| Basic Information | |
|---|---|
| Family ID | F060138 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRTLIAVLIGALIATGAAVVLVHNATMTRQAPARVLYNDGSG |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.47 % |
| % of genes near scaffold ends (potentially truncated) | 25.56 % |
| % of genes from short scaffolds (< 2000 bps) | 87.97 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.932 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.609 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 57.14 |
| PF00106 | adh_short | 3.01 |
| PF00067 | p450 | 2.26 |
| PF00135 | COesterase | 1.50 |
| PF11271 | PorA | 1.50 |
| PF08241 | Methyltransf_11 | 0.75 |
| PF00425 | Chorismate_bind | 0.75 |
| PF00440 | TetR_N | 0.75 |
| PF13386 | DsbD_2 | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| PF11847 | DUF3367 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 2.26 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.93 % |
| Unclassified | root | N/A | 27.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105555689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1223 | Open in IMG/M |
| 3300004092|Ga0062389_101449546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300005167|Ga0066672_10101080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1759 | Open in IMG/M |
| 3300005184|Ga0066671_10648581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 685 | Open in IMG/M |
| 3300005434|Ga0070709_11482022 | Not Available | 551 | Open in IMG/M |
| 3300005435|Ga0070714_100146468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2125 | Open in IMG/M |
| 3300005436|Ga0070713_102421922 | Not Available | 507 | Open in IMG/M |
| 3300005437|Ga0070710_10106295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1679 | Open in IMG/M |
| 3300005439|Ga0070711_100617494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 906 | Open in IMG/M |
| 3300005450|Ga0066682_10433982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 837 | Open in IMG/M |
| 3300005451|Ga0066681_10079931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura oligospora | 1842 | Open in IMG/M |
| 3300005454|Ga0066687_10341651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 856 | Open in IMG/M |
| 3300005471|Ga0070698_100023220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 6483 | Open in IMG/M |
| 3300005553|Ga0066695_10418155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
| 3300005556|Ga0066707_10188032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1327 | Open in IMG/M |
| 3300005587|Ga0066654_10253351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 929 | Open in IMG/M |
| 3300005598|Ga0066706_11134030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
| 3300005602|Ga0070762_10105244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1639 | Open in IMG/M |
| 3300005610|Ga0070763_10885132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 531 | Open in IMG/M |
| 3300005764|Ga0066903_104027459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 788 | Open in IMG/M |
| 3300006028|Ga0070717_10020027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5256 | Open in IMG/M |
| 3300006031|Ga0066651_10141407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1254 | Open in IMG/M |
| 3300006032|Ga0066696_10314844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1018 | Open in IMG/M |
| 3300006034|Ga0066656_10239790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1163 | Open in IMG/M |
| 3300006046|Ga0066652_101366450 | Not Available | 665 | Open in IMG/M |
| 3300006176|Ga0070765_102064240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 533 | Open in IMG/M |
| 3300006755|Ga0079222_10602605 | Not Available | 839 | Open in IMG/M |
| 3300006804|Ga0079221_10094647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura oligospora | 1453 | Open in IMG/M |
| 3300006806|Ga0079220_11300117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
| 3300006854|Ga0075425_102513015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300006904|Ga0075424_101139460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura oligospora | 831 | Open in IMG/M |
| 3300009038|Ga0099829_10955769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 711 | Open in IMG/M |
| 3300009090|Ga0099827_10004378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 8281 | Open in IMG/M |
| 3300009137|Ga0066709_103452288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300010396|Ga0134126_10272701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1995 | Open in IMG/M |
| 3300010396|Ga0134126_12041317 | Not Available | 627 | Open in IMG/M |
| 3300010396|Ga0134126_12511894 | Not Available | 560 | Open in IMG/M |
| 3300010866|Ga0126344_1168501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1570 | Open in IMG/M |
| 3300010877|Ga0126356_11084828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 769 | Open in IMG/M |
| 3300011270|Ga0137391_10894440 | Not Available | 727 | Open in IMG/M |
| 3300012096|Ga0137389_10190661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1702 | Open in IMG/M |
| 3300012198|Ga0137364_10228352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1371 | Open in IMG/M |
| 3300012200|Ga0137382_10138280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1642 | Open in IMG/M |
| 3300012202|Ga0137363_10347931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1226 | Open in IMG/M |
| 3300012205|Ga0137362_10736654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
| 3300012208|Ga0137376_10278527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1451 | Open in IMG/M |
| 3300012356|Ga0137371_10198786 | Not Available | 1570 | Open in IMG/M |
| 3300012517|Ga0157354_1045144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300012924|Ga0137413_10217531 | Not Available | 1294 | Open in IMG/M |
| 3300012929|Ga0137404_10282790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1434 | Open in IMG/M |
| 3300012944|Ga0137410_10590127 | Not Available | 917 | Open in IMG/M |
| 3300014150|Ga0134081_10331833 | Not Available | 554 | Open in IMG/M |
| 3300014166|Ga0134079_10223809 | Not Available | 801 | Open in IMG/M |
| 3300015372|Ga0132256_103472343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 530 | Open in IMG/M |
| 3300016270|Ga0182036_10422237 | Not Available | 1043 | Open in IMG/M |
| 3300016341|Ga0182035_10447638 | Not Available | 1094 | Open in IMG/M |
| 3300016445|Ga0182038_11579083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300017936|Ga0187821_10345276 | Not Available | 599 | Open in IMG/M |
| 3300017937|Ga0187809_10068743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1158 | Open in IMG/M |
| 3300017937|Ga0187809_10266291 | Not Available | 624 | Open in IMG/M |
| 3300017973|Ga0187780_10266693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1201 | Open in IMG/M |
| 3300017974|Ga0187777_10499257 | Not Available | 850 | Open in IMG/M |
| 3300017974|Ga0187777_11011828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 601 | Open in IMG/M |
| 3300017993|Ga0187823_10079364 | Not Available | 950 | Open in IMG/M |
| 3300018058|Ga0187766_10768649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300018060|Ga0187765_10461066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300018060|Ga0187765_10549197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 738 | Open in IMG/M |
| 3300018431|Ga0066655_10381871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300018433|Ga0066667_10148403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1650 | Open in IMG/M |
| 3300018482|Ga0066669_10071258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2297 | Open in IMG/M |
| 3300020140|Ga0179590_1170804 | Not Available | 596 | Open in IMG/M |
| 3300020170|Ga0179594_10076762 | Not Available | 1172 | Open in IMG/M |
| 3300020582|Ga0210395_10263483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1296 | Open in IMG/M |
| 3300020583|Ga0210401_11639368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 501 | Open in IMG/M |
| 3300021086|Ga0179596_10303061 | Not Available | 797 | Open in IMG/M |
| 3300021181|Ga0210388_10563954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 997 | Open in IMG/M |
| 3300021374|Ga0213881_10030131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → unclassified Micromonosporaceae → Micromonosporaceae bacterium | 2270 | Open in IMG/M |
| 3300021374|Ga0213881_10532396 | Not Available | 533 | Open in IMG/M |
| 3300021401|Ga0210393_11160150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300021407|Ga0210383_11016484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| 3300021477|Ga0210398_11065128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 643 | Open in IMG/M |
| 3300021559|Ga0210409_11162454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300024288|Ga0179589_10243259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300025910|Ga0207684_10054804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3383 | Open in IMG/M |
| 3300025929|Ga0207664_10144874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2013 | Open in IMG/M |
| 3300025929|Ga0207664_10178283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1823 | Open in IMG/M |
| 3300026551|Ga0209648_10019280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 5960 | Open in IMG/M |
| 3300027168|Ga0208239_1033632 | Not Available | 508 | Open in IMG/M |
| 3300027846|Ga0209180_10703225 | Not Available | 549 | Open in IMG/M |
| 3300027882|Ga0209590_10002418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 7476 | Open in IMG/M |
| 3300028789|Ga0302232_10693070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 500 | Open in IMG/M |
| 3300028906|Ga0308309_11832327 | Not Available | 513 | Open in IMG/M |
| 3300030520|Ga0311372_11367329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300031231|Ga0170824_107908339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300031544|Ga0318534_10023269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3317 | Open in IMG/M |
| 3300031549|Ga0318571_10316250 | Not Available | 591 | Open in IMG/M |
| 3300031572|Ga0318515_10323403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 827 | Open in IMG/M |
| 3300031573|Ga0310915_10888556 | Not Available | 625 | Open in IMG/M |
| 3300031679|Ga0318561_10723363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300031680|Ga0318574_10190297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300031680|Ga0318574_10682720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 602 | Open in IMG/M |
| 3300031708|Ga0310686_112819554 | Not Available | 566 | Open in IMG/M |
| 3300031715|Ga0307476_10963181 | Not Available | 629 | Open in IMG/M |
| 3300031718|Ga0307474_10381449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
| 3300031723|Ga0318493_10175984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1120 | Open in IMG/M |
| 3300031723|Ga0318493_10612066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300031744|Ga0306918_10274830 | Not Available | 1292 | Open in IMG/M |
| 3300031748|Ga0318492_10317129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 813 | Open in IMG/M |
| 3300031751|Ga0318494_10791896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 555 | Open in IMG/M |
| 3300031798|Ga0318523_10400337 | Not Available | 682 | Open in IMG/M |
| 3300031832|Ga0318499_10282251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300031835|Ga0318517_10270308 | Not Available | 768 | Open in IMG/M |
| 3300031835|Ga0318517_10289008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 741 | Open in IMG/M |
| 3300031859|Ga0318527_10444357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 553 | Open in IMG/M |
| 3300031912|Ga0306921_11818444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300031938|Ga0308175_100407016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300031946|Ga0310910_10997122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300031996|Ga0308176_10970458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 895 | Open in IMG/M |
| 3300032001|Ga0306922_11072991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 827 | Open in IMG/M |
| 3300032010|Ga0318569_10084241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1420 | Open in IMG/M |
| 3300032044|Ga0318558_10010262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3519 | Open in IMG/M |
| 3300032261|Ga0306920_104379709 | Not Available | 506 | Open in IMG/M |
| 3300032770|Ga0335085_10008062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16159 | Open in IMG/M |
| 3300032770|Ga0335085_10136834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3097 | Open in IMG/M |
| 3300032805|Ga0335078_11077222 | Not Available | 943 | Open in IMG/M |
| 3300032954|Ga0335083_10087858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3109 | Open in IMG/M |
| 3300032955|Ga0335076_10373209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1312 | Open in IMG/M |
| 3300032955|Ga0335076_10521932 | Not Available | 1071 | Open in IMG/M |
| 3300033004|Ga0335084_10132650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2590 | Open in IMG/M |
| 3300033134|Ga0335073_10298267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1936 | Open in IMG/M |
| 3300033134|Ga0335073_10751842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300033289|Ga0310914_10908285 | Not Available | 780 | Open in IMG/M |
| 3300033544|Ga0316215_1032583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.01% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.50% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1055556892 | 3300000364 | Soil | MRTLIAVLIGAIIATGAAVVLVHNATMTRQAPARVLYNHGSG* |
| Ga0062389_1014495461 | 3300004092 | Bog Forest Soil | MRTLMAVLIGILIATGGAVVMVHDETVVRQAPARVVFNYGSG* |
| Ga0066672_101010803 | 3300005167 | Soil | MRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG* |
| Ga0066671_106485812 | 3300005184 | Soil | MRTLIAVLIGVIIATGAAVILVHNATVTRQAPARVLYNYGSG* |
| Ga0070709_114820222 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARVLFGYGSG* |
| Ga0070714_1001464683 | 3300005435 | Agricultural Soil | MRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG* |
| Ga0070713_1024219222 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARVLFGYGSG* |
| Ga0070710_101062951 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TGDMRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGPG* |
| Ga0070711_1006174942 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRILIAVLAGVLLAVGASVVLVHDATVTRPAPALVLFNDGSG* |
| Ga0066682_104339822 | 3300005450 | Soil | MRTLIAVLIGAIIATGAAVVLVHDATITRQAPARVLYNHGSG* |
| Ga0066681_100799312 | 3300005451 | Soil | MRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNYGSG* |
| Ga0066687_103416511 | 3300005454 | Soil | RGRTVDMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG* |
| Ga0070698_1000232206 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGHG* |
| Ga0066695_104181552 | 3300005553 | Soil | MRTLIAVLIGAIIATGAAVVLVHNATITWQAPARVLYNHGSG* |
| Ga0066707_101880322 | 3300005556 | Soil | MRTLIAVLIGAVIATGAAVVLVHNATITWQAPARVLYNHGSG* |
| Ga0066654_102533512 | 3300005587 | Soil | MRTLIAVLIGVIIATGAAVILVHNATITRQAPARELYNNGAG* |
| Ga0066706_111340302 | 3300005598 | Soil | TLIAVLIGVIIATGAAVVLVHNATITRQAPARVLYNYGSG* |
| Ga0070762_101052443 | 3300005602 | Soil | MRTLVAVLIGILLATGGAVVMVHDESVVRQAPVRVLFNYGSG* |
| Ga0070763_108851322 | 3300005610 | Soil | MRTLVAVLIGILLATGGAVVMVHDESVVRQAPARVVFNYGSG* |
| Ga0066903_1040274592 | 3300005764 | Tropical Forest Soil | VRTLIAVLIGAVIAMGCAVALVHNATTTRQAPARVLYNYGPG* |
| Ga0070717_100200273 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGPG* |
| Ga0066651_101414072 | 3300006031 | Soil | MRTLIAVLIGVIIATGAAVILVHNATITRQAPARVLYNYGSG* |
| Ga0066696_103148442 | 3300006032 | Soil | MRTLIAVLVGVIIATGAAVVLVHNATITRQAPARVLYNYGSG* |
| Ga0066656_102397903 | 3300006034 | Soil | MRTLIAVLIGVIIATGAAVILVHNATITRQAPARVLYNYG |
| Ga0066652_1013664502 | 3300006046 | Soil | MRTLIAVLIGAIIAAGAAVVLVHNATMTRQAPARVLYHDGSG* |
| Ga0070765_1020642402 | 3300006176 | Soil | MRTVVAVLIGILLATGGAVVMVHDETIVRQAPARVLFNYGSG* |
| Ga0079222_106026052 | 3300006755 | Agricultural Soil | VNVRILIAMLIGALLAIGSSVVLVHDATVTRPAPTRVLFSDGSGQSGQ* |
| Ga0079221_100946472 | 3300006804 | Agricultural Soil | MRTLIAVLIGAAIAIGAAVVLVHDATITRQAPARVLYNHGSG* |
| Ga0079220_113001171 | 3300006806 | Agricultural Soil | TVDMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG* |
| Ga0075425_1025130151 | 3300006854 | Populus Rhizosphere | MRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVL |
| Ga0075424_1011394602 | 3300006904 | Populus Rhizosphere | VRTLIAVLIGAIIATGAAVVLVHNATMARQAPARVLYNHGSG* |
| Ga0099829_109557692 | 3300009038 | Vadose Zone Soil | MRTLIAVLIGVLIAIGCAVVLVHNDTTTRQAPAPVLYNDGSG* |
| Ga0099827_100043787 | 3300009090 | Vadose Zone Soil | MRTLIAVLIGVLIAIGCAVVLVHNDTMTRQAPAPVLYNDGSG* |
| Ga0066709_1034522881 | 3300009137 | Grasslands Soil | MRTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLYNYGSG* |
| Ga0134126_102727013 | 3300010396 | Terrestrial Soil | RILIAVLAGVLLAVGSSVVLVHDATVTRQAPARVLFGYGSG* |
| Ga0134126_120413171 | 3300010396 | Terrestrial Soil | MSMRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARV |
| Ga0134126_125118941 | 3300010396 | Terrestrial Soil | MPVNRRILIAVLAGVLLAVGSSVVLVHDATVTRQAPARV |
| Ga0126344_11685012 | 3300010866 | Boreal Forest Soil | MRTVVAVLIGILIATGCAVVMVHDETMVRQAPARVLFNYGSG* |
| Ga0126356_110848282 | 3300010877 | Boreal Forest Soil | MRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLFNYGSG* |
| Ga0137391_108944401 | 3300011270 | Vadose Zone Soil | MRTLIAVLIGVLIAIGAAVVLVHNDTMTRQAPARVLYNYGSG* |
| Ga0137389_101906612 | 3300012096 | Vadose Zone Soil | MRTLIAVLIGVLIAIGAAAVLVHNDTMTRQAPARVLYNDGSG* |
| Ga0137364_102283522 | 3300012198 | Vadose Zone Soil | MRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHDSG* |
| Ga0137382_101382802 | 3300012200 | Vadose Zone Soil | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYSHGSG* |
| Ga0137363_103479312 | 3300012202 | Vadose Zone Soil | MRTLIAVLIGALIATGAAVVLVHNATMTRQAPARVLYNDGSG* |
| Ga0137362_107366541 | 3300012205 | Vadose Zone Soil | MRTLIAVLIGVLIAIACAVVLVHNDTMTRQAPARVLYNDGSG* |
| Ga0137376_102785271 | 3300012208 | Vadose Zone Soil | RTVDMRTLIAVLIGVLIATGAAVVLVHNATITRQAPARVLYNHGSG* |
| Ga0137371_101987861 | 3300012356 | Vadose Zone Soil | MRTLIAVLIGAVIATGAAVVLVHNATITRQAPARVLYNHGSG* |
| Ga0157354_10451442 | 3300012517 | Unplanted Soil | MRTLIAVLIGAIIATGAAVVLVHNATIARQAPARVLYNHGSG* |
| Ga0137413_102175312 | 3300012924 | Vadose Zone Soil | MRTVVAVLIGILIAAGCAVVMVHDETMVRQAPARVLFNYGSG* |
| Ga0137404_102827902 | 3300012929 | Vadose Zone Soil | MRTLIAVLIGVLIATGSVMVLVHNDTMTRQAPARVLFNYGSG* |
| Ga0137410_105901271 | 3300012944 | Vadose Zone Soil | MRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLYNYG |
| Ga0134081_103318332 | 3300014150 | Grasslands Soil | MRTLIAVLIGVIIATGAAVVLVHDATITRQAPARVLYNHGSG* |
| Ga0134079_102238092 | 3300014166 | Grasslands Soil | MRTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLY |
| Ga0132256_1034723431 | 3300015372 | Arabidopsis Rhizosphere | MRTLIAVLIGAIIATGAAVVLVHNATMARQAPARVLYNHGSG* |
| Ga0182036_104222372 | 3300016270 | Soil | MRIVVAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLYDDGSG |
| Ga0182035_104476381 | 3300016341 | Soil | MRTVVAILIGALPASAGAVALVHDVTMTRQAPARVLYDDGSG |
| Ga0182038_115790832 | 3300016445 | Soil | MRTLIAMLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSYVDG |
| Ga0187821_103452762 | 3300017936 | Freshwater Sediment | MRTLIAVLIGAIIATGAAVVLATITRQAPDRVLDNHGSG |
| Ga0187809_100687432 | 3300017937 | Freshwater Sediment | MRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG |
| Ga0187809_102662912 | 3300017937 | Freshwater Sediment | MRTLIAVLIGAVIATGAAVVLVHNATITWQAPARVLYNHGSG |
| Ga0187780_102666932 | 3300017973 | Tropical Peatland | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYSNGFG |
| Ga0187777_104992572 | 3300017974 | Tropical Peatland | VRIRIVIAVLAGVLLAMGSCLVLVHDATVTRPAPARVLFSPGPG |
| Ga0187777_110118282 | 3300017974 | Tropical Peatland | RIVIAVLAGVLLAAGACLVLVHDATLTRPAPARVLFSPGPG |
| Ga0187823_100793642 | 3300017993 | Freshwater Sediment | MRTLIAVLIGAIIATGAAVVLATITRQAPDRVLYNHGS |
| Ga0187766_107686491 | 3300018058 | Tropical Peatland | MRILITVLIGILLAAGSSVVLVHDATAVRQASPQVLFSHGSG |
| Ga0187765_104610662 | 3300018060 | Tropical Peatland | VRIRIVIAVLAGVLLAAGSCLVLVHDAAVTRPAPARVLFSPGPG |
| Ga0187765_105491972 | 3300018060 | Tropical Peatland | VRIRIVIAVLAGVLLAAGACLVLVHDAAVTRPAPARVLFSPGPG |
| Ga0066655_103818712 | 3300018431 | Grasslands Soil | MRTLIAVLIGAIIATGAAVVLVHDATITRQAPARVLYNHGSG |
| Ga0066667_101484032 | 3300018433 | Grasslands Soil | MRTLIAVLIGAVIATGAAVVLVHNATITRQAPARVLYNYGSG |
| Ga0066669_100712582 | 3300018482 | Grasslands Soil | MRTLIAVLIGVIIATGAAVVLVHNATITRQAPARVLYNYGSG |
| Ga0179590_11708042 | 3300020140 | Vadose Zone Soil | MRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLFNYG |
| Ga0179594_100767621 | 3300020170 | Vadose Zone Soil | MRTLIAVLIGAIIATGAAVVLVHNATITRQAPSRVLYNHGSG |
| Ga0210395_102634832 | 3300020582 | Soil | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNSGSGPG |
| Ga0210401_116393681 | 3300020583 | Soil | RPARGRTVDMRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNHGSG |
| Ga0179596_103030612 | 3300021086 | Vadose Zone Soil | MRTVIAVLIGILIATGSAVVLVHNETMVRPAPVRVLFNYGSG |
| Ga0210388_105639542 | 3300021181 | Soil | RTLLAVLIGVLLATGCATVMVHDESVVRQAPVRVLFNYGSG |
| Ga0213881_100301312 | 3300021374 | Exposed Rock | MRTLIAVLIGALMATGAAVALVHNDTMIRQAPARVLYNYGSG |
| Ga0213881_105323962 | 3300021374 | Exposed Rock | MRTLIAVLIGALMATGAAVVLVHNDTMIRQAPARVLYNDGSG |
| Ga0210393_111601502 | 3300021401 | Soil | MRTLLAVLIGVLLATGCATVMVHDESVVRQAPVRVL |
| Ga0210383_110164841 | 3300021407 | Soil | MLIGILLAVGAAAVLVHNETVTRPAPARVLYNYGSG |
| Ga0210398_110651282 | 3300021477 | Soil | MRTLLAVLIGVLLATGCATVMVHDESVVRQAPVRVLFNYGSG |
| Ga0210409_111624542 | 3300021559 | Soil | IAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNSGSGPG |
| Ga0179589_102432592 | 3300024288 | Vadose Zone Soil | MRTVVAVLIGILIAAGCAVVMVHDETVVRQAPARVLFNYGSG |
| Ga0207684_100548042 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNYGSGPG |
| Ga0207664_101448741 | 3300025929 | Agricultural Soil | MSMRILTAVLAGVLVAVGSSVVLVHDATVTRQAPARVLFGDGSG |
| Ga0207664_101782831 | 3300025929 | Agricultural Soil | RPARGMPVNMRFLIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG |
| Ga0209648_100192802 | 3300026551 | Grasslands Soil | MRTLIAVLIGVLIAIACAVVLVHNDTMTRQAPARVLYNDGSG |
| Ga0208239_10336321 | 3300027168 | Forest Soil | MRTLVAVLIGILLATGGAVVMVHDESVVRQAPARVVFNYGSG |
| Ga0209180_107032252 | 3300027846 | Vadose Zone Soil | MRTLIAVLIGVLIAIGCAVVLVHNDTMTRQAPAPVLYNDGSG |
| Ga0209590_100024184 | 3300027882 | Vadose Zone Soil | MRTLIAVLIGVLIAIGCAVVLVHNDTTTRQAPAPVLYNDGSG |
| Ga0302232_106930702 | 3300028789 | Palsa | MRILIAVLIGILIATGSAVTLVRDETMVRQAPARVLFNYGSG |
| Ga0308309_118323272 | 3300028906 | Soil | MRTVVAVLIGILLATGGAVVMVHDETIVRQAPARVLFNYGSG |
| Ga0311372_113673292 | 3300030520 | Palsa | MRTVIAVLIGILIATGSAVVLVHDETMIRSAPVRVLFSYGSG |
| Ga0170824_1079083391 | 3300031231 | Forest Soil | MRTLIAVLIGAIIATGAAVVLVHNATITRQAPARVLYNH |
| Ga0318534_100232693 | 3300031544 | Soil | MRIVVAVLIGALLAAGGAVVLVHDVTMTRQVPARVLYDDGSG |
| Ga0318571_103162502 | 3300031549 | Soil | MRIVIAVLTGVLLAIGSCLVLVHDATVTRQAPARVLFSHGPG |
| Ga0318515_103234032 | 3300031572 | Soil | VNRRILIAVLIGALLAVGFSMVLVHDATMTRQAPARVLFSNDSG |
| Ga0310915_108885562 | 3300031573 | Soil | MRIVVAVLIGALLAAGGAVVLVHDVTMTRQVPARVLYDNGSG |
| Ga0318561_107233632 | 3300031679 | Soil | MRIVVAVLIGALLAAGGAVVLVHDVTMTRQAPARVLYDDGSG |
| Ga0318574_101902972 | 3300031680 | Soil | MRIVVAVLIGVLLAAGGAVVLVHDVTMTRQVPARVLYDDGSG |
| Ga0318574_106827202 | 3300031680 | Soil | VDMRTLIAVLIGALLATVTAVVLVHNATMTRQAPARVLYNYSSG |
| Ga0310686_1128195541 | 3300031708 | Soil | MRTLVAVLIGILIATGGAVVMVHDETVVRQAPARVVFNYGSG |
| Ga0307476_109631812 | 3300031715 | Hardwood Forest Soil | MRGVIAVLIGAVIAVGAAMVLVHNGTMTGQGPARVLFSYGYGSGSG |
| Ga0307474_103814492 | 3300031718 | Hardwood Forest Soil | MRGVIAVLIGAVIAVGAAMVLVHNGTMTGQGPARVLFSYGYGYGSGSG |
| Ga0318493_101759842 | 3300031723 | Soil | VGMRIVVAVLIGALLAAGGAVVLLHDVTMTRQVPARVLYDDGSG |
| Ga0318493_106120662 | 3300031723 | Soil | MRTLIAMLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSHVDG |
| Ga0306918_102748302 | 3300031744 | Soil | MRIVVAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLFSNDSG |
| Ga0318492_103171292 | 3300031748 | Soil | MRTLIAVLAGAIIAVGAVVVLVHNSTMTGQAPARVLFSYVDG |
| Ga0318494_107918962 | 3300031751 | Soil | TVDMRTLIAVLIGALLATVTAVVLVHNATMTRQAPARVLYNYSSG |
| Ga0318523_104003372 | 3300031798 | Soil | MRIVVAVLIGALLAVGGAVVLVHDVTMARQAPARVLYDDGSG |
| Ga0318499_102822512 | 3300031832 | Soil | MRIVVAVLIGALLAAGGAVVLLHDVTMTRQVPARVLYDDGSG |
| Ga0318517_102703082 | 3300031835 | Soil | MRIVVAVLIGALLAAGGAVVLVHDVTMTRQVPARVLYDD |
| Ga0318517_102890081 | 3300031835 | Soil | MRIVVAVLIGALLAAGGAVVLVHDVTMTRPAPARVLYDDGSG |
| Ga0318527_104443572 | 3300031859 | Soil | MRTLIAVLIGALLATGAAVVLVHNVTMTRQAPARVLYNNGFG |
| Ga0306921_118184442 | 3300031912 | Soil | MRTLIAVLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSYVDG |
| Ga0308175_1004070162 | 3300031938 | Soil | MRSVIAVLIGAIIAVGAAMLLVHNGTMTGQGPARVLFSDGYGYDSG |
| Ga0310910_109971222 | 3300031946 | Soil | MRTLIAVLAGAIIAVGAVVVLVHNGTMTGQAPARVLFSHVDG |
| Ga0308176_109704582 | 3300031996 | Soil | MRTLIAVLIGVIIATGAAVILVHNATITRQAPARVLYNYGSG |
| Ga0306922_110729911 | 3300032001 | Soil | AVLIGVLLAAGGAVVLVHDVTMTRQAPARVLYDDGSG |
| Ga0318569_100842412 | 3300032010 | Soil | IVVAVLIGVLLAAGGAVVLVHDVTMTRQAPARVLYDDGSG |
| Ga0318558_100102624 | 3300032044 | Soil | MRIVVAVLIGALLAVGGAVVLVHDVTMTRQVPARVLYDDGSG |
| Ga0306920_1043797091 | 3300032261 | Soil | MRTLIAVLIGALLATVTAVVLVHNATMTRQAPARVLYNYSSG |
| Ga0335085_1000806211 | 3300032770 | Soil | MRVVIAVLIGAIIATGAAVVLVHNATIIRPAPARVLYHHGSG |
| Ga0335085_101368343 | 3300032770 | Soil | MSMRILIAVLAGVLLAVGFSVVLVHDATVTRQAPARVLFGYGSG |
| Ga0335078_110772222 | 3300032805 | Soil | MRILIAVLIGVLLAAGSSAVLVHDATVTRQAPARVLFSDGSG |
| Ga0335083_100878581 | 3300032954 | Soil | MRILIAVLAGALLAAGSSAALVHDATVTRQAPARVLFSYGSG |
| Ga0335076_103732091 | 3300032955 | Soil | VSMRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFNDGSG |
| Ga0335076_105219321 | 3300032955 | Soil | VRTRILIAVLAGALLAGGSSAALVHDATVTRQAPA |
| Ga0335084_101326501 | 3300033004 | Soil | MRVVIAVLIGAIIATGAAVVLVHNATIIRPASARVLYHHGSG |
| Ga0335073_102982673 | 3300033134 | Soil | MKMRILIAVLTGVLLAAAASVVLVHDAAVTRPAPTRVLFSNGPG |
| Ga0335073_107518422 | 3300033134 | Soil | VSVRILIAVLAGVLLAVGASVVLVHDATVTRPAPARVLFTDGSG |
| Ga0310914_109082851 | 3300033289 | Soil | MRTLIAVLAGAIIAVGAVVVLVHNGTMTGEAPARVLFSYVDG |
| Ga0316215_10325832 | 3300033544 | Roots | MRTLVAVLIGILIATGCAVVMVHDETVVRQAPARVVFNYGSG |
| ⦗Top⦘ |