NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060167

Metagenome / Metatranscriptome Family F060167

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060167
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 43 residues
Representative Sequence MPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSIS
Number of Associated Samples 120
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 51.88 %
% of genes near scaffold ends (potentially truncated) 96.24 %
% of genes from short scaffolds (< 2000 bps) 94.74 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.985 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.278 % of family members)
Environment Ontology (ENVO) Unclassified
(21.053 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.624 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.54%    β-sheet: 11.27%    Coil/Unstructured: 66.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF01523PmbA_TldD 61.65
PF00202Aminotran_3 0.75
PF04471Mrr_cat 0.75
PF02569Pantoate_ligase 0.75
PF05016ParE_toxin 0.75
PF02548Pantoate_transf 0.75
PF04072LCM 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 61.65
COG0413Ketopantoate hydroxymethyltransferaseCoenzyme transport and metabolism [H] 0.75
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.75
COG3315O-Methyltransferase involved in polyketide biosynthesisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.98 %
UnclassifiedrootN/A6.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003218|JGI26339J46600_10149920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis543Open in IMG/M
3300003219|JGI26341J46601_10106074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae815Open in IMG/M
3300003368|JGI26340J50214_10040178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1339Open in IMG/M
3300004092|Ga0062389_102237835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae720Open in IMG/M
3300004092|Ga0062389_104291450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae536Open in IMG/M
3300004152|Ga0062386_101869198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae501Open in IMG/M
3300005166|Ga0066674_10493554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola552Open in IMG/M
3300005178|Ga0066688_10852892Not Available565Open in IMG/M
3300005435|Ga0070714_101526039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae653Open in IMG/M
3300005538|Ga0070731_10441103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae866Open in IMG/M
3300005541|Ga0070733_10945168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae579Open in IMG/M
3300005557|Ga0066704_10966187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae526Open in IMG/M
3300005568|Ga0066703_10772972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae550Open in IMG/M
3300005591|Ga0070761_10148329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1373Open in IMG/M
3300005598|Ga0066706_11171815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae585Open in IMG/M
3300005602|Ga0070762_10123043All Organisms → cellular organisms → Bacteria → Acidobacteria1526Open in IMG/M
3300005610|Ga0070763_10812321All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005610|Ga0070763_10963351All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae510Open in IMG/M
3300005712|Ga0070764_10783428All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005764|Ga0066903_102054875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1099Open in IMG/M
3300005995|Ga0066790_10081424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1393Open in IMG/M
3300006028|Ga0070717_10119560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2256Open in IMG/M
3300006028|Ga0070717_10697396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae922Open in IMG/M
3300006176|Ga0070765_100255988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1606Open in IMG/M
3300006176|Ga0070765_100655532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae991Open in IMG/M
3300006794|Ga0066658_10726182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae551Open in IMG/M
3300006854|Ga0075425_101252080All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300006893|Ga0073928_10187365All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300009038|Ga0099829_11078725All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300009088|Ga0099830_10467210All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300009518|Ga0116128_1104319All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300009552|Ga0116138_1191530All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300009624|Ga0116105_1231129All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300009628|Ga0116125_1087279All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300009628|Ga0116125_1147225All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300009640|Ga0116126_1072408All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300010335|Ga0134063_10328340Not Available740Open in IMG/M
3300010359|Ga0126376_11270981All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300011269|Ga0137392_10728771All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300011270|Ga0137391_10593554All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300011411|Ga0153933_1032197All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300012202|Ga0137363_11483021All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012203|Ga0137399_11136856All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300012211|Ga0137377_10222311All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300012356|Ga0137371_10616627All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300012362|Ga0137361_10215975All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300012924|Ga0137413_11691225All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012944|Ga0137410_10737856All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300012944|Ga0137410_11884582All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014495|Ga0182015_10089204All Organisms → cellular organisms → Bacteria2155Open in IMG/M
3300014501|Ga0182024_11848156All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300014657|Ga0181522_10178699All Organisms → cellular organisms → Bacteria1245Open in IMG/M
3300014658|Ga0181519_10923953All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300015371|Ga0132258_13113410All Organisms → cellular organisms → Bacteria → Acidobacteria1146Open in IMG/M
3300017924|Ga0187820_1184396All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300017927|Ga0187824_10346988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300017940|Ga0187853_10223265All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300017942|Ga0187808_10433126All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300018006|Ga0187804_10237356All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300018017|Ga0187872_10502351All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300018024|Ga0187881_10227350All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300018026|Ga0187857_10495957All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018027|Ga0184605_10148982All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300018060|Ga0187765_10495765All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300018062|Ga0187784_10116729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2176Open in IMG/M
3300018088|Ga0187771_10798011All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300018090|Ga0187770_10453989All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300018090|Ga0187770_10856760Not Available728Open in IMG/M
3300018090|Ga0187770_11056484All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018090|Ga0187770_11321089All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300018431|Ga0066655_11369614All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300018468|Ga0066662_12087444Not Available594Open in IMG/M
3300018482|Ga0066669_12140648All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae529Open in IMG/M
3300018482|Ga0066669_12462527All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300020580|Ga0210403_10802246All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300020581|Ga0210399_11357251All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300020582|Ga0210395_10045006All Organisms → cellular organisms → Bacteria → Acidobacteria3230Open in IMG/M
3300021180|Ga0210396_11728995All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300021402|Ga0210385_11471835All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300021406|Ga0210386_10713158All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300021474|Ga0210390_10070189All Organisms → cellular organisms → Bacteria → Acidobacteria2896Open in IMG/M
3300021478|Ga0210402_10108113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2504Open in IMG/M
3300022557|Ga0212123_10701552All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300023019|Ga0224560_101784All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300025320|Ga0209171_10521872All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300025412|Ga0208194_1015881All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300025434|Ga0208690_1050468All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300025460|Ga0208562_1081049All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300025500|Ga0208686_1053774All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300025854|Ga0209176_10135534All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300025905|Ga0207685_10206699All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300025912|Ga0207707_10496075All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300026305|Ga0209688_1003738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2680Open in IMG/M
3300026310|Ga0209239_1205501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300026326|Ga0209801_1217713Not Available750Open in IMG/M
3300026528|Ga0209378_1214504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300026537|Ga0209157_1061783All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300026557|Ga0179587_10343413All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300027591|Ga0209733_1049993All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300027643|Ga0209076_1193118All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300027681|Ga0208991_1024706All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300027738|Ga0208989_10093434All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300027812|Ga0209656_10087589All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300027855|Ga0209693_10487008All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300027862|Ga0209701_10617833All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300027869|Ga0209579_10282193All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300027879|Ga0209169_10475636All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300027889|Ga0209380_10267151All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300027894|Ga0209068_10278613All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300028780|Ga0302225_10174287All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300028780|Ga0302225_10208555All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300028800|Ga0265338_10312816All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300029636|Ga0222749_10191154All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300029907|Ga0311329_11051669All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300029986|Ga0302188_10184547All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300030007|Ga0311338_10266793All Organisms → cellular organisms → Bacteria1913Open in IMG/M
3300030057|Ga0302176_10066676All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300030943|Ga0311366_10824769All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300031231|Ga0170824_116773608All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300031234|Ga0302325_10739566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1405Open in IMG/M
3300031524|Ga0302320_10890473Not Available966Open in IMG/M
3300031715|Ga0307476_10532596Not Available870Open in IMG/M
3300031718|Ga0307474_10435750All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300031718|Ga0307474_10540274All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300031754|Ga0307475_11485885All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031962|Ga0307479_10508243All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300031962|Ga0307479_11031609All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300032770|Ga0335085_10448696Not Available1485Open in IMG/M
3300032805|Ga0335078_11510984All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300032828|Ga0335080_11032129All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300033405|Ga0326727_11097811All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300033807|Ga0314866_038690All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300034199|Ga0370514_133388All Organisms → cellular organisms → Bacteria639Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.28%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.26%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.76%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.01%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.01%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.26%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.26%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.26%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.26%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.75%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.75%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.75%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.75%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.75%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011411Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaGHost-AssociatedOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023019Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26339J46600_1014992013300003218Bog Forest SoilMWTIPVVTAEALTRALEEFLAGAAGAVVLEDGAVTFDLERAKYSISGE
JGI26341J46601_1010607413300003219Bog Forest SoilMTPQILTRTVQDFLSEAAGAVVLENGIVAFDLAQSKYSIS
JGI26340J50214_1004017813300003368Bog Forest SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLSRSKYSISG
Ga0062389_10223783523300004092Bog Forest SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYN
Ga0062389_10429145023300004092Bog Forest SoilMTPEALTRVVQEFLGEASGATVLEDGAVTFDLARAKYSVSGE
Ga0062386_10186919823300004152Bog Forest SoilMTPEMLTRTLQEFLAEASGAIVLEDGAIAFDLSRAKYSISGEHNKCLLH
Ga0066674_1049355413300005166SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISGER
Ga0066688_1085289213300005178SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSIS
Ga0070714_10152603933300005435Agricultural SoilMLSRTVADFLSEAAGAVVLEDGAVAFDLGQAKYSISGEHNK
Ga0070731_1044110313300005538Surface SoilMTPESLTQTVQDFLSEASGAVVLEDGAVVFDLAQSKYS
Ga0070733_1094516823300005541Surface SoilMWTIPLMTPDTLTRTVQDFLSEAAGAVVLENGAVAFDLSQSKYSISGEY
Ga0066704_1096618713300005557SoilVNPETLVRTVEDFLVGSRDAVVMEDGAVAFDLAQSKYSI
Ga0066703_1077297223300005568SoilVNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSKYSISGERNKCVL
Ga0070761_1014832913300005591SoilVDNSLVTPDALTRTLQDFLSGASGAVVLEDGAVAFDLCESKYSISGD
Ga0066706_1117181513300005598SoilVSPETLVRTVEDFLVGSRNAVVMEDGAVAFDLAQSKYSISGER
Ga0070762_1012304323300005602SoilVWTMQVDLPMPTMTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAKSKY*
Ga0070763_1081232113300005610SoilMQVDLPMPTMTPQALTRTVQDFLSEAAGAVVLENGAVAFDLA
Ga0070763_1096335113300005610SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNR
Ga0070764_1078342813300005712SoilMATPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQS
Ga0066903_10205487513300005764Tropical Forest SoilMDVNNSVMTPESPTQTVQDFLSDATGAVVPEDGAVTFDLAQAKYSTSG
Ga0066790_1008142413300005995SoilMWTIALVTPDTLTRTVQDYLSEASGAVVLENGAVAFDLGQSKYSISGE
Ga0070717_1011956013300006028Corn, Switchgrass And Miscanthus RhizosphereMARVTPELLTRTVQDYLKEASGAVVLENGSVAFDLGRA
Ga0070717_1069739613300006028Corn, Switchgrass And Miscanthus RhizosphereMMSPESLTRTVQDFLSEASGAVVLENGAVMFDLAQSKYSISGE
Ga0070765_10025598843300006176SoilMNVEALTATLRDYLADASGAVVLEDGAVTFDLERAKYSVSGERDKCL
Ga0070765_10065553223300006176SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYAI
Ga0066658_1072618213300006794SoilVTPDALIHIVEGFLAGSRDAVVIEDGAVTFDLAQAKYAISGEHNKCLVHL
Ga0075425_10125208023300006854Populus RhizosphereVNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSHLWSSER
Ga0073928_1018736513300006893Iron-Sulfur Acid SpringMPTVTPQALARTVQDFLSEAAGAVVLENGAVAFDLAQSKY
Ga0099829_1107872523300009038Vadose Zone SoilMWTIPFVTPDALTRTVQDFLSEASGAVVLENGAVAFDL
Ga0099830_1046721023300009088Vadose Zone SoilMWTIPCVTPDALTRTVQDFLSEASGAVVLENGAVAFDLS
Ga0116128_110431913300009518PeatlandMVNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE*
Ga0116138_119153013300009552PeatlandTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE*
Ga0116105_123112913300009624PeatlandTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE*
Ga0116125_108727923300009628PeatlandMVTPALTRTVQDFLREAAGAVVLENGAVAFDLAPSKYSISGE*
Ga0116125_114722523300009628PeatlandQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE*
Ga0116126_107240813300009640PeatlandMPMLTPQALTRTVQEFLSEAAGAVVLENGAVAFDLAQSKYSISGEHN
Ga0134063_1032834013300010335Grasslands SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAK
Ga0126376_1127098123300010359Tropical Forest SoilMTPEALVRTVEGFLSGARDAVVLEDGAVAFDLAQAKYS
Ga0137392_1072877123300011269Vadose Zone SoilMTSESLVRTLEDFLAGSRDAVVLEEGAVAFDLAWAKYSISGERGKC
Ga0137391_1059355413300011270Vadose Zone SoilMPTVTPQALTRTVQDFLNEAAGAVVLENGAVAFDLAQSKY
Ga0153933_103219723300011411Attine Ant Fungus GardensMPLVTPQALTQTVQDFLCEASGAVVLENGAVAFDLAQAKYSISGEYNR
Ga0137363_1148302123300012202Vadose Zone SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYS
Ga0137399_1113685623300012203Vadose Zone SoilMAAMTPDALTRTVQDFLSEAAGAVVLEDGAVAFDLG
Ga0137377_1022231113300012211Vadose Zone SoilMDNSIVTPDSLIRIVQDFLSEAAGAVVLEDGAVSFDLGQAKYSISGDHNTCL
Ga0137371_1061662723300012356Vadose Zone SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYS
Ga0137361_1021597523300012362Vadose Zone SoilVNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSKYSISGERN
Ga0137413_1169122513300012924Vadose Zone SoilMPTVTPQTLTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNR
Ga0137410_1073785623300012944Vadose Zone SoilMPTVTPEALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYS
Ga0137410_1188458213300012944Vadose Zone SoilMTPELLTRTVQDFLSDASGAVVLEEGAVTFDLGQAKYSISGECNKCL
Ga0182015_1008920413300014495PalsaVTPESLTRTVQDFLNEAVGAVVLEDGAVAFDLAQARYS
Ga0182024_1184815623300014501PermafrostMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQS
Ga0181522_1017869913300014657BogMTPETLGRTVADFLADAAGAVVLEDGALAFDLAQARYS
Ga0181519_1092395323300014658BogMLTPQALTQTVQEFLSDASSAVVLENGAVAFDLAQS
Ga0132258_1311341043300015371Arabidopsis RhizosphereMNSELLARTLEEFLSDASGAVVIEDGAVTFDLAQAKYSISGEHNK*
Ga0187820_118439613300017924Freshwater SedimentMTPEALSHTVQEFLSEASGAIVLEVGAVAFDLERAKHSISGEYNKCLLHL
Ga0187824_1034698813300017927Freshwater SedimentVTPDALTRTVQEFLSEASGAVVLEDGAVAFDLGQAKYSISGDYNKCLL
Ga0187853_1022326523300017940PeatlandMVNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE
Ga0187808_1043312613300017942Freshwater SedimentMTPEMLSRTIADFLAEACGAVVLEDGAVAFDLAQAKYS
Ga0187804_1023735613300018006Freshwater SedimentMTPEALTNTLQDFLAEASGAVVLEDGAVAFDLGQAKYSISGE
Ga0187872_1050235113300018017PeatlandNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE
Ga0187881_1022735033300018024PeatlandALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE
Ga0187857_1049595723300018026PeatlandMPTVTPQALTRTVQDFLSQAAGAVVLENGAVAFDLAQSKYS
Ga0184605_1014898213300018027Groundwater SedimentVNPETLVRTVKDFLVGARNAVVMEDGAVAFDLAQSKYSISG
Ga0187765_1049576513300018060Tropical PeatlandMSPETLARTLEEFLSEASGAVVLEDGAVTFDLAQAKY
Ga0187784_1011672933300018062Tropical PeatlandMWRIPVVTPDALARTLQDFLADASGAVVLENGAVAFDLERAKYSISGEY
Ga0187771_1079801113300018088Tropical PeatlandMTAETLTRTLQDFLAEASGAVVLEDGAVAFDLERAKYSISGEYNK
Ga0187770_1045398913300018090Tropical PeatlandMTAETLTRTLQEFLAEASGAVVLEDGAVAFDLERAKYSI
Ga0187770_1085676023300018090Tropical PeatlandMLSMTPESLARTVQGFLSEASGAVVLEDGAVTFDLERS
Ga0187770_1105648423300018090Tropical PeatlandMSTIPGVTPEALTRTLQDFLAEASGAVVLEDGAVSFDLERA
Ga0187770_1132108913300018090Tropical PeatlandMPTLTPQALTRTVQDFLSEAATAVVLENGAVAFDLAQSK
Ga0066655_1136961413300018431Grasslands SoilVHNSPVTPESLTRTVQDFLAEASGALVLEDGAVSFDLARAKYSISGEYNKCLL
Ga0066662_1208744413300018468Grasslands SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISG
Ga0066669_1214064823300018482Grasslands SoilMTPEALVRTVDDFLCGARDAVVLDDGAVVFDLAQAKYSISGERNKCLLH
Ga0066669_1246252713300018482Grasslands SoilMPTVTPEALTRTVHDFLNQAAGAIVLENGAVAFDLTQSKFSISGEYNRCLLHL
Ga0210403_1080224623300020580SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSIS
Ga0210399_1135725113300020581SoilMPTVTPQALTRTVQDFLNEAAGAVVLENGAVAFDLAQSKYSISGEYNR
Ga0210395_1004500643300020582SoilMRTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNRCLL
Ga0210396_1172899513300021180SoilMPMVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKY
Ga0210385_1147183523300021402SoilMPMVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNR
Ga0210386_1071315813300021406SoilMQTVNPQALTRTVQEFLSEAAGALVLENGAVAFDLAQSKYSISG
Ga0210390_1007018913300021474SoilMRTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSI
Ga0210402_1010811313300021478SoilMPTVTPQALTRTVQDFLSEAAGAIVLENGAVAFDLAQSKYSI
Ga0212123_1070155213300022557Iron-Sulfur Acid SpringMPTVTSQALTRTVQDFLSEATGAVVLENGAVAFDLAQSKYSISGEYNR
Ga0224560_10178413300023019SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSISGEYNRCLL
Ga0209171_1052187213300025320Iron-Sulfur Acid SpringMPTVTSQALTRTVQDFLSEATGAVVLENGAVAFDL
Ga0208194_101588113300025412PeatlandMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSIS
Ga0208690_105046823300025434PeatlandQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE
Ga0208562_108104923300025460PeatlandRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE
Ga0208686_105377423300025500PeatlandRHSGMVNGQWSMANAGDTPQALTRTLQDFLSQAAGASVLENGAVAFDLAQSKYSISGE
Ga0209176_1013553413300025854Arctic Peat SoilVTPDALTRTVQDFLSEAAGAVVLEDGAVAFDLGRSKYSISGEYN
Ga0207685_1020669923300025905Corn, Switchgrass And Miscanthus RhizosphereVTPDSLTRTVQDFLSEAAGAVVLENGAVAFDLSEAKYSISGEYEKCLL
Ga0207707_1049607513300025912Corn RhizosphereMRLPDVHNSPVTPETLTRTVQDFLAEASGALVFEDGAVSFDLARAKYSISGE
Ga0209688_100373813300026305SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQA
Ga0209239_120550113300026310Grasslands SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISGERNKCL
Ga0209801_121771313300026326SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKY
Ga0209378_121450413300026528SoilMTPDALVRTVEEFLSQAHDAVVLEDGAVAFDLAQAKYSISGE
Ga0209157_106178313300026537SoilMKPEALVRTVEDFLVSASDAVVMEEGVIAFDLANAKYYL
Ga0179587_1034341323300026557Vadose Zone SoilMPSVTSETLTRTVQDFLSEAAGAVVLENGAVTFDLTQS
Ga0209733_104999323300027591Forest SoilMPTVTPHALTRTVQDFLSGAAGAMVLENGAVAFDLAQSKYSISG
Ga0209076_119311813300027643Vadose Zone SoilVNPETLVRTVEDFLVGARNAVVMEDGAVAFDLAQSKYSISGERNK
Ga0208991_102470623300027681Forest SoilMPRVTPEALTRTVQDYLNQASGAVVLEDGSVAFDLGRAKYSIS
Ga0208989_1009343423300027738Forest SoilVTPEALTRTVQDYLNQASGAVVLEGGSVAFDLGRAKYSISGEH
Ga0209656_1008758913300027812Bog Forest SoilMPVTPQVLTRTLQDFLSEAAGAVVLENGAVAFDLAQSKY
Ga0209693_1048700813300027855SoilMQVDLPMPTMTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSK
Ga0209701_1061783323300027862Vadose Zone SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGTVAFDLA
Ga0209579_1028219323300027869Surface SoilMTPESLTQTVQDFLSEASGAVVLEDGAVVFDLAQSKYSISGEHN
Ga0209169_1047563623300027879SoilMTPDLLTRTVQDFLSDASGAVVLEDGAVAFDLGQAKY
Ga0209380_1026715113300027889SoilMQTVNPQALTRTVQEFLSEAAGALVLENGAVAFDLAQSKYSIS
Ga0209068_1027861323300027894WatershedsMTPEALVRSVQDFLSACCDAVVLEDGASVFDLAQSKYSISG
Ga0302225_1017428723300028780PalsaMPTVTPQALTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYSI
Ga0302225_1020855513300028780PalsaMTPDALTRAVQDFLGEAVGAVVLEDGAVTFDLARAKKK
Ga0265338_1031281613300028800RhizosphereVNNSHVTPDALTRTVQDFLSEASGAVVLENGALDFDLAQSKYSISGEYNKC
Ga0222749_1019115423300029636SoilMPTVTPQALIRTVHDFLSEAAGAVVLENGSVAFDL
Ga0311329_1105166913300029907BogMCGDGSMTTVTPQALTRTVQDFLSQAAGAVVLENGAVAFDLAQC
Ga0302188_1018454713300029986BogVSSVTPQALTQTVQDFLSESAGAVVLENGCVAFDLAQSKYSISGEYNRCL
Ga0311338_1026679323300030007PalsaMVTPQALTRTVQDFLSEAAGAVVLENGSVAFDLAQSK
Ga0302176_1006667623300030057PalsaMNPELLTRTVRDFLSEAAGAVVLEDGAVAFDLARSKYSISGEQNKCL
Ga0311366_1082476923300030943FenMTPESLRRTVSDFLAESRAAVVIEDGAAVFDLTEAKYSISGEYNKCLLQ
Ga0170824_11677360833300031231Forest SoilMPTVSPQILTRTVQDFLSEAAGAIVLENGAVAFDLA
Ga0302325_1073956623300031234PalsaMPTVTPQSLTRTVQDFLSEAAGAVVLENGAVAFDLAQSKYS
Ga0302320_1089047323300031524BogMVTPALTRTVQDFLREAAGAVVLENGAVAFDLAPSKYSISGE
Ga0307476_1053259623300031715Hardwood Forest SoilMMTPERLTRTLQDFLSEAAGAVVLEDGAVAFDLERAKYSI
Ga0307474_1043575023300031718Hardwood Forest SoilMWTIPSVTPDLLTRTVQEFLSEASGAVVLEDGAVA
Ga0307474_1054027413300031718Hardwood Forest SoilMPTVTPQALTRTVQDFLSEAAGAVVLENGSVAFDLAESKYSISGEYNR
Ga0307475_1148588523300031754Hardwood Forest SoilMQTVNPQALTRTVQEFLSEAAGALVLENGAVAFDLAQSKYSI
Ga0307479_1050824313300031962Hardwood Forest SoilMAIRDNWSMNAETLTHTLEEFLSDASGAVVIEDGAVMFDLAQAKYSISGEHN
Ga0307479_1103160923300031962Hardwood Forest SoilMWTIPLMTSDTLTRTVQDFLSEAAGAVVLENGAVA
Ga0335085_1044869623300032770SoilMTPESLSRELEGFLAGARGAVVLEAGAVLFDLAHAKYSISGE
Ga0335078_1151098423300032805SoilMWTILSVTPEALSHTVQEFLSEASGAVVLENGAVAFDLERAK
Ga0335080_1103212913300032828SoilVNPDALTRTLQEFLAEASGAVVLEDGAVAFDLARAKYSIS
Ga0326727_1109781113300033405Peat SoilMNPEHLTRTLQDFLGDATGAVVLEDGVVAFDLAQAKYSISGERNKC
Ga0314866_038690_1_1323300033807PeatlandMTPEALTRTLQQFLSEASGAVVLEDGAVTFDLVQARYSISGEYD
Ga0370514_133388_528_6383300034199Untreated Peat SoilMPMATPQSLTRTVQDFLSEAATAVVLEDGMVAFDLAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.