 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F060122 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MATSKTKGTNAKIKELKGIKPEKITDEQLKKVQDTVNNLNR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.98 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (89.474 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (51.128 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.496 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.489 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13385 | Laminin_G_3 | 15.79 |
| PF00166 | Cpn10 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 89.47 % |
| All Organisms | root | All Organisms | 10.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 51.13% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.54% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 15.04% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.02% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.50% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.75% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.75% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101840961 | 3300000101 | Marine | MATKTKGTNAKIRELKGIKPEKITAEQLDKVQKTVNTINRAQIEL |
| JGI24006J15134_100602474 | 3300001450 | Marine | MATKTKGTNAKIKELKGIKPETISKEHLDKMQELINSLNRSQLE |
| JGI24005J15628_100314516 | 3300001589 | Marine | MAKNTSAKIKELKGIKPEKITAEQLEKVQNTVNGI |
| JGI24005J15628_101447143 | 3300001589 | Marine | MGAKGTNAKIKELKGIKPEKITDEQLEKVQKTVNALNRAQLDIGS |
| Ga0075445_100980333 | 3300006193 | Marine | MATKGTNAKIKELKGIKPEKITDEQLKKVQETVNNINRSQ |
| Ga0098037_10362184 | 3300006737 | Marine | MATTKTKGTSKKIKELKGIKPEKITDEQLEKVQTLINDINRSQ |
| Ga0098037_10442451 | 3300006737 | Marine | MATTKVKGTSKKIKELKGIQDIRPEKITDKQLKDVQD |
| Ga0098037_10832813 | 3300006737 | Marine | MATSKVKGTNKKNKELKGIKPEKITDEQLKKVQDTINGINRSQLELGSI |
| Ga0098037_11574931 | 3300006737 | Marine | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLTKVQDT |
| Ga0098035_11586402 | 3300006738 | Marine | MATSKTKGTNAKIKELKGIKPEKITDEQLKKVQDTINNLNR |
| Ga0098035_11861632 | 3300006738 | Marine | MAKRTNAKIKELKGIKPEKITAEQLEKVQNTVNNI |
| Ga0098040_10998811 | 3300006751 | Marine | MTTTKVKGTNAKIKELKGIKAEKVTDEQLKEVQELVNGIN |
| Ga0098039_11866112 | 3300006753 | Marine | MAKAKTKGTNAKIKELKGIKPEKITAEQLDKVQSTVNNINRAQLEIGSIELK |
| Ga0098044_11201323 | 3300006754 | Marine | MATSKTKGTNAKIKELKGVKPEKITDEQLKDVQDIVNKMNRAQLE |
| Ga0098044_12592641 | 3300006754 | Marine | MATSKTKGTNAKIKELKGIKPEKVTDEQLKKVQDSVNN |
| Ga0098044_14077062 | 3300006754 | Marine | MATTKTKGTNSKIKELKGIKPENISKEHLDKMQGIVSGVNKIYL |
| Ga0098054_10811831 | 3300006789 | Marine | MATTKTKGTNSKIKELKGIKPEKITDEQLKEVQELVNGINRSQM |
| Ga0098054_11097292 | 3300006789 | Marine | MATTKLKGTSKKIKELKGIEDIRPEKITDEQLEKVQNLISSVNKLQI |
| Ga0098054_12652471 | 3300006789 | Marine | MATTKVKGTSRKIKELKGIKPEKITNEQLEKVQNTVNSINRAQLE |
| Ga0098054_13434092 | 3300006789 | Marine | MATSKTKGTNAKIKELKGIKPEKITEEQLKKVQSTVNALNRSQLDI |
| Ga0098054_13580671 | 3300006789 | Marine | MAKAKTKGTNAKIKELKGIKAEKITDEQLKEVQELVNGIN |
| Ga0098055_12508871 | 3300006793 | Marine | MATTKVKGTSRKIKELKGIKAEKITDEQLTKVQDAVNGIN |
| Ga0098055_12756851 | 3300006793 | Marine | MATSKTKGTNAKIKELKGVKPEKISDEQLQKVQTLINDINRSQME |
| Ga0098055_13599221 | 3300006793 | Marine | MATTKTKGTNAKIKELKSVKPEKVTSEQLEKVQNT |
| Ga0070754_100601731 | 3300006810 | Aqueous | MAKNTNAKIKELSGIKHEKITDEQLKKVQETVNTINRAQIEL |
| Ga0098060_11330522 | 3300006921 | Marine | MATKTKGTNAKIKELKGIKPSNVSKEHLDKMQSAVSDINNA |
| Ga0098045_10846571 | 3300006922 | Marine | MATTKVKGTSTKIKELKGLKPEKITEDQLKKVQDVINEINKSQMEI |
| Ga0098053_11180232 | 3300006923 | Marine | MTTTKVKGTNAKIKELKGVKAEKITDEQLKEVQELVNGINRSQMELGQ |
| Ga0098051_11709971 | 3300006924 | Marine | MATTKTKGTNSKIKELKGVKPEKVTDEQLTRIQNLVNKINQSQMDI |
| Ga0098050_11257891 | 3300006925 | Marine | MATTKVKGTSKKIKELKGIKPERITDEQLKKVQGAVNNIN |
| Ga0098041_10116978 | 3300006928 | Marine | MATTKVKGTNAKIKELKGVKHEKITDEQLKKVQDTVN |
| Ga0098041_10419383 | 3300006928 | Marine | MATSKTKGTSAKIKELKGIKPEKITDEQLKQVQDIVNK |
| Ga0098041_10792691 | 3300006928 | Marine | MAKAKTKGTNAKIKELKGIKPEKITDEQLEKVQTLIND |
| Ga0098041_12792942 | 3300006928 | Marine | MATSKTKGTNAKIKELKGIKPEKITDEQLKKVQDTVN |
| Ga0075444_101144323 | 3300006947 | Marine | MAKGTTAKIKELKSIKPEKISDEQLKKVQDTVNGINRAQLE |
| Ga0075444_101247343 | 3300006947 | Marine | MATKGTNAKIKELKGIKPEKITDEQLKKVQETVNNINRSQL |
| Ga0075444_101286181 | 3300006947 | Marine | MAKGTNAKIKELKGIKPDKITDEQLEKVQKLINSINR |
| Ga0075444_101566402 | 3300006947 | Marine | MATKGTNAKIKELKGIKPEKVTDEQLKKVQDSVNNINRAQLE |
| Ga0070747_10416371 | 3300007276 | Aqueous | MATTKVKGTSKKIKELKGIKPEKITDKQLEEVQKLINDI |
| Ga0110931_10411311 | 3300007963 | Marine | MAKKTSAKIKELKGIKPEKITVEQLEKVQGSVNNINR |
| Ga0110931_10856501 | 3300007963 | Marine | MATSKVKGTNRKIKELKGIKPEKITDNQLEKLQNTIDDINRTQLE |
| Ga0098052_11426901 | 3300008050 | Marine | MATTKTKGTNSKIKELKGVKPEKVTDEQLTRIQNLVNKIN |
| Ga0098052_11446251 | 3300008050 | Marine | MATTKTKGTNAKIKELKVEKPEKVTDEQLKKIQKLVDTIN |
| Ga0098052_12466201 | 3300008050 | Marine | MGAKGTTAKIKELKGIKPEKITDEQLKKVQDTVNN |
| Ga0098052_12916661 | 3300008050 | Marine | MGAKGTNAKIKELRGIKPEKITDEQLTKVQDAVNSINRVQLE |
| Ga0114910_10279035 | 3300008220 | Deep Ocean | MAKTKTKGTTAKIKELKGIKTEKVTEEQLNKIQSIVTRIN |
| Ga0114910_10714893 | 3300008220 | Deep Ocean | MTKGTNAKIKELKGERPEKVTDAQLSRIKNIVDRINNA |
| Ga0114902_11189461 | 3300009413 | Deep Ocean | MATSKTKGTNAKIKELKGIKPEKITNEQLKKVQDTVNN |
| Ga0114908_10176911 | 3300009418 | Deep Ocean | MATTKVKGTNAKIKELKGIKPEKVTDEQLKEVQQLINEINRSQME |
| Ga0114908_10955561 | 3300009418 | Deep Ocean | MATTKTKGTNSKIKELKGVKPEKITDEQLKKVQDSVNNLN |
| Ga0114994_110598581 | 3300009420 | Marine | MATKTKGTNAKIKELKGIKPVKISETHLKQMQDTV |
| Ga0114915_10929571 | 3300009428 | Deep Ocean | MATTKTKGTNAKIKELKSIKPDRISEEQLKKVQDT |
| Ga0114915_11428232 | 3300009428 | Deep Ocean | MATKVTNTKIKELKGVKPESITAEQLEKVQKLVNNINRGQLEVG |
| Ga0114915_11539271 | 3300009428 | Deep Ocean | MATKGTNAKIKELKGVKPESITAEQLEKVQKLVNNIN |
| Ga0114915_12038852 | 3300009428 | Deep Ocean | MATKGTNAKIKELKGIKAEKINYEQLGKVQNIVNRINQAQMDVG |
| Ga0114900_11818732 | 3300009602 | Deep Ocean | MATSKVKGTSRKIKELKGIKPEKITDDQLKKVQDT |
| Ga0114911_10930221 | 3300009603 | Deep Ocean | MATSKTKGTNAKIKELKGIKPEKITDEQLKEVQSVIN |
| Ga0114901_10186521 | 3300009604 | Deep Ocean | MAKGTNAKIKELRGIKPEKVKEEHLKEIQETVSDINKLYIELG |
| Ga0114906_10140238 | 3300009605 | Deep Ocean | MATSKVKGTSRKIKELKGIKPEKITDEQLAKVQDVVN |
| Ga0114999_113070211 | 3300009786 | Marine | MGAKGTNAKIKELKGIKPEKITAEQLDKVQNTVNSINRA |
| Ga0098056_10912681 | 3300010150 | Marine | MAISKTKGTNAKIKELTGKKPEKISEEQLTKVQDTVNGINRAQLEIGNIEVRK |
| Ga0098056_11551322 | 3300010150 | Marine | MATTKVKGTSRKIKELKGIKAEKITDEQLAKVQDTVNGIN |
| Ga0098056_11695552 | 3300010150 | Marine | MATTKTKGTNSKIKELKSTKPEKVSDDQLKRIQETVGIINRAHS |
| Ga0098061_10687011 | 3300010151 | Marine | MATTKTKGTNSKIKELKSTKPEKVSDDQLKRIQET |
| Ga0098059_10468715 | 3300010153 | Marine | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLEKVQ |
| Ga0098059_13054412 | 3300010153 | Marine | MAKAKTKGTNAKIKELKGIKPEKITDEQLKKVQDTVN |
| Ga0098059_13670582 | 3300010153 | Marine | MATSKVKGTNKKIKELKGIKPEKITDEQLEKVQTTVNNINRTQLEI |
| Ga0098047_100566154 | 3300010155 | Marine | MAKAKTKGTNAKIKELKGIKPEKITAEQLDKVQNTVNSINRAQLEIGSVE |
| Ga0181374_10678421 | 3300017702 | Marine | MATTKLKGTSKKIKELKGIKPEKITDEQLKKVPSS |
| Ga0181372_10512372 | 3300017705 | Marine | MATKGTNAKIKELKGIKPEKITAEQLEKVQNTVNSIN |
| Ga0181391_11128361 | 3300017713 | Seawater | MAKGTNAKIKELKGIKPESISKEQLDKVQSVVNRINQAQMD |
| Ga0181390_10757784 | 3300017719 | Seawater | MATTKTKGTSKKIKELKGVKPEKITAEQLEKVQAVI |
| Ga0181383_11325962 | 3300017720 | Seawater | MATSKVKGTSKKIKELKGLKPEKITDEQLTKVQDTVNGINRA |
| Ga0181398_11726631 | 3300017725 | Seawater | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLKKVQSTVNQINRTQLEI |
| Ga0181431_10928571 | 3300017735 | Seawater | MATKTKGTNAKIKELKGIKPEKVSEKHLEQIQEAVSEINKTY |
| Ga0187218_11318331 | 3300017737 | Seawater | MAKGTNAKIKELKGIKPESISKEQLDKVQSVVNRIN |
| Ga0181399_11464621 | 3300017742 | Seawater | GTNAKIKELKGVKAEKITDEQLKEVQELINNINRSQMEL |
| Ga0181399_11735361 | 3300017742 | Seawater | MATTKVKGTSKKIKELNGVEDIRPEKITDDQLTKLRALVKDINLSHHEIGVIEAKKHSMM |
| Ga0181389_11421361 | 3300017746 | Seawater | MATKTKGTNAKIKELKGVKPEKITAEQLDKVQNTVNSINRAQLEI |
| Ga0187219_10537404 | 3300017751 | Seawater | MATTKTKGTSKKIKELKGVKPEKITAEQLEKVQAVINDIN |
| Ga0181411_11901513 | 3300017755 | Seawater | MGAKGTNAKIKELKGIKHEKITDEQLKKVQDTVNSI |
| Ga0181420_11362942 | 3300017757 | Seawater | MATTKTKGTNAKIKELKTERPEKVTDAQLSRIKNIVD |
| Ga0181420_12390292 | 3300017757 | Seawater | MAKAKTKGTNAKIKELKGIKAEKVTDEQLKEVQELVNGINRSQ |
| Ga0181409_11687912 | 3300017758 | Seawater | MAKGTNAKIKELKGIKPESISKEQLDKVQSVVNRINQAQ |
| Ga0181413_10455614 | 3300017765 | Seawater | MATTKVKGTSKKIKELKGIKPERVTDDQLKSIQQT |
| Ga0181386_12539581 | 3300017773 | Seawater | MATKTKGTNAKIKELKGIKPEKITDEQLKKVQDTVNDINKSQLEI |
| Ga0181432_10589093 | 3300017775 | Seawater | MATTKTKGTNSKIKELKGIKPEKVTDEQLQKIQETVN |
| Ga0181394_10611701 | 3300017776 | Seawater | MAKAKTKGTNAKIKELKGIKPEKITAEQLDKVQNTVNSINRAQLE |
| Ga0181380_12029262 | 3300017782 | Seawater | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLKKVQSTVNQINRTQS |
| Ga0181380_12229081 | 3300017782 | Seawater | MATKTKGTNAKIKELKGIKPEKVTDEQLGKIQKLV |
| Ga0181379_10788303 | 3300017783 | Seawater | MAKNTSAKIKELKGIKPEKITDEQLDQVQKLINDI |
| Ga0181424_104480422 | 3300017786 | Seawater | MATTKVKGTSKKIKELKGVKPEKVTTEELEKVQAVINDINKSQIEI |
| Ga0206679_106708642 | 3300021089 | Seawater | MATKTKGTNAKIKELKGIKPEKVTDEELETIQSIINRINQTQM |
| Ga0207890_10440902 | 3300025079 | Marine | MATTKVKGTNSKIKELKGVKAEKVTDEQLKEVQELVNGIN |
| Ga0208157_10441174 | 3300025086 | Marine | MATTKVKGTSKKLKELKGIKPEKITDEQLKEVQDLVNGINRS |
| Ga0208010_10776781 | 3300025097 | Marine | MAKAKTKGTNAKIKELKGIKPEKITAEQLDKVQNTVNSINRAQLEIG |
| Ga0208793_11214963 | 3300025108 | Marine | MATKTKGTNAKIKELKGIKPEKITDEQLKKVQDTVNN |
| Ga0208158_10067068 | 3300025110 | Marine | MATTKTKGTSKKIKELKGIKPEKITDEQLEKVQTL |
| Ga0208158_10891761 | 3300025110 | Marine | MATSKVKGTNKKIKELKGIKPEKITDEQLEKVQTT |
| Ga0208158_10955051 | 3300025110 | Marine | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLEKVQSVINNIN |
| Ga0208790_11869291 | 3300025118 | Marine | MATSKTKGTNAKIKELKGIKPEKITDEQLKKVQDTVNNLNR |
| Ga0209535_11498541 | 3300025120 | Marine | MATKGTNAKIKELKGIKPEKITAEQLDKIQETINTMN |
| Ga0208919_10658531 | 3300025128 | Marine | MATTKVKGTSKKIKELKGIKPEKITDEQLKKVQDTVN |
| Ga0208919_11505621 | 3300025128 | Marine | MATSKTKGTNAKIKELTGKKPEKISEEQLRRVQETVNAINKGQ |
| Ga0209232_10627711 | 3300025132 | Marine | MATSKVKGTSKKIKELKGIEDIRPEKITDEQLEKVQGVINDINRAQMELGQ |
| Ga0209232_11119471 | 3300025132 | Marine | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLEKVQSVIND |
| Ga0208299_11018941 | 3300025133 | Marine | MTTTKTKGTNSKIKELKGVKPEKVTDEQLKRIQETVSVI |
| Ga0209634_11006271 | 3300025138 | Marine | MATKGTNAKIKELKGIKPEKITDEQLTKVQDTVNGINRAQLE |
| Ga0209337_11720262 | 3300025168 | Marine | MAKAKTKGTNAKIKELKGIKPEKITAEQLDKVQNTVNSINRAQL |
| Ga0208182_10667412 | 3300025251 | Deep Ocean | MAKAKTKGTNAKIKELKGVKPEKVTNEQLEKVQAVINDINKSQIEIGQM |
| Ga0208813_10350651 | 3300025270 | Deep Ocean | MATTKVKGTSKKIKELKGIEDIRPEKITDEQLEKVQGVINDINRAQMELG |
| Ga0208814_10139257 | 3300025276 | Deep Ocean | MATTKTKSTNSKIKELKGIKSEKITDEQLEKVQTTVN |
| Ga0208030_10853952 | 3300025282 | Deep Ocean | MATTKVKGTSKKLKELKGIKPEKITDEQLSKVQDTVNNINRAQLE |
| Ga0208030_11169421 | 3300025282 | Deep Ocean | MATSKTKGTNAKIKELKGIKPEKITDEQLKKVQNTVNTLNR |
| Ga0208450_10478203 | 3300025301 | Deep Ocean | MAKAKTKGTNAKIKELKGIKPEKITTEQLDKVQNTVNSINRAQLE |
| Ga0208684_10735282 | 3300025305 | Deep Ocean | MATSKTKGTNAKIKELKGIKPEKITDEQLKKVQNTVNTLNRSQLD |
| Ga0209757_100152376 | 3300025873 | Marine | MATKTKGTNAKIKELKGIKPEKITAEQLGKVQDTVNNIN |
| Ga0209757_101108511 | 3300025873 | Marine | MTTTKTKGTNSKIKELKGIKPEKVTDEQLQKIQETVNNLNR |
| Ga0209757_101156482 | 3300025873 | Marine | MATKTKGTNAKIKELKGIKPEKITDEQLEKIQKTINN |
| Ga0207994_10310521 | 3300027416 | Estuarine | MATKTKGTNAKIKELKGVKPEKITTEQLEKIQKTIN |
| Ga0209384_10150601 | 3300027522 | Marine | MATKGTNAKIKELKGIKPEKITDEQLKKVQETVNNINRS |
| Ga0209816_10374037 | 3300027704 | Marine | MATKVKGTNAKIKELKGIKPEKVTEDQLKKVQNTI |
| Ga0209816_11028933 | 3300027704 | Marine | MATKGTNAKIKELKGIKPEKITDEQLKKVQETVNNINRSQLE |
| Ga0209816_11103263 | 3300027704 | Marine | MATKGTNAKIKELKGIKPEKITDEQLEKVQKLINAIN |
| Ga0209815_12739972 | 3300027714 | Marine | MATSKTKGTDAKIKEIKGIKPRKVTDEQLTKIQAVVDKVNQTQMNIG |
| Ga0209279_101184972 | 3300027771 | Marine | MATKGTNAKIKELKGIKPEKITDEQLVKVQEAVNNINRNQLEIG |
| Ga0183748_10933102 | 3300029319 | Marine | MAISKTKGTSKKIKELKGIKPEKITDEQLERVQNTVNNINRA |
| Ga0308024_10017581 | 3300031140 | Marine | MATGTNAKIKELKGIKPERITEEELKKVQEAVNTMNR |
| Ga0307488_102841443 | 3300031519 | Sackhole Brine | MAKGTNAKIKELKGIKPEKITDEQLKKVQETVNTM |
| Ga0307994_100450415 | 3300031660 | Marine | MTTKTKGTNAKIKELKGIKPEKITAEQLENVQKLINSINRGQLE |
| Ga0308011_101964561 | 3300031688 | Marine | MATKGTNAKIKELKGIKPEKVTDEQLKKVQETVNN |
| Ga0308017_10569802 | 3300031689 | Marine | MATKGTNAKIKELKGIKPEKITDEQLKKVQDTVNS |
| Ga0308016_102611362 | 3300031695 | Marine | MATKVKGTNAKIKELKGIKPEKVTEDQLKKVQNTINGINR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |