Basic Information | |
---|---|
Family ID | F060079 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 50 residues |
Representative Sequence | TPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKTATQ |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 93.98 % |
% of genes from short scaffolds (< 2000 bps) | 90.98 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.985 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (8.271 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.639 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.932 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.63% β-sheet: 0.00% Coil/Unstructured: 47.37% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF04011 | LemA | 95.49 |
PF03319 | EutN_CcmL | 3.01 |
PF00596 | Aldolase_II | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 95.49 |
COG4576 | Carboxysome shell and ethanolamine utilization microcompartment protein CcmK/EutM | Energy production and conversion [C] | 6.02 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.98 % |
Unclassified | root | N/A | 6.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000531|CNBas_1008826 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300000955|JGI1027J12803_108010162 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300004114|Ga0062593_100623419 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300004114|Ga0062593_102927318 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300004157|Ga0062590_101901443 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300004480|Ga0062592_101528817 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300004480|Ga0062592_101645160 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300004643|Ga0062591_101115515 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300004643|Ga0062591_102603949 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005093|Ga0062594_101516329 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005178|Ga0066688_10957896 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005289|Ga0065704_10590329 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300005290|Ga0065712_10221017 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300005293|Ga0065715_10986923 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005295|Ga0065707_10581248 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005331|Ga0070670_100897042 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005332|Ga0066388_100361407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2098 | Open in IMG/M |
3300005334|Ga0068869_100492739 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300005334|Ga0068869_100495032 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300005334|Ga0068869_101319180 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005337|Ga0070682_100884984 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005353|Ga0070669_101956081 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005354|Ga0070675_100764883 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300005366|Ga0070659_100773567 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005438|Ga0070701_10503007 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300005440|Ga0070705_101140016 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005445|Ga0070708_101288123 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005445|Ga0070708_101676659 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005456|Ga0070678_101451239 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005457|Ga0070662_100451591 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300005545|Ga0070695_100958577 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005546|Ga0070696_100339347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300005549|Ga0070704_100799484 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005564|Ga0070664_101149966 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005577|Ga0068857_100865170 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300005577|Ga0068857_101068464 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005616|Ga0068852_100954053 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300005616|Ga0068852_102733009 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005617|Ga0068859_100185041 | All Organisms → cellular organisms → Bacteria | 2167 | Open in IMG/M |
3300005840|Ga0068870_10558977 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005841|Ga0068863_100914787 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300005841|Ga0068863_100923817 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300005843|Ga0068860_102055954 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005844|Ga0068862_100709959 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300006237|Ga0097621_100285562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1454 | Open in IMG/M |
3300006358|Ga0068871_102241683 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300006871|Ga0075434_100734259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
3300006881|Ga0068865_100677608 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300006904|Ga0075424_100619646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1155 | Open in IMG/M |
3300006931|Ga0097620_102000169 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300009093|Ga0105240_11744716 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300009098|Ga0105245_12229200 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300009148|Ga0105243_12621135 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300009162|Ga0075423_12545347 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009545|Ga0105237_11912546 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300009545|Ga0105237_12054068 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300009840|Ga0126313_10129426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1887 | Open in IMG/M |
3300010037|Ga0126304_10417597 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300010040|Ga0126308_10184157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1336 | Open in IMG/M |
3300010166|Ga0126306_11222199 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300010362|Ga0126377_13036975 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300010397|Ga0134124_10378194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1341 | Open in IMG/M |
3300010399|Ga0134127_10368061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1410 | Open in IMG/M |
3300010399|Ga0134127_12320370 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300010400|Ga0134122_10277263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1428 | Open in IMG/M |
3300011119|Ga0105246_11341278 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300011119|Ga0105246_11900626 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300012469|Ga0150984_108944923 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300012496|Ga0157353_1032795 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012907|Ga0157283_10296216 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012957|Ga0164303_10843175 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300013297|Ga0157378_11031027 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300013308|Ga0157375_12068571 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300013308|Ga0157375_13067325 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300014325|Ga0163163_12465375 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300014325|Ga0163163_12918604 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300014326|Ga0157380_11174129 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300014745|Ga0157377_10125348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1562 | Open in IMG/M |
3300015262|Ga0182007_10049401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1389 | Open in IMG/M |
3300015371|Ga0132258_11441258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1739 | Open in IMG/M |
3300015372|Ga0132256_101554826 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300015374|Ga0132255_105320805 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300018481|Ga0190271_13226457 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300019361|Ga0173482_10693548 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300025899|Ga0207642_10363799 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300025901|Ga0207688_10673769 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300025904|Ga0207647_10359279 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300025907|Ga0207645_10828424 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300025911|Ga0207654_10088197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1884 | Open in IMG/M |
3300025911|Ga0207654_10504150 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300025911|Ga0207654_10742879 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300025918|Ga0207662_10246643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1171 | Open in IMG/M |
3300025918|Ga0207662_10338454 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300025921|Ga0207652_11554833 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300025925|Ga0207650_10993050 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300025925|Ga0207650_11238647 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300025926|Ga0207659_10410507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1134 | Open in IMG/M |
3300025931|Ga0207644_11343754 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300025932|Ga0207690_11088924 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300025932|Ga0207690_11309900 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025941|Ga0207711_11894241 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300025945|Ga0207679_10418524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1182 | Open in IMG/M |
3300025945|Ga0207679_10984966 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300025949|Ga0207667_11157681 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300025949|Ga0207667_12218096 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300026023|Ga0207677_12081735 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300026035|Ga0207703_10061210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3081 | Open in IMG/M |
3300026035|Ga0207703_11971896 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300026075|Ga0207708_11919428 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300026088|Ga0207641_10086622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2731 | Open in IMG/M |
3300026095|Ga0207676_11088280 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300026095|Ga0207676_11685943 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300026116|Ga0207674_10459140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1231 | Open in IMG/M |
3300026142|Ga0207698_11337755 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300027326|Ga0209731_1025242 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300027787|Ga0209074_10243469 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300030499|Ga0268259_10064146 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300031538|Ga0310888_10403026 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300031740|Ga0307468_101334558 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300031854|Ga0310904_11183403 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300031911|Ga0307412_11315360 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300032004|Ga0307414_11316872 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300032012|Ga0310902_11003848 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300032122|Ga0310895_10749194 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300033475|Ga0310811_11463785 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.02% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.02% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.26% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.76% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.76% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.01% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.01% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.01% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.01% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.50% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.75% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.75% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
CNBas_10088261 | 3300000531 | Quercus Rhizosphere | RVLKLDPTPFERIFDFRSDGRLPTSEKEANDLFGAYLFQIEQVVEAVDELGKSTQ* |
JGI1027J12803_1080101621 | 3300000955 | Soil | TVQLLRLDAEPFEKIFEFRASESLPRSESEANAIFGSYLFQIEQVVEAVDELKPT* |
Ga0062593_1006234191 | 3300004114 | Soil | RATVQLLRLDAEPFEKIFEFRTSDSLPRSESEANAIFGSYLFQIEQVVEAVDELKPT* |
Ga0062593_1029273181 | 3300004114 | Soil | LHLDPTPFERIFEFRASDRRPSSEIEANDLFGAYLFQIEQVVEAVDQLKTSTQ* |
Ga0062590_1019014431 | 3300004157 | Soil | PFERIFEFRASDRLPSSEKEAHELFGVYLFQIQQVVEAVDKLGEATQ* |
Ga0062592_1015288172 | 3300004480 | Soil | EFRASDRLPSSEKEAHELFGVYLFQIEQVVEAVDKLGEATQ* |
Ga0062592_1016451601 | 3300004480 | Soil | IFEFRAGGRFPGSEREANELFGAYMFQIEQVVEAVDELERRGN* |
Ga0062591_1011155151 | 3300004643 | Soil | PFERIFEFRASDRRPSSEIEANDLFGAYLFQIEQVVEAVDQLKTSTQ* |
Ga0062591_1026039491 | 3300004643 | Soil | EPFEKIFEFRTSDSLPRSESEANAIFGSYLFQIEQVVEAVDELKPT* |
Ga0062594_1015163291 | 3300005093 | Soil | EKIFEFRTSDSLPRSESEANAIFGSYLFQIEQVVEAVDELKPT* |
Ga0066688_109578962 | 3300005178 | Soil | PFEKIFEFRASDKLPSSEKEANEVFGAYLSRIEQVVEAVDQLETATG* |
Ga0065704_105903291 | 3300005289 | Switchgrass Rhizosphere | RANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ* |
Ga0065712_102210171 | 3300005290 | Miscanthus Rhizosphere | LDPKPFERIFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ* |
Ga0065715_109869232 | 3300005293 | Miscanthus Rhizosphere | ERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKTETT* |
Ga0065707_105812482 | 3300005295 | Switchgrass Rhizosphere | LDPAPFERIFEFRASDRLPSSEKEANDLFGAYLSQIEQVVEAVDQLGTATQ* |
Ga0070670_1008970421 | 3300005331 | Switchgrass Rhizosphere | KPFERIFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ* |
Ga0066388_1003614075 | 3300005332 | Tropical Forest Soil | KLDPAPFERIFEFRSSYSELPSEKEANEIFGAYLTEIEKVVEAVDELEQNNAGS* |
Ga0068869_1004927393 | 3300005334 | Miscanthus Rhizosphere | PFERIFEFRAGDRLPASEKEANELFAAYMFQIEQVVEAVDELERRGR* |
Ga0068869_1004950322 | 3300005334 | Miscanthus Rhizosphere | PFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ* |
Ga0068869_1005578123 | 3300005334 | Miscanthus Rhizosphere | TAKLLRLDPAPFERIFEFRTGGNLPTSDKEANDLFGAYLFQIEQVVEAVDNLPMGDVR* |
Ga0068869_1013191801 | 3300005334 | Miscanthus Rhizosphere | TPFERIFAFRSGGALPNSEKDANDLFGAYMLQIQHVVEAVDELERREELR* |
Ga0070666_103468811 | 3300005335 | Switchgrass Rhizosphere | PDVVRSTAKLLQLDPTPFERIFEFRASDRLPSSEKEANDLFGDYLFQIGQVVEAVDQLGTATQ* |
Ga0070682_1008849842 | 3300005337 | Corn Rhizosphere | PFERIFEFRANDRLPSSEKEANDLFGAYLLQIEQVVESVDQLGSTTQ* |
Ga0070669_1019560812 | 3300005353 | Switchgrass Rhizosphere | RIFEFRASDRLPSSEKEANDLFGAYLLQIERVVEAVDELGNTTQ* |
Ga0070675_1007648831 | 3300005354 | Miscanthus Rhizosphere | LLKLDPGPFERIFEFRAGDVSPRSESEANELFGAYMLQIERVVEAVDELTPSS* |
Ga0070688_1006886511 | 3300005365 | Switchgrass Rhizosphere | DVVRTTAKLLQLDPAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQIGTATQ* |
Ga0070659_1007735672 | 3300005366 | Corn Rhizosphere | PFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKT* |
Ga0070701_105030071 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ERIFQFRSSDRRPASEKDANDLFGAYLFQIEQVVEAVDQLEKATQ* |
Ga0070705_1011400162 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TARLLDLDPAPFERIFEFRTSDRLPSSEKEANDLFGAYLLQIERVVEAVDELGNTTQ* |
Ga0070708_1012881232 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QLDPTPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDQLGSTTQ* |
Ga0070708_1016766592 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DRDPFERIFEFRATDNLPKSESEANAIFADYMAQIETVVEAVDELQSGTGSRL* |
Ga0070678_1014512392 | 3300005456 | Miscanthus Rhizosphere | DPGPFERIFEFRAGDVSPRSESEANELFGAYMLQIERVVEAVDELTPSS* |
Ga0070662_1004515911 | 3300005457 | Corn Rhizosphere | LQLDPTPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDQIGTATQ* |
Ga0070695_1009585771 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EPFEKIFEFRTSNSLPRSESEANAIFGSYLFQIEQVVEAVDELKPT* |
Ga0070696_1003393471 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLTTATQ* |
Ga0070704_1007994841 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DPAPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVEAVDELKTATT* |
Ga0070664_1011499661 | 3300005564 | Corn Rhizosphere | VPFERIFEFRSSDRRPASEKDANDLFGVYLFQIEQVVEAVDQLEKATQ* |
Ga0068857_1008651701 | 3300005577 | Corn Rhizosphere | LQLDPAPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ* |
Ga0068857_1010684642 | 3300005577 | Corn Rhizosphere | DPAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKTETT* |
Ga0068852_1009540531 | 3300005616 | Corn Rhizosphere | LLHLDPTPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDELKTATT* |
Ga0068852_1027330092 | 3300005616 | Corn Rhizosphere | FEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ* |
Ga0068859_1001850411 | 3300005617 | Switchgrass Rhizosphere | RIFEFRAGDRLPSSENEAHELFGAYLFQIEQVVEAVDNLGEARQ* |
Ga0068870_105589772 | 3300005840 | Miscanthus Rhizosphere | AKLLQLDPAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQIGTATQ* |
Ga0068863_1009147871 | 3300005841 | Switchgrass Rhizosphere | RATVKLLNLEPGPFERIFEFRAGDVSPRSETEANELFGAYMLQIERVVEAVDELTPSS* |
Ga0068863_1009238172 | 3300005841 | Switchgrass Rhizosphere | FRASDRLPSSEKEANDLFGDYLVQIERVVESVDQIGTTTQ* |
Ga0068860_1020559542 | 3300005843 | Switchgrass Rhizosphere | LKLDPVPFERIFEFRASDRRPASEKDANDLFGAYLFQIEQVVEAVDELEKATQ* |
Ga0068862_1007099592 | 3300005844 | Switchgrass Rhizosphere | TARLLQLDPTPFERIFEFRASDRLPSSEKEANDLFGAYLLQIERVVEAVDELGKTTQ* |
Ga0097621_1002855621 | 3300006237 | Miscanthus Rhizosphere | LPSSEKEANDLFGAYLFQIEQVVEAVDQIGTATQ* |
Ga0068871_1022416832 | 3300006358 | Miscanthus Rhizosphere | FEFRASDRLPSSEIEANDLFGAYLFQIEQVVEAVDELKTATE* |
Ga0075433_116093802 | 3300006852 | Populus Rhizosphere | SDRLPSSEKEANDLFGAYLLQVEQVVEAVDELGN* |
Ga0075434_1007342591 | 3300006871 | Populus Rhizosphere | FERIFEFRTTGALPRSEKEANELFAAYMFQIEQVVEAVDELERRGN* |
Ga0068865_1006776081 | 3300006881 | Miscanthus Rhizosphere | DPKPFERIFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ* |
Ga0075424_1006196463 | 3300006904 | Populus Rhizosphere | PFERIFEFRTTGALPRSEKEANELFAAYMFQIEQVVEAVDELERRGN* |
Ga0097620_1020001691 | 3300006931 | Switchgrass Rhizosphere | VLKLDPAPFERIFNLRNDENLPSSEKEANDLFASYMFQIEQVVEAVDELRLTKGEE* |
Ga0105240_117447161 | 3300009093 | Corn Rhizosphere | RLPSSEIEANDLFGAYLFQIEQVVEAVDQLKTATQ* |
Ga0105245_122292001 | 3300009098 | Miscanthus Rhizosphere | LLHLDPTPFERIFEFRASDRLPSSAIEANDLFGAYLFQIEQVVEAVDQLKTATQ* |
Ga0105243_126211351 | 3300009148 | Miscanthus Rhizosphere | APFERIFEFRTSDRLPSSEKEANDLFGAYLLQIERVVEAVDELGKTTQ* |
Ga0075423_125453471 | 3300009162 | Populus Rhizosphere | TPFERIFEFRASDRLPSSEIEANDLFGAYLFQIEQVVEAVDQLKTATQ* |
Ga0105237_119125462 | 3300009545 | Corn Rhizosphere | FERIFEFRASDRLPSSEIEANDLFGAYLFQIEQVVEAVDELKTATE* |
Ga0105237_120540682 | 3300009545 | Corn Rhizosphere | PAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLGTTTQ* |
Ga0126313_101294261 | 3300009840 | Serpentine Soil | TDRLPSSEKEANDLFGAYLFQVEQVVEAVDQPKTGTP* |
Ga0126304_104175971 | 3300010037 | Serpentine Soil | RETARLLQLDPVPFERIFAFRSDGNLPTSEKQANDLFGAYLLQIEQVVEAVDELGKSAQ* |
Ga0126309_100106319 | 3300010039 | Serpentine Soil | TARVLKLDAALFERIFQFRTSGELPSSEKEANDLFGAYLFQVEQVVEAVDELGRESAPSS |
Ga0126308_101841571 | 3300010040 | Serpentine Soil | RIFQFRTSGELPSSEKEANDLFGAYLFQVEQVVEAVDELGRESAPSS* |
Ga0126306_112221992 | 3300010166 | Serpentine Soil | DAVPFERIFEFRASGRLPSSEKETNDLFGAYLFQIEQVVEAVDELGN* |
Ga0126377_130369751 | 3300010362 | Tropical Forest Soil | RIFEFRAGGNLPKSGKEANDIFGAYMVQIEHVVEAVDELEQRGN* |
Ga0134124_103781941 | 3300010397 | Terrestrial Soil | FERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLGTTTQ* |
Ga0134127_103680611 | 3300010399 | Terrestrial Soil | LLKLDPVPFERIFEFRASDRRPASEKEANDLFGAYLFQIEQVVEAVDELEKATP* |
Ga0134127_123203701 | 3300010399 | Terrestrial Soil | LLKLDPVPFERIFEFRASDRRPASEKDANDLFGAYLFQIEQVVEAVDELEKATQ* |
Ga0134122_102772631 | 3300010400 | Terrestrial Soil | RLDPLPFEKIFEFRTKDSLPRSETEAIDMFGAYVEQIERVVEAVDIL* |
Ga0105246_113412782 | 3300011119 | Miscanthus Rhizosphere | KLDVTPFERIFQFRTTGALPRSDKEANELFAAYMFQIEQVVEAVDELERRGNLR* |
Ga0105246_119006261 | 3300011119 | Miscanthus Rhizosphere | ATARLLKLDPKPFERIFEFRASDRLPSSEKEAHELFGVYLVQIEQVVEAVDKLGEATQ* |
Ga0150984_1089449231 | 3300012469 | Avena Fatua Rhizosphere | PFERIFEFRASDRLPSSEIEANDLFGSYLFQIEQVVEAVDQLKTATQ* |
Ga0157353_10327952 | 3300012496 | Unplanted Soil | FERIFEFRAGDVSPRSESEANELFGAYMLQIERVVEAVDELTPSS* |
Ga0157283_102962161 | 3300012907 | Soil | EFRASDRLPSSEKEANDLFGAYLLQIERVVEAVDELGNTTQ* |
Ga0164303_108431751 | 3300012957 | Soil | LLKLDPGPFERIFEFRAGGVLPQSETDANELFGAYLLQIERVVEAVDELTPKS* |
Ga0157378_110310272 | 3300013297 | Miscanthus Rhizosphere | QLDPAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQIGTATQ* |
Ga0157375_120685712 | 3300013308 | Miscanthus Rhizosphere | FERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKTETT* |
Ga0157375_130673251 | 3300013308 | Miscanthus Rhizosphere | PFERIFEFRASDRLPSSEKEANDLFGAYLLQIERVVEAVDELGKTTQ* |
Ga0163163_124653752 | 3300014325 | Switchgrass Rhizosphere | ASDRRPASEKEANDLFGAYLFQIGQVVEAVDELERATQ* |
Ga0163163_129186041 | 3300014325 | Switchgrass Rhizosphere | TPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKTATQ* |
Ga0157380_111741291 | 3300014326 | Switchgrass Rhizosphere | ARVLRLDPRPFERIFDFRAGGRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ* |
Ga0157377_101253481 | 3300014745 | Miscanthus Rhizosphere | KLDPNPFEKIFEFRASGKLPSSEKEANEIFGAYLLQIEQVVEAVDQLETAKQ* |
Ga0182007_100494011 | 3300015262 | Rhizosphere | LDPTPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKT* |
Ga0132258_114412584 | 3300015371 | Arabidopsis Rhizosphere | LLNLDPTSFERIFEFRSTDKLPSTETEANQIFASYMFQIEQVVEAVDEIDESRPRHS* |
Ga0132256_1015548262 | 3300015372 | Arabidopsis Rhizosphere | LNLDPTSFERIFEFRSTDKLPSTETEANQIFASYMFQIEQVVEAVDELDQSRPRHS* |
Ga0132255_1053208051 | 3300015374 | Arabidopsis Rhizosphere | KIFEFRTKDSLPRSEAEANDIFGAYLEQIERVVEAVDNL* |
Ga0190271_132264571 | 3300018481 | Soil | LDPTPFERIFDFRAGENLPQSETEANELFGAYMLQIEVVVEAVDELRTSS |
Ga0173482_106935482 | 3300019361 | Soil | DAEPFEKIFEFRTSDSLPRSESEANAIFGSYLFQIEQVVEAVDELKPT |
Ga0207642_103637991 | 3300025899 | Miscanthus Rhizosphere | APFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ |
Ga0207688_106737691 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ |
Ga0207647_103592791 | 3300025904 | Corn Rhizosphere | SDRLPSSEKEANDLFGDYLFQIGQVVEAVDQLGTATQ |
Ga0207645_108284242 | 3300025907 | Miscanthus Rhizosphere | QLLKLDAEPFEKIFEFRTSNSLPRSESEANAIFGSYLFQIEQVVEAVDELKPT |
Ga0207654_100881975 | 3300025911 | Corn Rhizosphere | LQLDPAPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ |
Ga0207654_105041502 | 3300025911 | Corn Rhizosphere | LLKLDVTPFERIFQFRAGDDLPGSETEANELFGAYMLQIERVVEAVDELTMSGEV |
Ga0207654_107428792 | 3300025911 | Corn Rhizosphere | EFRSSDRLPSSEIEANDLFGAYLFQIEQVVEAVDRLTTQ |
Ga0207662_102466433 | 3300025918 | Switchgrass Rhizosphere | LQLDPAPFERIFEFRASDRLPSSEKEANDLFGDYLFQIGQVVEAVDQLGTATQ |
Ga0207662_103384541 | 3300025918 | Switchgrass Rhizosphere | KPFERIFEFRASDRLPSSEKEAHELFGVYLFQIEQVVEAVDKLGEATQ |
Ga0207652_115548331 | 3300025921 | Corn Rhizosphere | LLRLDQTPFERIFEFRSGGNLPTSEKDANDLFGAYLLQIEQVVEAVDHLPMGDVR |
Ga0207650_109930501 | 3300025925 | Switchgrass Rhizosphere | VRATARLLHLDPAPFERIFEFRASDRLPSSEKEANDLFGLYLFQIEQVVEAVDQLTTATQ |
Ga0207650_112386471 | 3300025925 | Switchgrass Rhizosphere | IFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ |
Ga0207659_104105073 | 3300025926 | Miscanthus Rhizosphere | ATAQLLKLDPAPFERIFEFRASDRRPSSEKDANDLFGAYLFQIEQVVEAVDELEKATQ |
Ga0207644_113437541 | 3300025931 | Switchgrass Rhizosphere | KLLKLDPGPFERIFEFRAGDVSPRSESEANELFGAYMLQIERVVEAVDELTPSS |
Ga0207690_110889241 | 3300025932 | Corn Rhizosphere | APFERIFEFRASDRRPASEKEANDLFGTYLFQIEQVVEAVDELERATQ |
Ga0207690_113099002 | 3300025932 | Corn Rhizosphere | TSFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLGTATQ |
Ga0207711_117538412 | 3300025941 | Switchgrass Rhizosphere | KPDVVRTTAKLLQLDPAPFERIFEFRASDRLPSSEKEANDLFGAYLVQIEQVVESVDQIGTATQ |
Ga0207711_118942412 | 3300025941 | Switchgrass Rhizosphere | TVKLLHLDPTPFERIFEFRASDRLPSSEIEANDLFGAYLFQIEQVVEAVDELKTATE |
Ga0207689_103753381 | 3300025942 | Miscanthus Rhizosphere | TAKLLRLDPAPFERIFEFRTGGNLPTSDKEANDLFGAYLFQIEQVVEAVDNLPMGDVR |
Ga0207679_104185243 | 3300025945 | Corn Rhizosphere | IFEFRASDRLPSSEKEANDLFGLYLFQIEQVVEAVDQLTTATQ |
Ga0207679_109849662 | 3300025945 | Corn Rhizosphere | SDRLPSSEIEANDLFGAYLFQIEQVVEAVDQLKTATQ |
Ga0207667_111576811 | 3300025949 | Corn Rhizosphere | RLLHLDPAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLKT |
Ga0207667_122180961 | 3300025949 | Corn Rhizosphere | KLLQLDPTPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDQLGAATQ |
Ga0207677_120817351 | 3300026023 | Miscanthus Rhizosphere | LHLDPTPFERIFEFRASDRLPSSEIEANDLFGAYLFQIEQVVEAVDELKTATE |
Ga0207703_100612108 | 3300026035 | Switchgrass Rhizosphere | RANDRLPSSEKEANDLFGAYLFQIEQVVEAVDQLGTTTQ |
Ga0207703_119718962 | 3300026035 | Switchgrass Rhizosphere | LLHLDPTPFERIFEFRASDRLPSSEIEANDLFGAYLFQIEQVVEAVDELKTATE |
Ga0207708_119194281 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPASEKDANDLFGAYLFQIEQVVEAVDELEKATQ |
Ga0207641_100866228 | 3300026088 | Switchgrass Rhizosphere | IFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEAIQ |
Ga0207676_110882801 | 3300026095 | Switchgrass Rhizosphere | PAPFERIFEFRTDGNLPTSEKEANDLFGAYLFQIEQVVEAVDNLPMGELK |
Ga0207676_116859431 | 3300026095 | Switchgrass Rhizosphere | LLTLDLDPFERIFEFRSTDNLPKSESEANAIFGDYLIQIEKVVEAVDELQGGTDFRL |
Ga0207674_104591403 | 3300026116 | Corn Rhizosphere | AKLLQLDPTPFERIFEFRANDRLPSSEKEANDLFGAYLFQIEQVVESVDRLGTATQ |
Ga0207698_113377551 | 3300026142 | Corn Rhizosphere | TTAKLLQLDPAPFERIFEFRASDRLPSSEKEANDLFGAYLFQIEQVVEAVDELKTATT |
Ga0209731_10252422 | 3300027326 | Forest Soil | ASLLKLDPIPFERIFEFRASDRRPSSEKEANDLFGAYLFQIEQVVEAVDELGNATE |
Ga0209074_102434691 | 3300027787 | Agricultural Soil | VVRATASLLHLDPTPFERIFEFRASDRLPSSETEANDLFGAYLFQIEQVVEAVDQLKTAT |
Ga0268259_100641462 | 3300030499 | Agave | DPAPFERIFQFRASDRLPSSEKEANDLFGAYLFQIEQVVESVDQLGT |
Ga0310888_104030261 | 3300031538 | Soil | ERIFEFRASDRRPASEKEANDLFGAYLFQIGQVVEAVDELGKATQ |
Ga0307408_1004345863 | 3300031548 | Rhizosphere | GGDLPSSEKEANDLFGAYLFQVEQVVEAVDELVQEPGSSS |
Ga0307468_1013345581 | 3300031740 | Hardwood Forest Soil | IFEFRASDRRPSSEKEANDLFGAYLFQIEQVVEAVDELGNATQ |
Ga0310904_111834032 | 3300031854 | Soil | DPKPFERIFEFRASDRLPSSEKEAHELFGVYLFQIERVVEAVDKLGEATQ |
Ga0307412_113153602 | 3300031911 | Rhizosphere | DPKPFERIFAFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEARQ |
Ga0307414_113168721 | 3300032004 | Rhizosphere | RLDYAPFGKIFEFQFGDSLPASQKEANELFGAYMFQIEQVVEAVDELHRRGGLR |
Ga0310902_110038482 | 3300032012 | Soil | KLLRLDPKPFERIFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ |
Ga0310895_107491941 | 3300032122 | Soil | NLLRLDPKPFERIFEFRAGDRLPSSEKEAHELFGAYLFQIEQVVEAVDNLGEATQ |
Ga0310811_114637852 | 3300033475 | Soil | LHLDPIPFERIFEFRASDRLPSSELEANDLFGAYLFQIEQVVEAVDQLGTATQ |
⦗Top⦘ |