NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060138

Metagenome / Metatranscriptome Family F060138

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060138
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 42 residues
Representative Sequence MRTLIAVLIGALIATGAAVVLVHNATMTRQAPARVLYNDGSG
Number of Associated Samples 120
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.47 %
% of genes near scaffold ends (potentially truncated) 25.56 %
% of genes from short scaffolds (< 2000 bps) 87.97 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.932 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.301 % of family members)
Environment Ontology (ENVO) Unclassified
(22.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.609 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.71%    β-sheet: 0.00%    Coil/Unstructured: 44.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF13561adh_short_C2 57.14
PF00106adh_short 3.01
PF00067p450 2.26
PF00135COesterase 1.50
PF11271PorA 1.50
PF08241Methyltransf_11 0.75
PF00425Chorismate_bind 0.75
PF00440TetR_N 0.75
PF13386DsbD_2 0.75
PF00903Glyoxalase 0.75
PF11847DUF3367 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 2.26
COG2272Carboxylesterase type BLipid transport and metabolism [I] 1.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.93 %
UnclassifiedrootN/A27.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105555689All Organisms → cellular organisms → Bacteria → Terrabacteria group1223Open in IMG/M
3300004092|Ga0062389_101449546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300005167|Ga0066672_10101080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1759Open in IMG/M
3300005184|Ga0066671_10648581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae685Open in IMG/M
3300005434|Ga0070709_11482022Not Available551Open in IMG/M
3300005435|Ga0070714_100146468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2125Open in IMG/M
3300005436|Ga0070713_102421922Not Available507Open in IMG/M
3300005437|Ga0070710_10106295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1679Open in IMG/M
3300005439|Ga0070711_100617494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae906Open in IMG/M
3300005450|Ga0066682_10433982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium837Open in IMG/M
3300005451|Ga0066681_10079931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura oligospora1842Open in IMG/M
3300005454|Ga0066687_10341651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium856Open in IMG/M
3300005471|Ga0070698_100023220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales6483Open in IMG/M
3300005553|Ga0066695_10418155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium829Open in IMG/M
3300005556|Ga0066707_10188032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1327Open in IMG/M
3300005587|Ga0066654_10253351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae929Open in IMG/M
3300005598|Ga0066706_11134030All Organisms → cellular organisms → Bacteria → Terrabacteria group596Open in IMG/M
3300005602|Ga0070762_10105244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1639Open in IMG/M
3300005610|Ga0070763_10885132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura531Open in IMG/M
3300005764|Ga0066903_104027459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura788Open in IMG/M
3300006028|Ga0070717_10020027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5256Open in IMG/M
3300006031|Ga0066651_10141407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1254Open in IMG/M
3300006032|Ga0066696_10314844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1018Open in IMG/M
3300006034|Ga0066656_10239790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1163Open in IMG/M
3300006046|Ga0066652_101366450Not Available665Open in IMG/M
3300006176|Ga0070765_102064240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales533Open in IMG/M
3300006755|Ga0079222_10602605Not Available839Open in IMG/M
3300006804|Ga0079221_10094647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura oligospora1453Open in IMG/M
3300006806|Ga0079220_11300117All Organisms → cellular organisms → Bacteria → Terrabacteria group609Open in IMG/M
3300006854|Ga0075425_102513015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300006904|Ga0075424_101139460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura oligospora831Open in IMG/M
3300009038|Ga0099829_10955769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura711Open in IMG/M
3300009090|Ga0099827_10004378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae8281Open in IMG/M
3300009137|Ga0066709_103452288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300010396|Ga0134126_10272701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1995Open in IMG/M
3300010396|Ga0134126_12041317Not Available627Open in IMG/M
3300010396|Ga0134126_12511894Not Available560Open in IMG/M
3300010866|Ga0126344_1168501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1570Open in IMG/M
3300010877|Ga0126356_11084828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura769Open in IMG/M
3300011270|Ga0137391_10894440Not Available727Open in IMG/M
3300012096|Ga0137389_10190661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1702Open in IMG/M
3300012198|Ga0137364_10228352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1371Open in IMG/M
3300012200|Ga0137382_10138280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1642Open in IMG/M
3300012202|Ga0137363_10347931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1226Open in IMG/M
3300012205|Ga0137362_10736654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium846Open in IMG/M
3300012208|Ga0137376_10278527All Organisms → cellular organisms → Bacteria → Terrabacteria group1451Open in IMG/M
3300012356|Ga0137371_10198786Not Available1570Open in IMG/M
3300012517|Ga0157354_1045144All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300012924|Ga0137413_10217531Not Available1294Open in IMG/M
3300012929|Ga0137404_10282790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1434Open in IMG/M
3300012944|Ga0137410_10590127Not Available917Open in IMG/M
3300014150|Ga0134081_10331833Not Available554Open in IMG/M
3300014166|Ga0134079_10223809Not Available801Open in IMG/M
3300015372|Ga0132256_103472343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae530Open in IMG/M
3300016270|Ga0182036_10422237Not Available1043Open in IMG/M
3300016341|Ga0182035_10447638Not Available1094Open in IMG/M
3300016445|Ga0182038_11579083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300017936|Ga0187821_10345276Not Available599Open in IMG/M
3300017937|Ga0187809_10068743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1158Open in IMG/M
3300017937|Ga0187809_10266291Not Available624Open in IMG/M
3300017973|Ga0187780_10266693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1201Open in IMG/M
3300017974|Ga0187777_10499257Not Available850Open in IMG/M
3300017974|Ga0187777_11011828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae601Open in IMG/M
3300017993|Ga0187823_10079364Not Available950Open in IMG/M
3300018058|Ga0187766_10768649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300018060|Ga0187765_10461066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300018060|Ga0187765_10549197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae738Open in IMG/M
3300018431|Ga0066655_10381871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300018433|Ga0066667_10148403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1650Open in IMG/M
3300018482|Ga0066669_10071258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2297Open in IMG/M
3300020140|Ga0179590_1170804Not Available596Open in IMG/M
3300020170|Ga0179594_10076762Not Available1172Open in IMG/M
3300020582|Ga0210395_10263483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1296Open in IMG/M
3300020583|Ga0210401_11639368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae501Open in IMG/M
3300021086|Ga0179596_10303061Not Available797Open in IMG/M
3300021181|Ga0210388_10563954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae997Open in IMG/M
3300021374|Ga0213881_10030131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium2270Open in IMG/M
3300021374|Ga0213881_10532396Not Available533Open in IMG/M
3300021401|Ga0210393_11160150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300021407|Ga0210383_11016484All Organisms → cellular organisms → Bacteria → Terrabacteria group703Open in IMG/M
3300021477|Ga0210398_11065128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura643Open in IMG/M
3300021559|Ga0210409_11162454All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300024288|Ga0179589_10243259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300025910|Ga0207684_10054804All Organisms → cellular organisms → Bacteria → Terrabacteria group3383Open in IMG/M
3300025929|Ga0207664_10144874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2013Open in IMG/M
3300025929|Ga0207664_10178283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1823Open in IMG/M
3300026551|Ga0209648_10019280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae5960Open in IMG/M
3300027168|Ga0208239_1033632Not Available508Open in IMG/M
3300027846|Ga0209180_10703225Not Available549Open in IMG/M
3300027882|Ga0209590_10002418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura7476Open in IMG/M
3300028789|Ga0302232_10693070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae500Open in IMG/M
3300028906|Ga0308309_11832327Not Available513Open in IMG/M
3300030520|Ga0311372_11367329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300031231|Ga0170824_107908339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300031544|Ga0318534_10023269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3317Open in IMG/M
3300031549|Ga0318571_10316250Not Available591Open in IMG/M
3300031572|Ga0318515_10323403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura827Open in IMG/M
3300031573|Ga0310915_10888556Not Available625Open in IMG/M
3300031679|Ga0318561_10723363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300031680|Ga0318574_10190297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1177Open in IMG/M
3300031680|Ga0318574_10682720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae602Open in IMG/M
3300031708|Ga0310686_112819554Not Available566Open in IMG/M
3300031715|Ga0307476_10963181Not Available629Open in IMG/M
3300031718|Ga0307474_10381449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1095Open in IMG/M
3300031723|Ga0318493_10175984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1120Open in IMG/M
3300031723|Ga0318493_10612066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300031744|Ga0306918_10274830Not Available1292Open in IMG/M
3300031748|Ga0318492_10317129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium813Open in IMG/M
3300031751|Ga0318494_10791896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae555Open in IMG/M
3300031798|Ga0318523_10400337Not Available682Open in IMG/M
3300031832|Ga0318499_10282251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300031835|Ga0318517_10270308Not Available768Open in IMG/M
3300031835|Ga0318517_10289008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae741Open in IMG/M
3300031859|Ga0318527_10444357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura553Open in IMG/M
3300031912|Ga0306921_11818444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300031938|Ga0308175_100407016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1423Open in IMG/M
3300031946|Ga0310910_10997122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300031996|Ga0308176_10970458All Organisms → cellular organisms → Bacteria → Terrabacteria group895Open in IMG/M
3300032001|Ga0306922_11072991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium827Open in IMG/M
3300032010|Ga0318569_10084241All Organisms → cellular organisms → Bacteria → Terrabacteria group1420Open in IMG/M
3300032044|Ga0318558_10010262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3519Open in IMG/M
3300032261|Ga0306920_104379709Not Available506Open in IMG/M
3300032770|Ga0335085_10008062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria16159Open in IMG/M
3300032770|Ga0335085_10136834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3097Open in IMG/M
3300032805|Ga0335078_11077222Not Available943Open in IMG/M
3300032954|Ga0335083_10087858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3109Open in IMG/M
3300032955|Ga0335076_10373209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1312Open in IMG/M
3300032955|Ga0335076_10521932Not Available1071Open in IMG/M
3300033004|Ga0335084_10132650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2590Open in IMG/M
3300033134|Ga0335073_10298267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1936Open in IMG/M
3300033134|Ga0335073_10751842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300033289|Ga0310914_10908285Not Available780Open in IMG/M
3300033544|Ga0316215_1032583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura542Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.01%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.01%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.26%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.26%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.50%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.50%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.50%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.50%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033544Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10555568923300000364SoilMRTLIAVLIGAIIATGAAVVLVHNATMTRQAPARVLYNHGSG*
Ga0062389_10144954613300004092Bog Forest SoilMRTLMAVLIGILIATGGAVVMVHDETVVRQAPARVVFNYGSG*
Ga0066672_1010108033300005167SoilMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG*
Ga0066671_1064858123300005184SoilMRTLIAVLIGVIIATGAAVILVHNATVTRQAPARVLYNYGSG*
Ga0070709_1148202223300005434Corn, Switchgrass And Miscanthus RhizosphereMSMRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARVLFGYGSG*
Ga0070714_10014646833300005435Agricultural SoilMRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG*
Ga0070713_10242192223300005436Corn, Switchgrass And Miscanthus RhizosphereMRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARVLFGYGSG*
Ga0070710_1010629513300005437Corn, Switchgrass And Miscanthus RhizosphereTGDMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGPG*
Ga0070711_10061749423300005439Corn, Switchgrass And Miscanthus RhizosphereMRILIAVLAGVLLAVGASVVLVHDATVTRPAPALVLFNDGSG*
Ga0066682_1043398223300005450SoilMRTLIAVLIGAIIATGAAVVLVHDATITRQAPARVLYNHGSG*
Ga0066681_1007993123300005451SoilMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNYGSG*
Ga0066687_1034165113300005454SoilRGRTVDMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG*
Ga0070698_10002322063300005471Corn, Switchgrass And Miscanthus RhizosphereMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGHG*
Ga0066695_1041815523300005553SoilMRTLIAVLIGAIIATGAAVVLVHNATITWQAPARVLYNHGSG*
Ga0066707_1018803223300005556SoilMRTLIAVLIGAVIATGAAVVLVHNATITWQAPARVLYNHGSG*
Ga0066654_1025335123300005587SoilMRTLIAVLIGVIIATGAAVILVHNATITRQAPARELYNNGAG*
Ga0066706_1113403023300005598SoilTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLYNYGSG*
Ga0070762_1010524433300005602SoilMRTLVAVLIGILLATGGAVVMVHDESVVRQAPVRVLFNYGSG*
Ga0070763_1088513223300005610SoilMRTLVAVLIGILLATGGAVVMVHDESVVRQAPARVVFNYGSG*
Ga0066903_10402745923300005764Tropical Forest SoilVRTLIAVLIGAVIAMGCAVALVHNATTTRQAPARVLYNYGPG*
Ga0070717_1002002733300006028Corn, Switchgrass And Miscanthus RhizosphereMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGPG*
Ga0066651_1014140723300006031SoilMRTLIAVLIGVIIATGAAVILVHNATITRQAPARVLYNYGSG*
Ga0066696_1031484423300006032SoilMRTLIAVLVGVIIATGAAVVLVHNATITRQAPARVLYNYGSG*
Ga0066656_1023979033300006034SoilMRTLIAVLIGVIIATGAAVILVHNATITRQAPARVLYNYG
Ga0066652_10136645023300006046SoilMRTLIAVLIGAIIAAGAAVVLVHNATMTRQAPARVLYHDGSG*
Ga0070765_10206424023300006176SoilMRTVVAVLIGILLATGGAVVMVHDETIVRQAPARVLFNYGSG*
Ga0079222_1060260523300006755Agricultural SoilVNVRILIAMLIGALLAIGSSVVLVHDATVTRPAPTRVLFSDGSGQSGQ*
Ga0079221_1009464723300006804Agricultural SoilMRTLIAVLIGAAIAIGAAVVLVHDATITRQAPARVLYNHGSG*
Ga0079220_1130011713300006806Agricultural SoilTVDMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG*
Ga0075425_10251301513300006854Populus RhizosphereMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVL
Ga0075424_10113946023300006904Populus RhizosphereVRTLIAVLIGAIIATGAAVVLVHNATMARQAPARVLYNHGSG*
Ga0099829_1095576923300009038Vadose Zone SoilMRTLIAVLIGVLIAIGCAVVLVHNDTTTRQAPAPVLYNDGSG*
Ga0099827_1000437873300009090Vadose Zone SoilMRTLIAVLIGVLIAIGCAVVLVHNDTMTRQAPAPVLYNDGSG*
Ga0066709_10345228813300009137Grasslands SoilMRTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLYNYGSG*
Ga0134126_1027270133300010396Terrestrial SoilRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARVLFGYGSG*
Ga0134126_1204131713300010396Terrestrial SoilMSMRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARV
Ga0134126_1251189413300010396Terrestrial SoilMPVNRRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARV
Ga0126344_116850123300010866Boreal Forest SoilMRTVVAVLIGILIATGCAVVMVHDETMVRQAPARVLFNYGSG*
Ga0126356_1108482823300010877Boreal Forest SoilMRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLFNYGSG*
Ga0137391_1089444013300011270Vadose Zone SoilMRTLIAVLIGVLIAIGAAVVLVHNDTMTRQAPARVLYNYGSG*
Ga0137389_1019066123300012096Vadose Zone SoilMRTLIAVLIGVLIAIGAAAVLVHNDTMTRQAPARVLYNDGSG*
Ga0137364_1022835223300012198Vadose Zone SoilMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHDSG*
Ga0137382_1013828023300012200Vadose Zone SoilMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYSHGSG*
Ga0137363_1034793123300012202Vadose Zone SoilMRTLIAVLIGALIATGAAVVLVHNATMTRQAPARVLYNDGSG*
Ga0137362_1073665413300012205Vadose Zone SoilMRTLIAVLIGVLIAIACAVVLVHNDTMTRQAPARVLYNDGSG*
Ga0137376_1027852713300012208Vadose Zone SoilRTVDMRTLIAVLIGVLIATGAAVVLVHNATITRQAPARVLYNHGSG*
Ga0137371_1019878613300012356Vadose Zone SoilMRTLIAVLIGAVIATGAAVVLVHNATITRQAPARVLYNHGSG*
Ga0157354_104514423300012517Unplanted SoilMRTLIAVLIGAIIATGAAVVLVHNATIARQAPARVLYNHGSG*
Ga0137413_1021753123300012924Vadose Zone SoilMRTVVAVLIGILIAAGCAVVMVHDETMVRQAPARVLFNYGSG*
Ga0137404_1028279023300012929Vadose Zone SoilMRTLIAVLIGVLIATGSVMVLVHNDTMTRQAPARVLFNYGSG*
Ga0137410_1059012713300012944Vadose Zone SoilMRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLYNYG
Ga0134081_1033183323300014150Grasslands SoilMRTLIAVLIGVIIATGAAVVLVHDATITRQAPARVLYNHGSG*
Ga0134079_1022380923300014166Grasslands SoilMRTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLY
Ga0132256_10347234313300015372Arabidopsis RhizosphereMRTLIAVLIGAIIATGAAVVLVHNATMARQAPARVLYNHGSG*
Ga0182036_1042223723300016270SoilMRIVVAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLYDDGSG
Ga0182035_1044763813300016341SoilMRTVVAILIGALPASAGAVALVHDVTMTRQAPARVLYDDGSG
Ga0182038_1157908323300016445SoilMRTLIAMLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSYVDG
Ga0187821_1034527623300017936Freshwater SedimentMRTLIAVLIGAIIATGAAVVLATITRQAPDRVLDNHGSG
Ga0187809_1006874323300017937Freshwater SedimentMRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG
Ga0187809_1026629123300017937Freshwater SedimentMRTLIAVLIGAVIATGAAVVLVHNATITWQAPARVLYNHGSG
Ga0187780_1026669323300017973Tropical PeatlandMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYSNGFG
Ga0187777_1049925723300017974Tropical PeatlandVRIRIVIAVLAGVLLAMGSCLVLVHDATVTRPAPARVLFSPGPG
Ga0187777_1101182823300017974Tropical PeatlandRIVIAVLAGVLLAAGACLVLVHDATLTRPAPARVLFSPGPG
Ga0187823_1007936423300017993Freshwater SedimentMRTLIAVLIGAIIATGAAVVLATITRQAPDRVLYNHGS
Ga0187766_1076864913300018058Tropical PeatlandMRILITVLIGILLAAGSSVVLVHDATAVRQASPQVLFSHGSG
Ga0187765_1046106623300018060Tropical PeatlandVRIRIVIAVLAGVLLAAGSCLVLVHDAAVTRPAPARVLFSPGPG
Ga0187765_1054919723300018060Tropical PeatlandVRIRIVIAVLAGVLLAAGACLVLVHDAAVTRPAPARVLFSPGPG
Ga0066655_1038187123300018431Grasslands SoilMRTLIAVLIGAIIATGAAVVLVHDATITRQAPARVLYNHGSG
Ga0066667_1014840323300018433Grasslands SoilMRTLIAVLIGAVIATGAAVVLVHNATITRQAPARVLYNYGSG
Ga0066669_1007125823300018482Grasslands SoilMRTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLYNYGSG
Ga0179590_117080423300020140Vadose Zone SoilMRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLFNYG
Ga0179594_1007676213300020170Vadose Zone SoilMRTLIAVLIGAIIATGAAVVLVHNATITRQAPSRVLYNHGSG
Ga0210395_1026348323300020582SoilMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNSGSGPG
Ga0210401_1163936813300020583SoilRPARGRTVDMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG
Ga0179596_1030306123300021086Vadose Zone SoilMRTVIAVLIGILIATGSAVVLVHNETMVRPAPVRVLFNYGSG
Ga0210388_1056395423300021181SoilRTLLAVLIGVLLATGCATVMVHDESVVRQAPVRVLFNYGSG
Ga0213881_1003013123300021374Exposed RockMRTLIAVLIGALMATGAAVALVHNDTMIRQAPARVLYNYGSG
Ga0213881_1053239623300021374Exposed RockMRTLIAVLIGALMATGAAVVLVHNDTMIRQAPARVLYNDGSG
Ga0210393_1116015023300021401SoilMRTLLAVLIGVLLATGCATVMVHDESVVRQAPVRVL
Ga0210383_1101648413300021407SoilMLIGILLAVGAAAVLVHNETVTRPAPARVLYNYGSG
Ga0210398_1106512823300021477SoilMRTLLAVLIGVLLATGCATVMVHDESVVRQAPVRVLFNYGSG
Ga0210409_1116245423300021559SoilIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNSGSGPG
Ga0179589_1024325923300024288Vadose Zone SoilMRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLFNYGSG
Ga0207684_1005480423300025910Corn, Switchgrass And Miscanthus RhizosphereMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGPG
Ga0207664_1014487413300025929Agricultural SoilMSMRILTAVLAGVLVAVGSSVVLVHDATVTRQAPARVLFGDGSG
Ga0207664_1017828313300025929Agricultural SoilRPARGMPVNMRFLIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG
Ga0209648_1001928023300026551Grasslands SoilMRTLIAVLIGVLIAIACAVVLVHNDTMTRQAPARVLYNDGSG
Ga0208239_103363213300027168Forest SoilMRTLVAVLIGILLATGGAVVMVHDESVVRQAPARVVFNYGSG
Ga0209180_1070322523300027846Vadose Zone SoilMRTLIAVLIGVLIAIGCAVVLVHNDTMTRQAPAPVLYNDGSG
Ga0209590_1000241843300027882Vadose Zone SoilMRTLIAVLIGVLIAIGCAVVLVHNDTTTRQAPAPVLYNDGSG
Ga0302232_1069307023300028789PalsaMRILIAVLIGILIATGSAVTLVRDETMVRQAPARVLFNYGSG
Ga0308309_1183232723300028906SoilMRTVVAVLIGILLATGGAVVMVHDETIVRQAPARVLFNYGSG
Ga0311372_1136732923300030520PalsaMRTVIAVLIGILIATGSAVVLVHDETMIRSAPVRVLFSYGSG
Ga0170824_10790833913300031231Forest SoilMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNH
Ga0318534_1002326933300031544SoilMRIVVAVLIGALLAAGGAVVLVHDVTMTRQVPARVLYDDGSG
Ga0318571_1031625023300031549SoilMRIVIAVLTGVLLAIGSCLVLVHDATVTRQAPARVLFSHGPG
Ga0318515_1032340323300031572SoilVNRRILIAVLIGALLAVGFSMVLVHDATMTRQAPARVLFSNDSG
Ga0310915_1088855623300031573SoilMRIVVAVLIGALLAAGGAVVLVHDVTMTRQVPARVLYDNGSG
Ga0318561_1072336323300031679SoilMRIVVAVLIGALLAAGGAVVLVHDVTMTRQAPARVLYDDGSG
Ga0318574_1019029723300031680SoilMRIVVAVLIGVLLAAGGAVVLVHDVTMTRQVPARVLYDDGSG
Ga0318574_1068272023300031680SoilVDMRTLIAVLIGALLATVTAVVLVHNATMTRQAPARVLYNYSSG
Ga0310686_11281955413300031708SoilMRTLVAVLIGILIATGGAVVMVHDETVVRQAPARVVFNYGSG
Ga0307476_1096318123300031715Hardwood Forest SoilMRGVIAVLIGAVIAVGAAMVLVHNGTMTGQGPARVLFSYGYGSGSG
Ga0307474_1038144923300031718Hardwood Forest SoilMRGVIAVLIGAVIAVGAAMVLVHNGTMTGQGPARVLFSYGYGYGSGSG
Ga0318493_1017598423300031723SoilVGMRIVVAVLIGALLAAGGAVVLLHDVTMTRQVPARVLYDDGSG
Ga0318493_1061206623300031723SoilMRTLIAMLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSHVDG
Ga0306918_1027483023300031744SoilMRIVVAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLFSNDSG
Ga0318492_1031712923300031748SoilMRTLIAVLAGAIIAVGAVVVLVHNSTMTGQAPARVLFSYVDG
Ga0318494_1079189623300031751SoilTVDMRTLIAVLIGALLATVTAVVLVHNATMTRQAPARVLYNYSSG
Ga0318523_1040033723300031798SoilMRIVVAVLIGALLAVGGAVVLVHDVTMARQAPARVLYDDGSG
Ga0318499_1028225123300031832SoilMRIVVAVLIGALLAAGGAVVLLHDVTMTRQVPARVLYDDGSG
Ga0318517_1027030823300031835SoilMRIVVAVLIGALLAAGGAVVLVHDVTMTRQVPARVLYDD
Ga0318517_1028900813300031835SoilMRIVVAVLIGALLAAGGAVVLVHDVTMTRPAPARVLYDDGSG
Ga0318527_1044435723300031859SoilMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNNGFG
Ga0306921_1181844423300031912SoilMRTLIAVLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSYVDG
Ga0308175_10040701623300031938SoilMRSVIAVLIGAIIAVGAAMLLVHNGTMTGQGPARVLFSDGYGYDSG
Ga0310910_1099712223300031946SoilMRTLIAVLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSHVDG
Ga0308176_1097045823300031996SoilMRTLIAVLIGVIIATGAAVILVHNATITRQAPARVLYNYGSG
Ga0306922_1107299113300032001SoilAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLYDDGSG
Ga0318569_1008424123300032010SoilIVVAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLYDDGSG
Ga0318558_1001026243300032044SoilMRIVVAVLIGALLAVGGAVVLVHDVTMTRQVPARVLYDDGSG
Ga0306920_10437970913300032261SoilMRTLIAVLIGALLATVTAVVLVHNATMTRQAPARVLYNYSSG
Ga0335085_10008062113300032770SoilMRVVIAVLIGAIIATGAAVVLVHNATIIRPAPARVLYHHGSG
Ga0335085_1013683433300032770SoilMSMRILIAVLAGVLLAVGFSVVLVHDATVTRQAPARVLFGYGSG
Ga0335078_1107722223300032805SoilMRILIAVLIGVLLAAGSSAVLVHDATVTRQAPARVLFSDGSG
Ga0335083_1008785813300032954SoilMRILIAVLAGALLAAGSSAALVHDATVTRQAPARVLFSYGSG
Ga0335076_1037320913300032955SoilVSMRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG
Ga0335076_1052193213300032955SoilVRTRILIAVLAGALLAGGSSAALVHDATVTRQAPA
Ga0335084_1013265013300033004SoilMRVVIAVLIGAIIATGAAVVLVHNATIIRPASARVLYHHGSG
Ga0335073_1029826733300033134SoilMKMRILIAVLTGVLLAAAASVVLVHDAAVTRPAPTRVLFSNGPG
Ga0335073_1075184223300033134SoilVSVRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFTDGSG
Ga0310914_1090828513300033289SoilMRTLIAVLAGAIIAVGAVVVLVHNGTMTGEAPARVLFSYVDG
Ga0316215_103258323300033544RootsMRTLVAVLIGILIATGCAVVMVHDETVVRQAPARVVFNYGSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.