in IMG/M
3300028881|Ga0307277_10468647All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300031965|Ga0326597_10300399All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300032205|Ga0307472_101840769All Organisms → cellular organisms → Bacteria602Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil33.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil12.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil8.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.02%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.01%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.26%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.50%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.50%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.75%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1160243833300000891SoilIDKDSGQARSRIELGKEKEPVYAVDDIAGMLFLRAAPGTLVGYKL*
JGI12053J15887_1059355613300001661Forest SoilQIDKDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTAPGTLAGYKL*
JGI25382J37095_1018703623300002562Grasslands SoilIDKDSAQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGMLVGYRL*
JGI25382J43887_1004601933300002908Grasslands SoilDSGQPRSRVDLGKEREPVYAVDDVANMLFLRTTAGTLVGYRL*
JGI25386J43895_1007296233300002912Grasslands SoilDKDNAQPRSRVDLGKQREPVYAVDDIAGMLFLQTSSGTLAGYKL*
JGI25386J43895_1014925913300002912Grasslands SoilLLQIDKDSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTAGTLAGYKL*
Ga0066683_1092086513300005172SoilAQPRARVDLGKEREPVYAVDDVANMLFLRTASGTLVGYRL*
Ga0066679_1048640323300005176SoilQIDKDTAKSRAQVNLGKENEPAYAVDDIADMLFLQTTPGTLVGYRL*
Ga0070703_1032392913300005406Corn, Switchgrass And Miscanthus RhizosphereLDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL*
Ga0070709_1022438933300005434Corn, Switchgrass And Miscanthus RhizosphereDKRTAEPQASINLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL*
Ga0070698_100009082123300005471Corn, Switchgrass And Miscanthus RhizosphereKDSGQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL*
Ga0070741_1030497943300005529Surface SoilNVLLQIDKSTAQPQARVNLGKENEPAYAVDDIADMLFLQTAPGTLVGYRL*
Ga0066697_1021497233300005540SoilRVDLGKEREPVYAVDDVAGMLFLRTASGTLVGYRL*
Ga0066695_1050819323300005553SoilNGNVLLQLDKDTTQPRSRVDLGKQREPVYAVDDIAGMLFLQTTSGTLAGYKL*
Ga0066692_1000548973300005555SoilRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0066707_1062879413300005556SoilVDLGKEREPVYAVDDVAGMLFLRTASATLVGYRL*
Ga0066707_1081675823300005556SoilQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL*
Ga0066707_1085793933300005556SoilRSRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0066694_1015235623300005574SoilATAKPKAQVNLGKEKEPAYAVDDIADMLFLQTTPGTLVGYRL*
Ga0066694_1033329613300005574SoilRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL*
Ga0068870_1026825533300005840Miscanthus RhizosphereRARIDLGKDKEPVYAVDDISGMLFLRTGPGTVVGYRL*
Ga0066656_1095664523300006034SoilIDKDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL*
Ga0070712_10205475123300006175Corn, Switchgrass And Miscanthus RhizosphereTAEPQASINLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL*
Ga0079222_1043576513300006755Agricultural SoilDLGKDREPVYAVDDVAGMLFLKTAAGTLTGFRLQ*
Ga0066658_1072645113300006794SoilRVDLGREREPVYAVDDVAGMLFLKTAAGTLVGYKL*
Ga0066659_1174040213300006797SoilPRARVDLGKEREPVYAVDDIAGMLFLRTASGTLVGYRL*
Ga0066660_1072438023300006800SoilVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0075425_10009672813300006854Populus RhizosphereQPRARVDLGKEREPVYAVDDVAGMLFLQTTPGTLVSYRL*
Ga0075425_10223277323300006854Populus RhizosphereQPRSRVDLGKQREPVYAVDDISGMLFLQTTNGTLVGYRL*
Ga0075434_10205690623300006871Populus RhizosphereKDSGQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYPL*
Ga0075436_10012229833300006914Populus RhizosphereDKDSAQPRARVDLGKEREPVYAVDDVAGMLFLQTTPGTLVSYRL*
Ga0075435_10021549713300007076Populus RhizosphereARVDLGKEREPVYAVDDVAGMLFLQTTPGTLVSYRL*
Ga0075435_10037611833300007076Populus RhizospherePKSRIDLGKDREPVYAVDDVAGMLFLKTAAGTLTAFRL*
Ga0075435_10171167913300007076Populus RhizosphereNVLLQIDKDNAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTTGTLAGYRL*
Ga0099794_1019201423300007265Vadose Zone SoilQLDKDSAQPRARVDLGKEREPVYAVDDVASMLFLRTASGTLVGYRL*
Ga0066710_10259640623300009012Grasslands SoilAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL
Ga0099828_1025936113300009089Vadose Zone SoilTAQPRARVDLGKEREPVYAVDDVASMLFLRTGSGTLVGYRL*
Ga0099827_1062099833300009090Vadose Zone SoilAQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL*
Ga0099827_1079494933300009090Vadose Zone SoilRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0066709_10335202113300009137Grasslands SoilKDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTAAGTLTAYRL*
Ga0126311_1181996723300010045Serpentine SoilQIDKVSAQPKGRLDLGKDREPVYAVDDIAGMLFLRTAPGTLVGYRL*
Ga0126382_1088882513300010047Tropical Forest SoilLQIDKDSGQPRARVDLGKEREPVYAVDDLAGMLFLRTTAGTLAGYRL*
Ga0134070_1020141223300010301Grasslands SoilVDLGKEREPVYAVDDVANMLFLRSATGSLVAYRL*
Ga0134064_1017671523300010325Grasslands SoilVDLGKEREPVYAVDDVSNMLFLRTTGGTLVGYRL*
Ga0134065_1008455713300010326Grasslands SoilPDGNGNVLLQLDKDTTQPRSRVDLGKQREPVYAVDDISGMLFLQTAAGVLAGYKL*
Ga0134111_1028538533300010329Grasslands SoilVDLGKEREPVYAVDDVAGMLFLRTTTGTLVGYRL*
Ga0134063_1041254313300010335Grasslands SoilSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL*
Ga0134071_1049777323300010336Grasslands SoilAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL*
Ga0134125_1249625213300010371Terrestrial SoilKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0134127_1031672633300010399Terrestrial SoilQIDKDSAQPRARVNLGKEREPVYAVDDIAGMLFLQTAAGTLVGYRL*
Ga0134127_1280520823300010399Terrestrial SoilKDSGQPRARVDLGKEREPVYAVDDIAGMLFLRTTAGTVVAYRL*
Ga0137391_1133255723300011270Vadose Zone SoilRARVDLGKEREPVYAVDDVASMLFLRTGSGTLVGYRL*
Ga0137463_118495013300011444SoilPDGYGNSLRQIDKDSAQQRARVDLGKEREPVYSVYDVAGMLFLQTASGTLVGYRL*
Ga0137427_10001107133300011445SoilEGNGNVLLQIDKDSAQPRARVDLGKEREPVYAVDDIAGMLFLRTTAGTVVAYRL*
Ga0137389_1083140233300012096Vadose Zone SoilRVDLGKQREPVYAVDDIAGMLFLQTTAGTLAGYKL*
Ga0137388_1003369643300012189Vadose Zone SoilDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL*
Ga0137388_1182839723300012189Vadose Zone SoilSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0137364_1003493113300012198Vadose Zone SoilDSGQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL*
Ga0137364_1032453913300012198Vadose Zone SoilKDSAQPRARVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL*
Ga0137364_1085568213300012198Vadose Zone SoilQPRSRVDLGKQREPVYAVDDIAGMLFLQTTSGTLAGYRL*
Ga0137364_1097543723300012198Vadose Zone SoilQIDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL*
Ga0137383_1002587613300012199Vadose Zone SoilSAQPRARVDLGKEREPVYAVDEVAGMLFLQTVPGTLVGYRL*
Ga0137382_1045430523300012200Vadose Zone SoilVELGKEREPVYAVDDIAGMLFLRTTTGTLAGYRL*
Ga0137399_1006885813300012203Vadose Zone SoilVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYKL*
Ga0137399_1016099513300012203Vadose Zone SoilNGNVLLQIDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTAGTLAGYRL*
Ga0137399_1173068113300012203Vadose Zone SoilQPRSRVDLGKQREPVYAVDDISGMLFLQTTAGTLAGYRL*
Ga0137374_1083958613300012204Vadose Zone SoilGNGNVLLQIDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYKL*
Ga0137362_1076199723300012205Vadose Zone SoilARYRRKEREPVYAVDDVAGMLFLQTSPGTLVGYRL*
Ga0137362_1125851923300012205Vadose Zone SoilQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0137380_1040131313300012206Vadose Zone SoilIDKDSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL*
Ga0137381_1135536533300012207Vadose Zone SoilGRVDLGKEREPVYAVDDVAGMLFLRTAPTTLVGYRL*
Ga0137381_1175206513300012207Vadose Zone SoilPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL*
Ga0137378_1003524253300012210Vadose Zone SoilQIDKDSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL*
Ga0150985_11922530613300012212Avena Fatua RhizospherePRSRVDLGKEREPVYAVDDISGMLFLRTGPGTLAGYRL*
Ga0137370_1058335213300012285Vadose Zone SoilQSRARVDLGKEREPVYAVDDVSNMLFLRTMGGTLVGYRL*
Ga0137370_1087967713300012285Vadose Zone SoilIDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL*
Ga0137387_1005107213300012349Vadose Zone SoilVDLGKEREPVYAVDDVAGMLFLRTASGTLVGYRL*
Ga0137387_1075365213300012349Vadose Zone SoilQIDKDNAQPRSRVDLGKQREPVYAVDDIAGMLFLQTSSGTLAGYKL*
Ga0137387_1111360223300012349Vadose Zone SoilVDLGKEREPVYAVDDIAGMLFLRTAPGTLVGYRL*
Ga0137387_1119697323300012349Vadose Zone SoilVDLGKEREPVYAVDDVANMLFLQTASGTLVGYRL*
Ga0137386_1066500323300012351Vadose Zone SoilARVDLGKDREPVYAVDDVVGMLFLRTAPSTLVGYRL*
Ga0137384_1147927423300012357Vadose Zone SoilGQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLIGYRL*
Ga0137375_1002106913300012360Vadose Zone SoilQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYKL*
Ga0134051_114450223300012398Grasslands SoilDKDNAQPRGRVDLGKEREPVYAVDDIAGMLFLRTAPGTLAGYRL*
Ga0137373_10014378103300012532Vadose Zone SoilSRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0137398_1000276113300012683Vadose Zone SoilGQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL*
Ga0137397_1009941813300012685Vadose Zone SoilDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTAGTLAGYRL*
Ga0137394_1111193113300012922Vadose Zone SoilVDLGKEREPVYAVDDVAGMLFLRTAPGTLVCYRL*
Ga0137419_1105299113300012925Vadose Zone SoilSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0137404_1011419443300012929Vadose Zone SoilDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0137404_1173517223300012929Vadose Zone SoilQLDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0137407_1002753213300012930Vadose Zone SoilDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0153915_1301583223300012931Freshwater WetlandsRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLIGYRL*
Ga0162653_10004014923300012937SoilLQVDKVSAEPRARIDLGNDKEPVYAVDDISGMLFLRTGPGTVVGYRL*
Ga0134077_1004596443300012972Grasslands SoilDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLFGYRL*
Ga0134077_1022177423300012972Grasslands SoilKDSGQPRSRVDLGKEREPVYAVDDVANMLFLRTASGTLVGYRL*
Ga0134077_1034308723300012972Grasslands SoilRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL*
Ga0134076_1012752513300012976Grasslands SoilARVDLGKEREPVYAVDDVAGMLFLRTASGTLVGYRL*
Ga0134078_1052754113300014157Grasslands SoilPRSRVDLGKEREPVYAVDDVANMLFLRSASGSLVAYRL*
Ga0134079_1001568743300014166Grasslands SoilRVDLGKEREPVYAVDDVAGMLFLRTAPRTLVGYRL*
Ga0137403_1015108513300015264Vadose Zone SoilPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL*
Ga0134089_1057270023300015358Grasslands SoilLLQIDKDSAQPRARVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL*
Ga0134069_122341613300017654Grasslands SoilQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL
Ga0134112_1035444523300017656Grasslands SoilSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL
Ga0184632_1015872713300018075Groundwater SedimentSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYKLQND
Ga0066669_1155480513300018482Grasslands SoilQPRARVDLGKEREPVYAVDDIAGMLFLRTAPGTLVGYRL
Ga0184646_137668333300019259Groundwater SedimentLLQIDKDSAQPRARVDLGKAREPVYAVDDIAGMLFLQTAAGTLVGYRL
Ga0137408_112318673300019789Vadose Zone SoilQLDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL
Ga0210407_1124890513300020579SoilLAQVNLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL
Ga0210378_1013080633300021073Groundwater SedimentLQIDKGSIQPLARVDLGKEREPVYAVDDIAGMLFLRTAPGTLVGYRL
Ga0247665_100451313300024219SoilKESAQARSRVDLGKEREPVYAVDDVAGMLFLRTVPGTLVGYRL
Ga0207653_1006035133300025885Corn, Switchgrass And Miscanthus RhizosphereSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL
Ga0207700_1151885113300025928Corn, Switchgrass And Miscanthus RhizosphereQVNLGKENEPAYAVDDIADMLFLQTTPGTLVGYRL
Ga0207648_1075868723300026089Miscanthus RhizosphereQARSRIELGKEKEPVYAVDDIAGMLFLRAAPGTLVGYKL
Ga0209235_113456123300026296Grasslands SoilPRSRVDLGKEREPVYAVDDVAGMLLLRTTAGTLVGYRL
Ga0209235_118101333300026296Grasslands SoilGQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL
Ga0209236_102761013300026298Grasslands SoilSRVDLGKQREPVYAVDDISGMLFLQTTPGTLTGYRL
Ga0209238_117543023300026301Grasslands SoilARPRARVDLGKEREPVYAVDDVAGMLFLRTTPGTLVGYRL
Ga0209471_133175613300026318SoilARVELGKEREPVYAVDDVAGMLFLQTAPSTLVGYRL
Ga0209152_1037538423300026325SoilRVDLGREREPVYAVDDVAGMLFLKTAAGTLVGYKL
Ga0209803_127975813300026332SoilQARSRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL
Ga0209160_104962013300026532SoilRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL
Ga0209161_1035614513300026548SoilDSGQPRARVDLGKEREPVYAVDDVSGMLFLRTTPGTLVGYRL
Ga0209474_1002481453300026550SoilPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL
Ga0209073_1050401713300027765Agricultural SoilPRSRVDLGKEREPVYAVDDVAGMLFLRTATATLVGYRL
Ga0209590_1024941313300027882Vadose Zone SoilARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL
Ga0209382_1024391413300027909Populus RhizosphereKDSAQPRAQVNLGKEREPVYAVDDIAGMLFLQTASGTLVGYRL
Ga0137415_1050828613300028536Vadose Zone SoilDTGRRRQRPSQIDKDSAQPRARVDLGKEREPVYAVDDIAAMLFLRTASGTLVGYRL
Ga0307287_1013956233300028796SoilTTQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL
Ga0307302_1059982723300028814SoilQIDKDTGQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL
Ga0307277_1046864723300028881SoilRSRVDLGKQREPVYAVDDISGMLFLQTSPGTLAGYRL
Ga0326597_1030039953300031965SoilPRSRVDLGKEREPVYAVDDVARMLFLQTAAGTLVGYRL
Ga0307472_10184076923300032205Hardwood Forest SoilKSTAQPRAQVNLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.