| Basic Information | |
|---|---|
| Family ID | F060183 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 41 residues |
| Representative Sequence | QPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 81.95 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.489 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.835 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.842 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.617 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.87% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00180 | Iso_dh | 8.27 |
| PF06983 | 3-dmu-9_3-mt | 5.26 |
| PF02789 | Peptidase_M17_N | 3.76 |
| PF04185 | Phosphoesterase | 3.01 |
| PF00311 | PEPcase | 1.50 |
| PF07715 | Plug | 1.50 |
| PF07485 | DUF1529 | 1.50 |
| PF14333 | DUF4389 | 1.50 |
| PF08327 | AHSA1 | 1.50 |
| PF10282 | Lactonase | 1.50 |
| PF04127 | DFP | 0.75 |
| PF07885 | Ion_trans_2 | 0.75 |
| PF02310 | B12-binding | 0.75 |
| PF00082 | Peptidase_S8 | 0.75 |
| PF00753 | Lactamase_B | 0.75 |
| PF12704 | MacB_PCD | 0.75 |
| PF00069 | Pkinase | 0.75 |
| PF02687 | FtsX | 0.75 |
| PF13505 | OMP_b-brl | 0.75 |
| PF01266 | DAO | 0.75 |
| PF04014 | MazE_antitoxin | 0.75 |
| PF13540 | RCC1_2 | 0.75 |
| PF09365 | DUF2461 | 0.75 |
| PF02826 | 2-Hacid_dh_C | 0.75 |
| PF02371 | Transposase_20 | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| PF13699 | DUF4157 | 0.75 |
| PF00440 | TetR_N | 0.75 |
| PF03167 | UDG | 0.75 |
| PF00365 | PFK | 0.75 |
| PF05299 | Peptidase_M61 | 0.75 |
| PF00582 | Usp | 0.75 |
| PF13564 | DoxX_2 | 0.75 |
| PF01152 | Bac_globin | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 5.26 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 5.26 |
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 3.76 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.01 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 3.01 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 1.50 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.75 |
| COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 0.75 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.75 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.75 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.75 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.75 |
| COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.49 % |
| Unclassified | root | N/A | 4.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11602438 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300001661|JGI12053J15887_10593556 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300002562|JGI25382J37095_10187036 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300002908|JGI25382J43887_10046019 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300002912|JGI25386J43895_10072962 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300002912|JGI25386J43895_10149259 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005172|Ga0066683_10920865 | All Organisms → cellular organisms → Bacteria → FCB group | 500 | Open in IMG/M |
| 3300005176|Ga0066679_10486403 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300005406|Ga0070703_10323929 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005434|Ga0070709_10224389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1341 | Open in IMG/M |
| 3300005471|Ga0070698_100009082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 10685 | Open in IMG/M |
| 3300005529|Ga0070741_10304979 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300005540|Ga0066697_10214972 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300005553|Ga0066695_10508193 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005555|Ga0066692_10005489 | All Organisms → cellular organisms → Bacteria | 5614 | Open in IMG/M |
| 3300005556|Ga0066707_10628794 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005556|Ga0066707_10816758 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005556|Ga0066707_10857939 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005574|Ga0066694_10152356 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005574|Ga0066694_10333296 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005840|Ga0068870_10268255 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300006034|Ga0066656_10956645 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006175|Ga0070712_102054751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300006755|Ga0079222_10435765 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300006794|Ga0066658_10726451 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006797|Ga0066659_11740402 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006800|Ga0066660_10724380 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006854|Ga0075425_100096728 | All Organisms → cellular organisms → Bacteria | 3352 | Open in IMG/M |
| 3300006854|Ga0075425_102232773 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006871|Ga0075434_102056906 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 576 | Open in IMG/M |
| 3300006914|Ga0075436_100122298 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300007076|Ga0075435_100215497 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300007076|Ga0075435_100376118 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300007076|Ga0075435_101711679 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300007265|Ga0099794_10192014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1044 | Open in IMG/M |
| 3300009012|Ga0066710_102596406 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009089|Ga0099828_10259361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1560 | Open in IMG/M |
| 3300009090|Ga0099827_10620998 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300009090|Ga0099827_10794949 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300009137|Ga0066709_103352021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300010045|Ga0126311_11819967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 516 | Open in IMG/M |
| 3300010047|Ga0126382_10888825 | Not Available | 769 | Open in IMG/M |
| 3300010301|Ga0134070_10201412 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010325|Ga0134064_10176715 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010326|Ga0134065_10084557 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300010329|Ga0134111_10285385 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010335|Ga0134063_10412543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 664 | Open in IMG/M |
| 3300010336|Ga0134071_10497773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 629 | Open in IMG/M |
| 3300010371|Ga0134125_12496252 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010399|Ga0134127_10316726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1509 | Open in IMG/M |
| 3300010399|Ga0134127_12805208 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300011270|Ga0137391_11332557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 565 | Open in IMG/M |
| 3300011444|Ga0137463_1184950 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300011445|Ga0137427_10001107 | All Organisms → cellular organisms → Bacteria | 12486 | Open in IMG/M |
| 3300012096|Ga0137389_10831402 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012189|Ga0137388_10033696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4016 | Open in IMG/M |
| 3300012189|Ga0137388_11828397 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012198|Ga0137364_10034931 | All Organisms → cellular organisms → Bacteria | 3240 | Open in IMG/M |
| 3300012198|Ga0137364_10324539 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012198|Ga0137364_10855682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300012198|Ga0137364_10975437 | All Organisms → cellular organisms → Bacteria → FCB group | 641 | Open in IMG/M |
| 3300012199|Ga0137383_10025876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4096 | Open in IMG/M |
| 3300012200|Ga0137382_10454305 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012203|Ga0137399_10068858 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
| 3300012203|Ga0137399_10160995 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300012203|Ga0137399_11730681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300012204|Ga0137374_10839586 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012205|Ga0137362_10761997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300012205|Ga0137362_11258519 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012206|Ga0137380_10401313 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300012207|Ga0137381_11355365 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012207|Ga0137381_11752065 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012210|Ga0137378_10035242 | All Organisms → cellular organisms → Bacteria | 4455 | Open in IMG/M |
| 3300012212|Ga0150985_119225306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
| 3300012285|Ga0137370_10583352 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012285|Ga0137370_10879677 | All Organisms → cellular organisms → Bacteria → FCB group | 554 | Open in IMG/M |
| 3300012349|Ga0137387_10051072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2757 | Open in IMG/M |
| 3300012349|Ga0137387_10753652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 704 | Open in IMG/M |
| 3300012349|Ga0137387_11113602 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012349|Ga0137387_11196973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300012351|Ga0137386_10665003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300012357|Ga0137384_11479274 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012360|Ga0137375_10021069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7560 | Open in IMG/M |
| 3300012398|Ga0134051_1144502 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
| 3300012532|Ga0137373_10014378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8094 | Open in IMG/M |
| 3300012683|Ga0137398_10002761 | All Organisms → cellular organisms → Bacteria | 7600 | Open in IMG/M |
| 3300012685|Ga0137397_10099418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2132 | Open in IMG/M |
| 3300012922|Ga0137394_11111931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 654 | Open in IMG/M |
| 3300012925|Ga0137419_11052991 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012929|Ga0137404_10114194 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300012929|Ga0137404_11735172 | All Organisms → cellular organisms → Bacteria → FCB group | 580 | Open in IMG/M |
| 3300012930|Ga0137407_10027532 | All Organisms → cellular organisms → Bacteria | 4378 | Open in IMG/M |
| 3300012931|Ga0153915_13015832 | Not Available | 548 | Open in IMG/M |
| 3300012937|Ga0162653_100040149 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012972|Ga0134077_10045964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1598 | Open in IMG/M |
| 3300012972|Ga0134077_10221774 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012972|Ga0134077_10343087 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012976|Ga0134076_10127525 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300014157|Ga0134078_10527541 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300014166|Ga0134079_10015687 | Not Available | 2376 | Open in IMG/M |
| 3300015264|Ga0137403_10151085 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
| 3300015358|Ga0134089_10572700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300017654|Ga0134069_1223416 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300017656|Ga0134112_10354445 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300018075|Ga0184632_10158727 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300018482|Ga0066669_11554805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 602 | Open in IMG/M |
| 3300019259|Ga0184646_1376683 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300019789|Ga0137408_1123186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3190 | Open in IMG/M |
| 3300020579|Ga0210407_11248905 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021073|Ga0210378_10130806 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300024219|Ga0247665_1004513 | Not Available | 1459 | Open in IMG/M |
| 3300025885|Ga0207653_10060351 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300025928|Ga0207700_11518851 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026089|Ga0207648_10758687 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300026296|Ga0209235_1134561 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300026296|Ga0209235_1181013 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300026298|Ga0209236_1027610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3077 | Open in IMG/M |
| 3300026301|Ga0209238_1175430 | Not Available | 632 | Open in IMG/M |
| 3300026318|Ga0209471_1331756 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026325|Ga0209152_10375384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300026332|Ga0209803_1279758 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026532|Ga0209160_1049620 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300026548|Ga0209161_10356145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300026550|Ga0209474_10024814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4574 | Open in IMG/M |
| 3300027765|Ga0209073_10504017 | Not Available | 511 | Open in IMG/M |
| 3300027882|Ga0209590_10249413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300027909|Ga0209382_10243914 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300028536|Ga0137415_10508286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1013 | Open in IMG/M |
| 3300028796|Ga0307287_10139562 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300028814|Ga0307302_10599827 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
| 3300028881|Ga0307277_10468647 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031965|Ga0326597_10300399 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300032205|Ga0307472_101840769 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.01% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.26% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.50% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_116024383 | 3300000891 | Soil | IDKDSGQARSRIELGKEKEPVYAVDDIAGMLFLRAAPGTLVGYKL* |
| JGI12053J15887_105935561 | 3300001661 | Forest Soil | QIDKDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTAPGTLAGYKL* |
| JGI25382J37095_101870362 | 3300002562 | Grasslands Soil | IDKDSAQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGMLVGYRL* |
| JGI25382J43887_100460193 | 3300002908 | Grasslands Soil | DSGQPRSRVDLGKEREPVYAVDDVANMLFLRTTAGTLVGYRL* |
| JGI25386J43895_100729623 | 3300002912 | Grasslands Soil | DKDNAQPRSRVDLGKQREPVYAVDDIAGMLFLQTSSGTLAGYKL* |
| JGI25386J43895_101492591 | 3300002912 | Grasslands Soil | LLQIDKDSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTAGTLAGYKL* |
| Ga0066683_109208651 | 3300005172 | Soil | AQPRARVDLGKEREPVYAVDDVANMLFLRTASGTLVGYRL* |
| Ga0066679_104864032 | 3300005176 | Soil | QIDKDTAKSRAQVNLGKENEPAYAVDDIADMLFLQTTPGTLVGYRL* |
| Ga0070703_103239291 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL* |
| Ga0070709_102243893 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DKRTAEPQASINLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL* |
| Ga0070698_10000908212 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KDSGQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL* |
| Ga0070741_103049794 | 3300005529 | Surface Soil | NVLLQIDKSTAQPQARVNLGKENEPAYAVDDIADMLFLQTAPGTLVGYRL* |
| Ga0066697_102149723 | 3300005540 | Soil | RVDLGKEREPVYAVDDVAGMLFLRTASGTLVGYRL* |
| Ga0066695_105081932 | 3300005553 | Soil | NGNVLLQLDKDTTQPRSRVDLGKQREPVYAVDDIAGMLFLQTTSGTLAGYKL* |
| Ga0066692_100054897 | 3300005555 | Soil | RVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0066707_106287941 | 3300005556 | Soil | VDLGKEREPVYAVDDVAGMLFLRTASATLVGYRL* |
| Ga0066707_108167582 | 3300005556 | Soil | QPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL* |
| Ga0066707_108579393 | 3300005556 | Soil | RSRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0066694_101523562 | 3300005574 | Soil | ATAKPKAQVNLGKEKEPAYAVDDIADMLFLQTTPGTLVGYRL* |
| Ga0066694_103332961 | 3300005574 | Soil | RVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL* |
| Ga0068870_102682553 | 3300005840 | Miscanthus Rhizosphere | RARIDLGKDKEPVYAVDDISGMLFLRTGPGTVVGYRL* |
| Ga0066656_109566452 | 3300006034 | Soil | IDKDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL* |
| Ga0070712_1020547512 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TAEPQASINLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL* |
| Ga0079222_104357651 | 3300006755 | Agricultural Soil | DLGKDREPVYAVDDVAGMLFLKTAAGTLTGFRLQ* |
| Ga0066658_107264511 | 3300006794 | Soil | RVDLGREREPVYAVDDVAGMLFLKTAAGTLVGYKL* |
| Ga0066659_117404021 | 3300006797 | Soil | PRARVDLGKEREPVYAVDDIAGMLFLRTASGTLVGYRL* |
| Ga0066660_107243802 | 3300006800 | Soil | VDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0075425_1000967281 | 3300006854 | Populus Rhizosphere | QPRARVDLGKEREPVYAVDDVAGMLFLQTTPGTLVSYRL* |
| Ga0075425_1022327732 | 3300006854 | Populus Rhizosphere | QPRSRVDLGKQREPVYAVDDISGMLFLQTTNGTLVGYRL* |
| Ga0075434_1020569062 | 3300006871 | Populus Rhizosphere | KDSGQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYPL* |
| Ga0075436_1001222983 | 3300006914 | Populus Rhizosphere | DKDSAQPRARVDLGKEREPVYAVDDVAGMLFLQTTPGTLVSYRL* |
| Ga0075435_1002154971 | 3300007076 | Populus Rhizosphere | ARVDLGKEREPVYAVDDVAGMLFLQTTPGTLVSYRL* |
| Ga0075435_1003761183 | 3300007076 | Populus Rhizosphere | PKSRIDLGKDREPVYAVDDVAGMLFLKTAAGTLTAFRL* |
| Ga0075435_1017116791 | 3300007076 | Populus Rhizosphere | NVLLQIDKDNAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTTGTLAGYRL* |
| Ga0099794_101920142 | 3300007265 | Vadose Zone Soil | QLDKDSAQPRARVDLGKEREPVYAVDDVASMLFLRTASGTLVGYRL* |
| Ga0066710_1025964062 | 3300009012 | Grasslands Soil | AQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL |
| Ga0099828_102593611 | 3300009089 | Vadose Zone Soil | TAQPRARVDLGKEREPVYAVDDVASMLFLRTGSGTLVGYRL* |
| Ga0099827_106209983 | 3300009090 | Vadose Zone Soil | AQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL* |
| Ga0099827_107949493 | 3300009090 | Vadose Zone Soil | RARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0066709_1033520211 | 3300009137 | Grasslands Soil | KDTAQPRSRVDLGKQREPVYAVDDISGMLFLQTAAGTLTAYRL* |
| Ga0126311_118199672 | 3300010045 | Serpentine Soil | QIDKVSAQPKGRLDLGKDREPVYAVDDIAGMLFLRTAPGTLVGYRL* |
| Ga0126382_108888251 | 3300010047 | Tropical Forest Soil | LQIDKDSGQPRARVDLGKEREPVYAVDDLAGMLFLRTTAGTLAGYRL* |
| Ga0134070_102014122 | 3300010301 | Grasslands Soil | VDLGKEREPVYAVDDVANMLFLRSATGSLVAYRL* |
| Ga0134064_101767152 | 3300010325 | Grasslands Soil | VDLGKEREPVYAVDDVSNMLFLRTTGGTLVGYRL* |
| Ga0134065_100845571 | 3300010326 | Grasslands Soil | PDGNGNVLLQLDKDTTQPRSRVDLGKQREPVYAVDDISGMLFLQTAAGVLAGYKL* |
| Ga0134111_102853853 | 3300010329 | Grasslands Soil | VDLGKEREPVYAVDDVAGMLFLRTTTGTLVGYRL* |
| Ga0134063_104125431 | 3300010335 | Grasslands Soil | SAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL* |
| Ga0134071_104977732 | 3300010336 | Grasslands Soil | AQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL* |
| Ga0134125_124962521 | 3300010371 | Terrestrial Soil | KDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0134127_103167263 | 3300010399 | Terrestrial Soil | QIDKDSAQPRARVNLGKEREPVYAVDDIAGMLFLQTAAGTLVGYRL* |
| Ga0134127_128052082 | 3300010399 | Terrestrial Soil | KDSGQPRARVDLGKEREPVYAVDDIAGMLFLRTTAGTVVAYRL* |
| Ga0137391_113325572 | 3300011270 | Vadose Zone Soil | RARVDLGKEREPVYAVDDVASMLFLRTGSGTLVGYRL* |
| Ga0137463_11849501 | 3300011444 | Soil | PDGYGNSLRQIDKDSAQQRARVDLGKEREPVYSVYDVAGMLFLQTASGTLVGYRL* |
| Ga0137427_1000110713 | 3300011445 | Soil | EGNGNVLLQIDKDSAQPRARVDLGKEREPVYAVDDIAGMLFLRTTAGTVVAYRL* |
| Ga0137389_108314023 | 3300012096 | Vadose Zone Soil | RVDLGKQREPVYAVDDIAGMLFLQTTAGTLAGYKL* |
| Ga0137388_100336964 | 3300012189 | Vadose Zone Soil | DTAQPRSRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL* |
| Ga0137388_118283972 | 3300012189 | Vadose Zone Soil | SRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0137364_100349311 | 3300012198 | Vadose Zone Soil | DSGQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL* |
| Ga0137364_103245391 | 3300012198 | Vadose Zone Soil | KDSAQPRARVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL* |
| Ga0137364_108556821 | 3300012198 | Vadose Zone Soil | QPRSRVDLGKQREPVYAVDDIAGMLFLQTTSGTLAGYRL* |
| Ga0137364_109754372 | 3300012198 | Vadose Zone Soil | QIDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL* |
| Ga0137383_100258761 | 3300012199 | Vadose Zone Soil | SAQPRARVDLGKEREPVYAVDEVAGMLFLQTVPGTLVGYRL* |
| Ga0137382_104543052 | 3300012200 | Vadose Zone Soil | VELGKEREPVYAVDDIAGMLFLRTTTGTLAGYRL* |
| Ga0137399_100688581 | 3300012203 | Vadose Zone Soil | VDLGKQREPVYAVDDISGMLFLQTTSGTLAGYKL* |
| Ga0137399_101609951 | 3300012203 | Vadose Zone Soil | NGNVLLQIDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTAGTLAGYRL* |
| Ga0137399_117306811 | 3300012203 | Vadose Zone Soil | QPRSRVDLGKQREPVYAVDDISGMLFLQTTAGTLAGYRL* |
| Ga0137374_108395861 | 3300012204 | Vadose Zone Soil | GNGNVLLQIDKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYKL* |
| Ga0137362_107619972 | 3300012205 | Vadose Zone Soil | ARYRRKEREPVYAVDDVAGMLFLQTSPGTLVGYRL* |
| Ga0137362_112585192 | 3300012205 | Vadose Zone Soil | QPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0137380_104013131 | 3300012206 | Vadose Zone Soil | IDKDSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL* |
| Ga0137381_113553653 | 3300012207 | Vadose Zone Soil | GRVDLGKEREPVYAVDDVAGMLFLRTAPTTLVGYRL* |
| Ga0137381_117520651 | 3300012207 | Vadose Zone Soil | PRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL* |
| Ga0137378_100352425 | 3300012210 | Vadose Zone Soil | QIDKDSAQPRSRVDLGKQREPVYAVDDIAGMLFLQTTPGTLAGYRL* |
| Ga0150985_1192253061 | 3300012212 | Avena Fatua Rhizosphere | PRSRVDLGKEREPVYAVDDISGMLFLRTGPGTLAGYRL* |
| Ga0137370_105833521 | 3300012285 | Vadose Zone Soil | QSRARVDLGKEREPVYAVDDVSNMLFLRTMGGTLVGYRL* |
| Ga0137370_108796771 | 3300012285 | Vadose Zone Soil | IDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL* |
| Ga0137387_100510721 | 3300012349 | Vadose Zone Soil | VDLGKEREPVYAVDDVAGMLFLRTASGTLVGYRL* |
| Ga0137387_107536521 | 3300012349 | Vadose Zone Soil | QIDKDNAQPRSRVDLGKQREPVYAVDDIAGMLFLQTSSGTLAGYKL* |
| Ga0137387_111136022 | 3300012349 | Vadose Zone Soil | VDLGKEREPVYAVDDIAGMLFLRTAPGTLVGYRL* |
| Ga0137387_111969732 | 3300012349 | Vadose Zone Soil | VDLGKEREPVYAVDDVANMLFLQTASGTLVGYRL* |
| Ga0137386_106650032 | 3300012351 | Vadose Zone Soil | ARVDLGKDREPVYAVDDVVGMLFLRTAPSTLVGYRL* |
| Ga0137384_114792742 | 3300012357 | Vadose Zone Soil | GQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLIGYRL* |
| Ga0137375_100210691 | 3300012360 | Vadose Zone Soil | QPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYKL* |
| Ga0134051_11445022 | 3300012398 | Grasslands Soil | DKDNAQPRGRVDLGKEREPVYAVDDIAGMLFLRTAPGTLAGYRL* |
| Ga0137373_1001437810 | 3300012532 | Vadose Zone Soil | SRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0137398_100027611 | 3300012683 | Vadose Zone Soil | GQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL* |
| Ga0137397_100994181 | 3300012685 | Vadose Zone Soil | DKDSAQPRSRVDLGKQREPVYAVDDISGMLFLQTTAGTLAGYRL* |
| Ga0137394_111119311 | 3300012922 | Vadose Zone Soil | VDLGKEREPVYAVDDVAGMLFLRTAPGTLVCYRL* |
| Ga0137419_110529911 | 3300012925 | Vadose Zone Soil | SAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0137404_101141944 | 3300012929 | Vadose Zone Soil | DKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0137404_117351722 | 3300012929 | Vadose Zone Soil | QLDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0137407_100275321 | 3300012930 | Vadose Zone Soil | DSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0153915_130158322 | 3300012931 | Freshwater Wetlands | RARVDLGKEREPVYAVDDVAGMLFLRTAPGTLIGYRL* |
| Ga0162653_1000401492 | 3300012937 | Soil | LQVDKVSAEPRARIDLGNDKEPVYAVDDISGMLFLRTGPGTVVGYRL* |
| Ga0134077_100459644 | 3300012972 | Grasslands Soil | DSAQPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLFGYRL* |
| Ga0134077_102217742 | 3300012972 | Grasslands Soil | KDSGQPRSRVDLGKEREPVYAVDDVANMLFLRTASGTLVGYRL* |
| Ga0134077_103430872 | 3300012972 | Grasslands Soil | RSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL* |
| Ga0134076_101275251 | 3300012976 | Grasslands Soil | ARVDLGKEREPVYAVDDVAGMLFLRTASGTLVGYRL* |
| Ga0134078_105275411 | 3300014157 | Grasslands Soil | PRSRVDLGKEREPVYAVDDVANMLFLRSASGSLVAYRL* |
| Ga0134079_100156874 | 3300014166 | Grasslands Soil | RVDLGKEREPVYAVDDVAGMLFLRTAPRTLVGYRL* |
| Ga0137403_101510851 | 3300015264 | Vadose Zone Soil | PRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL* |
| Ga0134089_105727002 | 3300015358 | Grasslands Soil | LLQIDKDSAQPRARVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYRL* |
| Ga0134069_12234161 | 3300017654 | Grasslands Soil | QPRSRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL |
| Ga0134112_103544452 | 3300017656 | Grasslands Soil | SRVDLGKEREPVYAVDDVANMLFLRTATGTLVGYRL |
| Ga0184632_101587271 | 3300018075 | Groundwater Sediment | SRVDLGKQREPVYAVDDISGMLFLQTTPGTLAGYKLQND |
| Ga0066669_115548051 | 3300018482 | Grasslands Soil | QPRARVDLGKEREPVYAVDDIAGMLFLRTAPGTLVGYRL |
| Ga0184646_13766833 | 3300019259 | Groundwater Sediment | LLQIDKDSAQPRARVDLGKAREPVYAVDDIAGMLFLQTAAGTLVGYRL |
| Ga0137408_11231867 | 3300019789 | Vadose Zone Soil | QLDKDSAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL |
| Ga0210407_112489051 | 3300020579 | Soil | LAQVNLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL |
| Ga0210378_101308063 | 3300021073 | Groundwater Sediment | LQIDKGSIQPLARVDLGKEREPVYAVDDIAGMLFLRTAPGTLVGYRL |
| Ga0247665_10045131 | 3300024219 | Soil | KESAQARSRVDLGKEREPVYAVDDVAGMLFLRTVPGTLVGYRL |
| Ga0207653_100603513 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | SAQPRSRVDLGKEREPVYAVDDVANMLFLRTAAGTLVGYRL |
| Ga0207700_115188511 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | QVNLGKENEPAYAVDDIADMLFLQTTPGTLVGYRL |
| Ga0207648_107586872 | 3300026089 | Miscanthus Rhizosphere | QARSRIELGKEKEPVYAVDDIAGMLFLRAAPGTLVGYKL |
| Ga0209235_11345612 | 3300026296 | Grasslands Soil | PRSRVDLGKEREPVYAVDDVAGMLLLRTTAGTLVGYRL |
| Ga0209235_11810133 | 3300026296 | Grasslands Soil | GQPRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL |
| Ga0209236_10276101 | 3300026298 | Grasslands Soil | SRVDLGKQREPVYAVDDISGMLFLQTTPGTLTGYRL |
| Ga0209238_11754302 | 3300026301 | Grasslands Soil | ARPRARVDLGKEREPVYAVDDVAGMLFLRTTPGTLVGYRL |
| Ga0209471_13317561 | 3300026318 | Soil | ARVELGKEREPVYAVDDVAGMLFLQTAPSTLVGYRL |
| Ga0209152_103753842 | 3300026325 | Soil | RVDLGREREPVYAVDDVAGMLFLKTAAGTLVGYKL |
| Ga0209803_12797581 | 3300026332 | Soil | QARSRVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL |
| Ga0209160_10496201 | 3300026532 | Soil | RVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL |
| Ga0209161_103561451 | 3300026548 | Soil | DSGQPRARVDLGKEREPVYAVDDVSGMLFLRTTPGTLVGYRL |
| Ga0209474_100248145 | 3300026550 | Soil | PRARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL |
| Ga0209073_105040171 | 3300027765 | Agricultural Soil | PRSRVDLGKEREPVYAVDDVAGMLFLRTATATLVGYRL |
| Ga0209590_102494131 | 3300027882 | Vadose Zone Soil | ARVDLGKEREPVYAVDDVAGMLFLRTAPGTLVGYRL |
| Ga0209382_102439141 | 3300027909 | Populus Rhizosphere | KDSAQPRAQVNLGKEREPVYAVDDIAGMLFLQTASGTLVGYRL |
| Ga0137415_105082861 | 3300028536 | Vadose Zone Soil | DTGRRRQRPSQIDKDSAQPRARVDLGKEREPVYAVDDIAAMLFLRTASGTLVGYRL |
| Ga0307287_101395623 | 3300028796 | Soil | TTQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL |
| Ga0307302_105998272 | 3300028814 | Soil | QIDKDTGQPRSRVDLGKQREPVYAVDDISGMLFLQTTSGTLAGYRL |
| Ga0307277_104686472 | 3300028881 | Soil | RSRVDLGKQREPVYAVDDISGMLFLQTSPGTLAGYRL |
| Ga0326597_103003995 | 3300031965 | Soil | PRSRVDLGKEREPVYAVDDVARMLFLQTAAGTLVGYRL |
| Ga0307472_1018407692 | 3300032205 | Hardwood Forest Soil | KSTAQPRAQVNLGKEKEPAYAVDDIADMLFLQTAPGTLVGYRL |
| ⦗Top⦘ |