| Basic Information | |
|---|---|
| Family ID | F060121 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRM |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.15 % |
| % of genes near scaffold ends (potentially truncated) | 96.99 % |
| % of genes from short scaffolds (< 2000 bps) | 84.96 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.398 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (39.850 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.985 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF01555 | N6_N4_Mtase | 5.26 |
| PF13589 | HATPase_c_3 | 1.50 |
| PF02562 | PhoH | 0.75 |
| PF06508 | QueC | 0.75 |
| PF14236 | DUF4338 | 0.75 |
| PF00733 | Asn_synthase | 0.75 |
| PF04055 | Radical_SAM | 0.75 |
| PF02086 | MethyltransfD12 | 0.75 |
| PF01227 | GTP_cyclohydroI | 0.75 |
| PF13537 | GATase_7 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 5.26 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 5.26 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 5.26 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.75 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.75 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.75 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.75 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.75 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.75 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.46 % |
| Unclassified | root | N/A | 16.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10110120 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10034549 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
| 3300000949|BBAY94_10135552 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 670 | Open in IMG/M |
| 3300000973|BBAY93_10095047 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 759 | Open in IMG/M |
| 3300002483|JGI25132J35274_1090082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 629 | Open in IMG/M |
| 3300002488|JGI25128J35275_1091055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 620 | Open in IMG/M |
| 3300002488|JGI25128J35275_1106400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 564 | Open in IMG/M |
| 3300002518|JGI25134J35505_10116286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 569 | Open in IMG/M |
| 3300005424|Ga0066826_10278961 | Not Available | 562 | Open in IMG/M |
| 3300005521|Ga0066862_10029412 | Not Available | 1998 | Open in IMG/M |
| 3300005521|Ga0066862_10304558 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 515 | Open in IMG/M |
| 3300005605|Ga0066850_10170026 | Not Available | 797 | Open in IMG/M |
| 3300006193|Ga0075445_10264950 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 586 | Open in IMG/M |
| 3300006350|Ga0099954_1009501 | Not Available | 506 | Open in IMG/M |
| 3300006736|Ga0098033_1153922 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 644 | Open in IMG/M |
| 3300006750|Ga0098058_1060645 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1055 | Open in IMG/M |
| 3300006751|Ga0098040_1076087 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300006754|Ga0098044_1066216 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
| 3300006789|Ga0098054_1121882 | Not Available | 970 | Open in IMG/M |
| 3300006916|Ga0070750_10364580 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 608 | Open in IMG/M |
| 3300006924|Ga0098051_1018522 | All Organisms → Viruses → Predicted Viral | 2031 | Open in IMG/M |
| 3300006925|Ga0098050_1098009 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 750 | Open in IMG/M |
| 3300006927|Ga0098034_1071937 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300007647|Ga0102855_1111287 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 733 | Open in IMG/M |
| 3300008012|Ga0075480_10016023 | All Organisms → Viruses → Predicted Viral | 4641 | Open in IMG/M |
| 3300008050|Ga0098052_1242319 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 691 | Open in IMG/M |
| 3300008050|Ga0098052_1345949 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 557 | Open in IMG/M |
| 3300009507|Ga0115572_10079749 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1997 | Open in IMG/M |
| 3300009705|Ga0115000_10350751 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 947 | Open in IMG/M |
| 3300010149|Ga0098049_1030696 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300010150|Ga0098056_1105631 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 960 | Open in IMG/M |
| 3300010151|Ga0098061_1083661 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1202 | Open in IMG/M |
| 3300010151|Ga0098061_1095831 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1108 | Open in IMG/M |
| 3300010153|Ga0098059_1268857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 655 | Open in IMG/M |
| 3300010155|Ga0098047_10044894 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1750 | Open in IMG/M |
| 3300010155|Ga0098047_10194206 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 779 | Open in IMG/M |
| 3300010155|Ga0098047_10194302 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 778 | Open in IMG/M |
| 3300010883|Ga0133547_10591453 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 2221 | Open in IMG/M |
| 3300010883|Ga0133547_11108049 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300010883|Ga0133547_11579349 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1227 | Open in IMG/M |
| 3300011013|Ga0114934_10513065 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 530 | Open in IMG/M |
| 3300012928|Ga0163110_10187287 | Not Available | 1459 | Open in IMG/M |
| 3300012928|Ga0163110_10327463 | Not Available | 1129 | Open in IMG/M |
| 3300012928|Ga0163110_10765867 | Not Available | 757 | Open in IMG/M |
| 3300012952|Ga0163180_10963370 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 681 | Open in IMG/M |
| 3300012954|Ga0163111_10626180 | Not Available | 1007 | Open in IMG/M |
| 3300013115|Ga0171651_1015217 | All Organisms → Viruses → Predicted Viral | 2810 | Open in IMG/M |
| 3300017708|Ga0181369_1010799 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 2332 | Open in IMG/M |
| 3300017713|Ga0181391_1032746 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1262 | Open in IMG/M |
| 3300017730|Ga0181417_1097685 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 710 | Open in IMG/M |
| 3300017731|Ga0181416_1045326 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300017745|Ga0181427_1132571 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 606 | Open in IMG/M |
| 3300017748|Ga0181393_1016515 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 2185 | Open in IMG/M |
| 3300017750|Ga0181405_1007883 | All Organisms → Viruses → Predicted Viral | 3090 | Open in IMG/M |
| 3300017752|Ga0181400_1089839 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 910 | Open in IMG/M |
| 3300017757|Ga0181420_1112015 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 834 | Open in IMG/M |
| 3300017759|Ga0181414_1160054 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 588 | Open in IMG/M |
| 3300017762|Ga0181422_1228680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 554 | Open in IMG/M |
| 3300017765|Ga0181413_1136471 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 742 | Open in IMG/M |
| 3300017765|Ga0181413_1156032 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 687 | Open in IMG/M |
| 3300017767|Ga0181406_1212811 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 572 | Open in IMG/M |
| 3300017772|Ga0181430_1172055 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 625 | Open in IMG/M |
| 3300017781|Ga0181423_1160047 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 865 | Open in IMG/M |
| 3300017782|Ga0181380_1241856 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 600 | Open in IMG/M |
| 3300017783|Ga0181379_1317893 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 527 | Open in IMG/M |
| 3300017786|Ga0181424_10133662 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1067 | Open in IMG/M |
| 3300017956|Ga0181580_10769796 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 608 | Open in IMG/M |
| 3300017967|Ga0181590_10460576 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 892 | Open in IMG/M |
| 3300017969|Ga0181585_10079478 | All Organisms → Viruses → Predicted Viral | 2497 | Open in IMG/M |
| 3300017986|Ga0181569_10426060 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 905 | Open in IMG/M |
| 3300018417|Ga0181558_10245613 | Not Available | 1001 | Open in IMG/M |
| 3300018420|Ga0181563_10164193 | Not Available | 1383 | Open in IMG/M |
| 3300020169|Ga0206127_1163251 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 847 | Open in IMG/M |
| 3300020207|Ga0181570_10109655 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1553 | Open in IMG/M |
| 3300020257|Ga0211704_1071720 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 520 | Open in IMG/M |
| 3300020365|Ga0211506_1151310 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 654 | Open in IMG/M |
| 3300020366|Ga0211489_10220390 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 534 | Open in IMG/M |
| 3300020367|Ga0211703_10187902 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 540 | Open in IMG/M |
| 3300020402|Ga0211499_10052333 | All Organisms → Viruses → Predicted Viral | 1588 | Open in IMG/M |
| 3300020414|Ga0211523_10162037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 934 | Open in IMG/M |
| 3300020417|Ga0211528_10309672 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 590 | Open in IMG/M |
| 3300020438|Ga0211576_10433501 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 669 | Open in IMG/M |
| 3300020448|Ga0211638_10606883 | Not Available | 514 | Open in IMG/M |
| 3300020451|Ga0211473_10331797 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 780 | Open in IMG/M |
| 3300020456|Ga0211551_10278443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 795 | Open in IMG/M |
| 3300020470|Ga0211543_10109070 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300020470|Ga0211543_10295274 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 788 | Open in IMG/M |
| 3300020470|Ga0211543_10363936 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300020470|Ga0211543_10471033 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 599 | Open in IMG/M |
| 3300020474|Ga0211547_10081290 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300020474|Ga0211547_10240578 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 924 | Open in IMG/M |
| 3300020474|Ga0211547_10526154 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 590 | Open in IMG/M |
| 3300023116|Ga0255751_10384479 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 700 | Open in IMG/M |
| 3300025072|Ga0208920_1032293 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300025084|Ga0208298_1014431 | All Organisms → Viruses → Predicted Viral | 1857 | Open in IMG/M |
| 3300025086|Ga0208157_1107787 | Not Available | 661 | Open in IMG/M |
| 3300025096|Ga0208011_1006577 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 3419 | Open in IMG/M |
| 3300025112|Ga0209349_1172614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 568 | Open in IMG/M |
| 3300025127|Ga0209348_1178685 | Not Available | 607 | Open in IMG/M |
| 3300025131|Ga0209128_1135403 | Not Available | 753 | Open in IMG/M |
| 3300025131|Ga0209128_1210014 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 542 | Open in IMG/M |
| 3300025132|Ga0209232_1070133 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1233 | Open in IMG/M |
| 3300025132|Ga0209232_1085289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300025133|Ga0208299_1172948 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 661 | Open in IMG/M |
| 3300025141|Ga0209756_1234813 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 681 | Open in IMG/M |
| 3300025151|Ga0209645_1101318 | Not Available | 933 | Open in IMG/M |
| 3300025151|Ga0209645_1157482 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 696 | Open in IMG/M |
| 3300025168|Ga0209337_1023777 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 3513 | Open in IMG/M |
| 3300025592|Ga0209658_1083218 | Not Available | 772 | Open in IMG/M |
| 3300025665|Ga0209360_1028719 | All Organisms → Viruses → Predicted Viral | 2047 | Open in IMG/M |
| 3300025769|Ga0208767_1112695 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300025816|Ga0209193_1020565 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 2095 | Open in IMG/M |
| 3300025816|Ga0209193_1020986 | All Organisms → Viruses → Predicted Viral | 2068 | Open in IMG/M |
| 3300026257|Ga0208407_1028252 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1957 | Open in IMG/M |
| 3300026321|Ga0208764_10198924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 994 | Open in IMG/M |
| 3300027522|Ga0209384_1076165 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 842 | Open in IMG/M |
| 3300027714|Ga0209815_1006885 | All Organisms → cellular organisms → Bacteria | 5791 | Open in IMG/M |
| 3300027714|Ga0209815_1044932 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1636 | Open in IMG/M |
| 3300027779|Ga0209709_10054884 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 2276 | Open in IMG/M |
| 3300027779|Ga0209709_10318494 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 653 | Open in IMG/M |
| 3300028022|Ga0256382_1150041 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 559 | Open in IMG/M |
| 3300028274|Ga0257119_1020760 | All Organisms → Viruses → Predicted Viral | 2162 | Open in IMG/M |
| 3300028277|Ga0257116_1172156 | Not Available | 512 | Open in IMG/M |
| 3300028418|Ga0228615_1138813 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 635 | Open in IMG/M |
| 3300029318|Ga0185543_1116213 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 502 | Open in IMG/M |
| 3300031519|Ga0307488_10182258 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1440 | Open in IMG/M |
| 3300031519|Ga0307488_10433077 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 804 | Open in IMG/M |
| 3300031598|Ga0308019_10188282 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 804 | Open in IMG/M |
| 3300032278|Ga0310345_11784927 | Not Available | 600 | Open in IMG/M |
| 3300032820|Ga0310342_100950097 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 39.85% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 17.29% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.53% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 6.02% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.01% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.26% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.26% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.50% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.50% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.50% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.50% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.50% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.50% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.50% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.75% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.75% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.75% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.75% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.75% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300005424 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013115 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020257 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX555911-ERR599048) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020366 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025592 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025665 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300026210 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028274 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_200m | Environmental | Open in IMG/M |
| 3300028277 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120m | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101101203 | 3300000115 | Marine | MIEFTPKQIQDNWIKLIQLIEDTFEGERKEKLLEMY |
| DelMOWin2010_100345491 | 3300000117 | Marine | MKQLTEKQILDNWNKLMKLIEDTFEGERKEKLLEMYKHFENRMVTAPAS |
| BBAY94_101355521 | 3300000949 | Macroalgal Surface | MKQLTEQQIVDNWNKLMKLIEDTFEGDRLKKLKTMYTYFEDRMS |
| BBAY93_100950471 | 3300000973 | Macroalgal Surface | MKQLTEQQIVDNWNKLMKLIEDTFEGDRLKRLKTMYTYFEDRM |
| JGI25132J35274_10900822 | 3300002483 | Marine | MKQLTEQQILDNWNNLMQLINDTFTGDRRDNLXNMYKYFEDRMSVAPASGKAD |
| JGI25128J35275_10910551 | 3300002488 | Marine | MKQLTEQQILDNWDKLMKLIEDTFEGDRKDKLLKMYKYFEDRMSVAPASGKA |
| JGI25128J35275_11064001 | 3300002488 | Marine | MKQLTEKQIVENWGKLIQLIEDTFDGDRKEKLLEMYKYFEDR |
| JGI25134J35505_101162861 | 3300002518 | Marine | MNSEKLLNNWNKLTQIIESTFSGERKTKLLKMYEHFKDRMMFAPASGQQHF |
| Ga0066826_102789611 | 3300005424 | Marine | MKQLTETQLLDNWNKLLQLIEDTFEGERKEKLLEMYKFFEDRM |
| Ga0066862_100294121 | 3300005521 | Marine | MKQLTENQLLDNWNKLLQLVEDTFEGERKEKLLEMY |
| Ga0066862_103045583 | 3300005521 | Marine | MKQLTENQLLDNWNKLLQLVEDTFEGERKEKLLEMYKFF |
| Ga0066850_101700261 | 3300005605 | Marine | MKQLTEEQLQDNWEKLLQLIEDMFEGERKTRLLEMYKDLEDRMV |
| Ga0075445_102649503 | 3300006193 | Marine | MKQLTEQQILDNWNKLMSVIEDTFDGERKEKLLKMYK |
| Ga0099954_10095011 | 3300006350 | Marine | MKQLTEEQLLGNWEKLLQLIEDTFEGDRKEKLLEM |
| Ga0098033_11539222 | 3300006736 | Marine | MKLTAEQIELNWKTLINLIEDTFRGERKENLLKMYNHFQ |
| Ga0098058_10606453 | 3300006750 | Marine | MKQLSEQQIIDNWNKLIKLIEDTFQGERKDKLLEMYKYFED |
| Ga0098040_10760873 | 3300006751 | Marine | MKQLSEQQIVDNWNKLMKLIEDTFDGDRLKKLKTMYIY |
| Ga0098044_10662163 | 3300006754 | Marine | MKQLSEQQIVDNWNKLMKLIDDTFVDTDENERHTKLREMYDYFEDRMSIA |
| Ga0098054_11218821 | 3300006789 | Marine | MNSEKLLDNWNKLTQIIESTFSGERKTKLLKMYEHFKDRMMFAPA |
| Ga0070750_103645802 | 3300006916 | Aqueous | MIEFTPEQIQENWNKLIQLIEDTFEGERKEKLLEMYSHFE |
| Ga0098051_10185224 | 3300006924 | Marine | MKQLTAEQIDLNWKALIDLIEDTFEGERKENLLKMYNHFQ* |
| Ga0098050_10980091 | 3300006925 | Marine | MKQLSEQQIVDNWNKLMQLIEDTFDGERKEKLLKMY |
| Ga0098034_10719371 | 3300006927 | Marine | MKQLTAEQIDLNWKALIDLIEDTFEGERKENLLKMYNH |
| Ga0102855_11112872 | 3300007647 | Estuarine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRM |
| Ga0075480_100160235 | 3300008012 | Aqueous | MKQLTEQQIVDNWNKLIQLIEDTFDGERKEKLLEMYKYFEN |
| Ga0098052_12423191 | 3300008050 | Marine | MKQLSEQQIIDNWNKLIKLIEDTFQGERKVNLMVMYKYFEDRM |
| Ga0098052_13459492 | 3300008050 | Marine | MKQLSEQQILDNWNKLIKLIEDTFQGERKVNLMVMYKYFEDRMSVAPASGKAAYH |
| Ga0115572_100797491 | 3300009507 | Pelagic Marine | MKQLTEKQILDNWNKLMKLIEDTFEGERKEKLLKMYK |
| Ga0115000_103507512 | 3300009705 | Marine | MKQLTEEQILENWNKLIKLIEDTFEGERKDKLLEMYKYFEDRMSVAPAS |
| Ga0114999_102823911 | 3300009786 | Marine | MLQANKIEENWESLIQLIEDNFEGERKEKLLEMYSHFKE |
| Ga0098049_10306963 | 3300010149 | Marine | MKQLTEKQIVDNWNKLMKLIEDTFEGERKEKLLKMYKYFEN |
| Ga0098056_11056311 | 3300010150 | Marine | MKQLTEQQIVDNWNKLMKLIEDTFEGERKEKLLKMYEYFE |
| Ga0098061_10836611 | 3300010151 | Marine | MKQLSEQQILDNWNKLIKLIEDTFQGERKVNLMVMYKYFEDRMSVAPASGKAAYHNAMVG |
| Ga0098061_10958311 | 3300010151 | Marine | MKQLSEQQIIDNWNKLIKLIEDTFTGERKVNLMVMYKYFEDRMSV |
| Ga0098059_12688571 | 3300010153 | Marine | MKQLTEQQILDNWNKLMKLIEDTLEGDRKDKLLEMYKYFEDRMS |
| Ga0098047_100448943 | 3300010155 | Marine | MKKLTAEQIEMNWQTLMGIIDNTFVDTDDNERHTKLCEMYDDLKDR |
| Ga0098047_101942061 | 3300010155 | Marine | MKQLSEQQIVDNWNKLIKLIEDTFEGERKVNLMVMYKYFEDRMSVAPASGKAH |
| Ga0098047_101943023 | 3300010155 | Marine | MKQLSEQQIIDNWNKLIKLIEDTFQGERKVNLMVMYKYFEDRMSVAPASGKAAYHNAMVGGYV |
| Ga0133547_105914535 | 3300010883 | Marine | MKQLTEQQIVDNWNKLIKLIEDTFQGERKDKLLGMYKYFE |
| Ga0133547_111080493 | 3300010883 | Marine | MKLTAEQIELNWKTFIGLIEDTFEGERQEKLLKMYN |
| Ga0133547_115793491 | 3300010883 | Marine | MKHLSEQQIVNNWNKLIKLIEDTFQGERKDKLLGMYKYFEDRMS |
| Ga0114934_105130651 | 3300011013 | Deep Subsurface | MKQLTENQLLDNWQKLLQLVEDTFEGERKEKLLEMYKFFENRMIVAPA |
| Ga0163110_101872871 | 3300012928 | Surface Seawater | MKQLTPEQIVNNWNELIQLIEGEFDGERKEKLLEMYKYFEDRM |
| Ga0163110_103274631 | 3300012928 | Surface Seawater | MKQLTEEQLLGNWKKLLQLVEETFEGERKERLLEMYKYF |
| Ga0163110_107658673 | 3300012928 | Surface Seawater | MKQLTEEQLLGNWNKLLQLVEDTFEGERKERLLEMYEFFEDRMVVA |
| Ga0163180_109633701 | 3300012952 | Seawater | MKQLTEKQIVDNWNKLMKLIEDTFEGERKEKLLKMYKYFENRMSTAP |
| Ga0163111_106261801 | 3300012954 | Surface Seawater | MKQLTEEQLLSNWKKLLQLVEDTFEGERKERLLEMYEFYEDRMVVAPASGKEEYHYC |
| Ga0171651_10152175 | 3300013115 | Marine | MKNKMKELTPEQIQENWNKLVQLVEDTFEGERKEN |
| Ga0181369_10107991 | 3300017708 | Marine | MKQLTEKQIIENWDKLMKLIDDTFEGERKEKLLEMYKYFEDRMSV |
| Ga0181391_10327462 | 3300017713 | Seawater | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDR |
| Ga0181417_10976854 | 3300017730 | Seawater | MKQLTEKQILDNWNKLIKLIEDTFDGERKEKLLEMYKYFENRMVTAPASGK |
| Ga0181416_10453263 | 3300017731 | Seawater | MKQLTEQQILDNWNKLMKLIEDTFDGERKEKLLEMYKYFENRMV |
| Ga0181427_11325712 | 3300017745 | Seawater | MKQLTEQQILDNWNKLIKLIEDTFQDEKKDKLLEMYKYFEDRMSVAPASGKAAYH |
| Ga0181393_10165151 | 3300017748 | Seawater | MKQLSEQQILDNWNKLIKLIEDTFDGERKEKLLEMYKY |
| Ga0181405_10078835 | 3300017750 | Seawater | MKQLTEKQILDNWNKLIKLIEDTFEGERKEKLLEMYKYFENRMVTAPASGKAAY |
| Ga0181400_10898391 | 3300017752 | Seawater | MRQLSEEKILANWNRLMKLIEDTFDEERKDNLLEMYKYFEDRMS |
| Ga0181420_11120151 | 3300017757 | Seawater | MKQLTEKQIVDNWNKLMKLIEDTFEGERKEKLLKMYKYFENRMSIAPS |
| Ga0181414_11600541 | 3300017759 | Seawater | MKQLSEKQILDNWNKLMQLIEDTFSGERKEKLLEMYKYFEDRMSVAPASGKAA |
| Ga0181422_12286801 | 3300017762 | Seawater | MKQLTEQQIVDNWNKLMKLIEDTFEGERKDKLLEMYKYFE |
| Ga0181413_11364713 | 3300017765 | Seawater | MIKFTAEQIQENWDQLIQLIEDTFEGERKEKLLKMYKHFE |
| Ga0181413_11560321 | 3300017765 | Seawater | MKQLTEKQILDNWNKLMKLIEDTFDGERKEKLLEMYKYFEN |
| Ga0181406_12128113 | 3300017767 | Seawater | MKQLTEKQILDNWNKLMKLIEDTFDGERKEKLLEMYKYFENRMVTAP |
| Ga0181430_11720553 | 3300017772 | Seawater | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLKMYK |
| Ga0181423_11600472 | 3300017781 | Seawater | MIKFTPEQIQDNWNELIKLIEDTFEGERKEKLLEMYGHFE |
| Ga0181380_12418563 | 3300017782 | Seawater | MKQLTEKQIVENWESLMKLIEDTFDGERKEKLLGMYKYFEDRMSVAP |
| Ga0181379_13178931 | 3300017783 | Seawater | MIKFTAEQIQENWDQLIQLIEDTFEGERKEKLLKMY |
| Ga0181424_101336623 | 3300017786 | Seawater | MIKFTAEQKQENWDQLIQLIEDTFEGERKEKLLKMYKHFEDRMCF |
| Ga0181580_107697961 | 3300017956 | Salt Marsh | MKQLTEQQIVDNWNKLIQLIENTFDGERKEKLLEMYKYFENRMSVAPASGK |
| Ga0181590_104605763 | 3300017967 | Salt Marsh | MKQLTEQQIVDNWNKLIQLIENTFDGERKEKLLEMYKYFENRMSVAPA |
| Ga0181585_100794784 | 3300017969 | Salt Marsh | MKQLTEQQIVDNWNKLIQLIENTFDGERKEKLLEMYKYFEN |
| Ga0181569_104260601 | 3300017986 | Salt Marsh | MKQLTEKQIIENWDKLMKLIEDTFDGERKEKLLEMYKYFEDR |
| Ga0181558_102456131 | 3300018417 | Salt Marsh | MKQLTEEQLLGNWNKLLQLVEDTFEGERKERLLEMYKYFEDRMVVAPASGKEEYHYCYAG |
| Ga0181563_101641931 | 3300018420 | Salt Marsh | MKQLTEEQLLGNWNKLLQLVEDTFEGERKERLLEM |
| Ga0206127_11632511 | 3300020169 | Seawater | MKQLTEQQIVDNWNKLMKLIEDTFEGERKEKLLKMYKYFED |
| Ga0181570_101096551 | 3300020207 | Salt Marsh | MKQLTEQQILDNWNKLIKLIEDTFEGERKEKLLEMYKY |
| Ga0211704_10717201 | 3300020257 | Marine | MKQLTEEQLLGNWKKLLQLVEDTFEGERKERLLEMYEFFEDRMVVAPASGKEEYHYCYA |
| Ga0211506_11513101 | 3300020365 | Marine | MKQLTEQQIVDNWNKLIQLIENTFDGERKEKLLEMYKYFENRMSVAPASGKAAY |
| Ga0211489_102203903 | 3300020366 | Marine | MKQLTEEQLLGNWNKLLQLVEDTFEGERKERLLEMYKYFEDRMVVAPASGKEEFHY |
| Ga0211703_101879023 | 3300020367 | Marine | MKQLTEEQLLGNWKKLLQLVEDTFEGERKERLLEMYEFFEDRMVVAPAS |
| Ga0211499_100523331 | 3300020402 | Marine | MKQLTEEQLLGNWNKLLQLVEDTFEGERKERLLEMYKYFEDRMVVAPA |
| Ga0211523_101620372 | 3300020414 | Marine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRMSLAPASG |
| Ga0211528_103096721 | 3300020417 | Marine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRMSL |
| Ga0211576_104335013 | 3300020438 | Marine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRMVTAPASGKAA |
| Ga0211638_106068833 | 3300020448 | Marine | MKQLTEEQLLGNWNKLLQLVEDTFEGERKERLLEMYEFFEDR |
| Ga0211473_103317973 | 3300020451 | Marine | MKQLSEQQIIDNWNKLIKLIEDTFQDERKEKLLGMYKYFED |
| Ga0211551_102784433 | 3300020456 | Marine | MKQLTEQQIVDNWNKLMKLIEDTFEGDRLKKLKTMYTYF |
| Ga0211543_101090701 | 3300020470 | Marine | MIKFTPEQIQDNWNELIQLIEDTFEGKRKEQLLKMYGHFEDRMC |
| Ga0211543_102952741 | 3300020470 | Marine | MKQLTEQQIVDNWNKLIQLIEDTFQGERKDKILEMYKYFEDRMSVAPASGKAAYHN |
| Ga0211543_103639362 | 3300020470 | Marine | MIRELTSEQIVDNWGDLIKLINDTFDGERKEKLLKMY |
| Ga0211543_104710331 | 3300020470 | Marine | MIEFTPEQIQENWNKLIQLIEDTFEGERKEKLLEMYSHFEDR |
| Ga0211547_100812903 | 3300020474 | Marine | MIQFTEQQIIDNWNKLIQLIEDTFEGERKEKLLEMYKHFENRMCVAPASG |
| Ga0211547_102405781 | 3300020474 | Marine | MKQLTEQQILDNWNKLMKLIEDTFEGNRKDKLLKMYKYFED |
| Ga0211547_105261541 | 3300020474 | Marine | MKQLTEKQIVDNWNKLMQLIEDTFEGDRLRKLKTMYTYFEDRMSVAPASGKAAYHNAM |
| Ga0255751_103844793 | 3300023116 | Salt Marsh | MKQLTEQQIVDNWNKLIQLIENTFDGERKEKLLEMYKYFENRMSVAPASGKAA |
| Ga0208920_10322932 | 3300025072 | Marine | MKQLTAEQIDLNWKALIDLIEDTFEGERKENLLKMYN |
| Ga0208298_10144311 | 3300025084 | Marine | MKQLTAEQIDLNWKALIDLIEDTFEGERKENLLKM |
| Ga0208157_11077872 | 3300025086 | Marine | MKQLTEKQIIENWDKLMKLIEDTFDGERKEKLLEMYKYF |
| Ga0208011_10065771 | 3300025096 | Marine | MKQLSEQQIVDNWNKLMQLVEDTFSGDRLKKLKTMYDYFEDRM |
| Ga0209349_11726141 | 3300025112 | Marine | MLELTAEQLQENWDKLIQLIEDTFEGERKEKLLKMYE |
| Ga0209348_11786853 | 3300025127 | Marine | MKQLTEEQLLGNWKKLLQLIEDTFEGDRKEKLLEMYKYFED |
| Ga0209128_11354033 | 3300025131 | Marine | MKQLTENQLLDNWNKLLQLVEDTFEGERKEKLLEMYKF |
| Ga0209128_12100142 | 3300025131 | Marine | MKLTAEQIELNWNTLIQIIDDTFIDTEDNERHTKLREMYDCFKDRMMFAP |
| Ga0209232_10701331 | 3300025132 | Marine | MKQLTEKQIVENWGKLIQLIEDTFDGDRKEKLLEMYKYFEDRMSVA |
| Ga0209232_10852891 | 3300025132 | Marine | MKQLTEQQILDNWNNLMQLINDTFTGDRRDNLLNMYKYFEDRMSV |
| Ga0208299_11729483 | 3300025133 | Marine | MKQLSEQQIIDNWNKLIKLIEDTFQGERKEKLLEMYKYFEDRMSVAPASG |
| Ga0209756_12348131 | 3300025141 | Marine | MKLTAEQIEQNWIKLINLIEDTFEGERKEKLLKMYDD |
| Ga0209645_11013183 | 3300025151 | Marine | MKQLTEEQLLSNWEKLLQLIEDTFEGDRKEKLLEMYKY |
| Ga0209645_11574821 | 3300025151 | Marine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRMSLAPAS |
| Ga0209337_10237775 | 3300025168 | Marine | MRQLSEEKILANWNRLMKLIEDTFDEERKDNLLEMYKYFEDRMSVAPASGKAA |
| Ga0209658_10832181 | 3300025592 | Marine | MKELTPEQIQENWNKLIQLVEDTFEGERKENLLKMYEYF |
| Ga0209360_10287191 | 3300025665 | Marine | MKQLTETQLVDNWNKLLQLIEDTFEGERKDRLLEMYKFFEDRM |
| Ga0208767_11126951 | 3300025769 | Aqueous | MKQLTEKQILDNWNKLMKLIEDTFDGERKEKLLEMYKYFE |
| Ga0209193_10205654 | 3300025816 | Pelagic Marine | MKQLTEKQILDNWNKLMKLIEDTFEGERKEKLLKMYKYFENRMS |
| Ga0209193_10209864 | 3300025816 | Pelagic Marine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKHFENR |
| Ga0208642_10088441 | 3300026210 | Marine | MLKANQIEENWESLIQLIEDNFEGERKEKLLEMYSHFKER |
| Ga0208407_10282524 | 3300026257 | Marine | MKQLTEQQIVDNWNKLMKLIDDTFVDTDENERHTKLREMYDYFEDRMSVA |
| Ga0208411_10237723 | 3300026279 | Marine | MLKANQIEENWESLIQLIEDNFEGERKDKLLEMYSHFKERM |
| Ga0208764_101989241 | 3300026321 | Marine | MKQLSEQQIVDNWNKLMKLIDDTFVDTDENERHTKLREMYDYFEDRMSIAPASGKAAYHN |
| Ga0209384_10761653 | 3300027522 | Marine | MKQLSEQKILGNWNRLIKLIEDTFEGERKDNLLEMYKYFEDRMSVA |
| Ga0209815_10068857 | 3300027714 | Marine | MKQLTEQKILGNWNRLIKLIEDTFEGERKDNLLEMYKYFEDR |
| Ga0209815_10449323 | 3300027714 | Marine | MKQLTEQKILGNWNRLIKLVEDTFEGERKDKLLKMYKHFEDRMV |
| Ga0209709_100548841 | 3300027779 | Marine | MKQLTEQQIVDNWNKLIKLIEDTFQGERKDKLLGMYKYFEDRMSVAPASGKAAY |
| Ga0209709_103184941 | 3300027779 | Marine | MKQLTEQQILDNWNKLIKLVEDTFEGERKEKLIKMYKHFEDRM |
| Ga0256382_11500411 | 3300028022 | Seawater | MIKFTPEQIQDNWNELIQLIEDTFEGKRKEKLLKMYGHFEDRMCVAP |
| Ga0257119_10207601 | 3300028274 | Marine | MKQLTETQLVDNWNKLLQLIEDTFEGERKDRLLEMYK |
| Ga0257116_11721562 | 3300028277 | Marine | MKELTPEQIQENWNKLIQLVEDTFEGERKENLLKMYEYFE |
| Ga0228615_11388132 | 3300028418 | Seawater | MRQLSEEKILANWNRLMKLIEDTFDEERKDNLLEMYKYFEDRMSVAPASGKAAY |
| Ga0185543_11162131 | 3300029318 | Marine | MKQLTEQQILDNWNKLMKLIEDTFEGERKEKLLEMYKYFEDRMS |
| Ga0307488_101822581 | 3300031519 | Sackhole Brine | MNLTEEQILDNWNKLIQSIEDNFEGDRKNKLLELYNKLGET |
| Ga0307488_104330771 | 3300031519 | Sackhole Brine | MKQLTEQQILDNWNKLMQLIEDTFDGERKERLIEMYKYFEDRMSVAPASGKAAYHNAMVGGYVE |
| Ga0308019_101882822 | 3300031598 | Marine | MIQFTPEQIQDNWKELIQLIEDTFEGERQDKLLKMYNHFED |
| Ga0310345_117849272 | 3300032278 | Seawater | MKLTAEQIQNNWNKLITIVEETFEGERKENLLKMYTHFQDRMM |
| Ga0310342_1009500973 | 3300032820 | Seawater | MKQLTETQLVDNWNKLLQLIEDTFDGERKDRLLEMYKFFEDRMLVAPASGKEEYHYCY |
| ⦗Top⦘ |