Metagenome Family F060060

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F060060
Family Type	Metagenome
Number of Sequences	133
Average Sequence Length	45 residues
Representative Sequence	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSK
Number of Associated Samples	65
Number of Associated Scaffolds	133

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.68 %
% of genes near scaffold ends (potentially truncated)	78.20 %
% of genes from short scaffolds (< 2000 bps)	84.21 %
Associated GOLD sequencing projects	63
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (98.496 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (85.714 % of family members)
Environment Ontology (ENVO)	Unclassified (86.466 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (85.714 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.63% β-sheet: 0.00% Coil/Unstructured: 47.37%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 133 Family Scaffolds
PF03108	DBD_Tnp_Mut	0.75

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
All Organisms	root	All Organisms	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
cellular organisms	root	All Organisms → cellular organisms	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.50 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_101575521	Not Available	584	Open in IMG/M
3300005338\|Ga0068868_101826832	Not Available	574	Open in IMG/M
3300005338\|Ga0068868_101833167	Not Available	573	Open in IMG/M
3300005718\|Ga0068866_10387890	Not Available	897	Open in IMG/M
3300005718\|Ga0068866_11152909	Not Available	557	Open in IMG/M
3300005718\|Ga0068866_11210529	Not Available	545	Open in IMG/M
3300005840\|Ga0068870_10773620	Not Available	668	Open in IMG/M
3300006237\|Ga0097621_101890504	Not Available	569	Open in IMG/M
3300006358\|Ga0068871_100933545	Not Available	805	Open in IMG/M
3300009176\|Ga0105242_13213075	Not Available	507	Open in IMG/M
3300011119\|Ga0105246_12301975	Not Available	526	Open in IMG/M
3300013296\|Ga0157374_10876652	Not Available	915	Open in IMG/M
3300014486\|Ga0182004_10194965	Not Available	701	Open in IMG/M
3300014745\|Ga0157377_11684378	Not Available	511	Open in IMG/M
3300015267\|Ga0182122_1015951	Not Available	758	Open in IMG/M
3300015267\|Ga0182122_1043401	Not Available	581	Open in IMG/M
3300015267\|Ga0182122_1056672	Not Available	539	Open in IMG/M
3300015269\|Ga0182113_1069389	Not Available	559	Open in IMG/M
3300015274\|Ga0182188_1051823	Not Available	529	Open in IMG/M
3300015274\|Ga0182188_1061833	Not Available	503	Open in IMG/M
3300015276\|Ga0182170_1014696	Not Available	798	Open in IMG/M
3300015277\|Ga0182128_1028609	Not Available	673	Open in IMG/M
3300015277\|Ga0182128_1035520	Not Available	634	Open in IMG/M
3300015277\|Ga0182128_1078236	Not Available	505	Open in IMG/M
3300015279\|Ga0182174_1038902	Not Available	635	Open in IMG/M
3300015281\|Ga0182160_1034950	Not Available	646	Open in IMG/M
3300015281\|Ga0182160_1039765	Not Available	624	Open in IMG/M
3300015281\|Ga0182160_1058138	Not Available	561	Open in IMG/M
3300015281\|Ga0182160_1074264	Not Available	522	Open in IMG/M
3300015282\|Ga0182124_1025424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	700	Open in IMG/M
3300015283\|Ga0182156_1023918	Not Available	732	Open in IMG/M
3300015288\|Ga0182173_1023191	Not Available	730	Open in IMG/M
3300015288\|Ga0182173_1041057	Not Available	625	Open in IMG/M
3300015288\|Ga0182173_1054311	Not Available	577	Open in IMG/M
3300015289\|Ga0182138_1053739	Not Available	585	Open in IMG/M
3300015294\|Ga0182126_1077521	Not Available	537	Open in IMG/M
3300015299\|Ga0182107_1008351	Not Available	1042	Open in IMG/M
3300015299\|Ga0182107_1059235	Not Available	599	Open in IMG/M
3300015302\|Ga0182143_1092047	Not Available	523	Open in IMG/M
3300015303\|Ga0182123_1043238	Not Available	639	Open in IMG/M
3300015303\|Ga0182123_1067881	Not Available	562	Open in IMG/M
3300015303\|Ga0182123_1085605	Not Available	525	Open in IMG/M
3300015304\|Ga0182112_1023811	Not Available	778	Open in IMG/M
3300015304\|Ga0182112_1050935	Not Available	627	Open in IMG/M
3300015304\|Ga0182112_1069405	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	573	Open in IMG/M
3300015305\|Ga0182158_1093439	Not Available	520	Open in IMG/M
3300015305\|Ga0182158_1100730	Not Available	508	Open in IMG/M
3300015307\|Ga0182144_1030965	Not Available	731	Open in IMG/M
3300015308\|Ga0182142_1012429	Not Available	964	Open in IMG/M
3300015314\|Ga0182140_1043960	Not Available	676	Open in IMG/M
3300015342\|Ga0182109_1099793	Not Available	680	Open in IMG/M
3300015342\|Ga0182109_1206923	Not Available	517	Open in IMG/M
3300015343\|Ga0182155_1047749	Not Available	870	Open in IMG/M
3300015343\|Ga0182155_1083310	Not Available	721	Open in IMG/M
3300015343\|Ga0182155_1126172	Not Available	623	Open in IMG/M
3300015343\|Ga0182155_1223394	Not Available	503	Open in IMG/M
3300015344\|Ga0182189_1068329	Not Available	784	Open in IMG/M
3300015344\|Ga0182189_1087334	Not Available	719	Open in IMG/M
3300015344\|Ga0182189_1132872	Not Available	619	Open in IMG/M
3300015345\|Ga0182111_1130124	Not Available	642	Open in IMG/M
3300015345\|Ga0182111_1146419	Not Available	614	Open in IMG/M
3300015345\|Ga0182111_1183421	Not Available	563	Open in IMG/M
3300015346\|Ga0182139_1139733	Not Available	626	Open in IMG/M
3300015346\|Ga0182139_1175489	Not Available	574	Open in IMG/M
3300015346\|Ga0182139_1212170	Not Available	532	Open in IMG/M
3300015351\|Ga0182161_1168284	Not Available	606	Open in IMG/M
3300015351\|Ga0182161_1207738	Not Available	557	Open in IMG/M
3300015351\|Ga0182161_1213856	Not Available	550	Open in IMG/M
3300015351\|Ga0182161_1233935	Not Available	530	Open in IMG/M
3300015355\|Ga0182159_1206637	Not Available	634	Open in IMG/M
3300015355\|Ga0182159_1249804	Not Available	584	Open in IMG/M
3300015355\|Ga0182159_1282838	Not Available	553	Open in IMG/M
3300015355\|Ga0182159_1317702	Not Available	525	Open in IMG/M
3300015361\|Ga0182145_1093441	Not Available	643	Open in IMG/M
3300017409\|Ga0182204_1014333	Not Available	939	Open in IMG/M
3300017409\|Ga0182204_1022273	Not Available	828	Open in IMG/M
3300017409\|Ga0182204_1055344	Not Available	636	Open in IMG/M
3300017410\|Ga0182207_1096031	Not Available	619	Open in IMG/M
3300017411\|Ga0182208_1090805	Not Available	563	Open in IMG/M
3300017411\|Ga0182208_1127585	Not Available	504	Open in IMG/M
3300017413\|Ga0182222_1019127	Not Available	784	Open in IMG/M
3300017413\|Ga0182222_1093497	Not Available	522	Open in IMG/M
3300017413\|Ga0182222_1095266	Not Available	520	Open in IMG/M
3300017413\|Ga0182222_1103644	Not Available	508	Open in IMG/M
3300017415\|Ga0182202_1108444	Not Available	546	Open in IMG/M
3300017415\|Ga0182202_1133106	Not Available	510	Open in IMG/M
3300017417\|Ga0182230_1030077	Not Available	949	Open in IMG/M
3300017420\|Ga0182228_1091518	Not Available	570	Open in IMG/M
3300017424\|Ga0182219_1061376	Not Available	650	Open in IMG/M
3300017424\|Ga0182219_1072251	Not Available	618	Open in IMG/M
3300017424\|Ga0182219_1084557	Not Available	590	Open in IMG/M
3300017424\|Ga0182219_1088924	Not Available	580	Open in IMG/M
3300017427\|Ga0182190_1047678	Not Available	765	Open in IMG/M
3300017430\|Ga0182192_1088419	Not Available	635	Open in IMG/M
3300017442\|Ga0182221_1039021	Not Available	789	Open in IMG/M
3300017443\|Ga0182193_1092930	Not Available	652	Open in IMG/M
3300017443\|Ga0182193_1111580	Not Available	613	Open in IMG/M
3300017443\|Ga0182193_1121866	Not Available	595	Open in IMG/M
3300017443\|Ga0182193_1190971	Not Available	508	Open in IMG/M
3300017680\|Ga0182233_1085895	Not Available	574	Open in IMG/M
3300017680\|Ga0182233_1102175	Not Available	531	Open in IMG/M
3300017683\|Ga0182218_1005752	Not Available	1301	Open in IMG/M
3300017683\|Ga0182218_1054806	Not Available	689	Open in IMG/M
3300017683\|Ga0182218_1081284	Not Available	613	Open in IMG/M
3300017683\|Ga0182218_1095948	Not Available	582	Open in IMG/M
3300017684\|Ga0182225_1089052	Not Available	585	Open in IMG/M
3300017685\|Ga0182227_1039489	Not Available	824	Open in IMG/M
3300017686\|Ga0182205_1132210	Not Available	550	Open in IMG/M
3300017689\|Ga0182231_1095632	Not Available	571	Open in IMG/M
3300017690\|Ga0182223_1074238	Not Available	581	Open in IMG/M
3300025899\|Ga0207642_10882543	Not Available	572	Open in IMG/M
3300026078\|Ga0207702_10623399	Not Available	1059	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	85.71%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.76%
Roots	Host-Associated → Plants → Roots	2.26%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	85.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.76%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.50%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.75%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	85.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.76%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.50%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.75%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	85.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	7.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.26%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.75%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	0.75%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1015755211	3300005334	Miscanthus Rhizosphere	WLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0068868_1018268323	3300005338	Miscanthus Rhizosphere	HSYKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0068868_1018331671	3300005338	Miscanthus Rhizosphere	SITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0068866_103878901	3300005718	Miscanthus Rhizosphere	SWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0068866_111529091	3300005718	Miscanthus Rhizosphere	EIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0068866_112105291	3300005718	Miscanthus Rhizosphere	SWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKESKS*
Ga0068866_113973941	3300005718	Miscanthus Rhizosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRY
Ga0068870_107736202	3300005840	Miscanthus Rhizosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0097621_1018905041	3300006237	Miscanthus Rhizosphere	SWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0068871_1009335453	3300006358	Miscanthus Rhizosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRHVAAISPMKDSKS*
Ga0105242_132130752	3300009176	Miscanthus Rhizosphere	LSITKKGEIESAFAPYVGFDVLMASKLGTNVILMRSVAAISPMKDSKS*
Ga0105246_123019752	3300011119	Miscanthus Rhizosphere	PYVGFGVLMTFKLGTNVILMRYVAAISTMKDSKS*
Ga0157374_108766521	3300013296	Miscanthus Rhizosphere	LSSIIKKGEIKSAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKD
Ga0157378_117862571	3300013297	Miscanthus Rhizosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILM
Ga0182004_101949651	3300014486	Root	LSSSTKKGEIESAFAPYVGFGVLMTSNLGTNALYLRFAAATRFMKVAKVQLKIKWYP
Ga0157377_116843781	3300014745	Miscanthus Rhizosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYIEALVP*
Ga0182122_10159511	3300015267	Miscanthus Phyllosphere	LSSITKKEEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAI
Ga0182122_10434011	3300015267	Miscanthus Phyllosphere	LSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0182122_10566721	3300015267	Miscanthus Phyllosphere	TKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0182113_10693892	3300015269	Miscanthus Phyllosphere	ITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0182188_10518232	3300015274	Miscanthus Phyllosphere	AFVPYVTFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0182188_10618331	3300015274	Miscanthus Phyllosphere	SAFAPYVGFGVLMTSKLGTNVILMRYVTAISPMKDSKS*
Ga0182170_10146962	3300015276	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMGYVAAII
Ga0182128_10286091	3300015277	Miscanthus Phyllosphere	IESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0182128_10355201	3300015277	Miscanthus Phyllosphere	LSSITKKGEIESAFAPNVDFGVLMTSKLGTNVILMRYVVAISPMKE
Ga0182128_10782361	3300015277	Miscanthus Phyllosphere	PYVGFGVLMTSKLGTNVILMRYVAAISPMKESKS*
Ga0182174_10389021	3300015279	Miscanthus Phyllosphere	SYKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVI*
Ga0182174_10492581	3300015279	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFVILMTFKLGTNEILMRYIVAFVP*
Ga0182160_10349501	3300015281	Miscanthus Phyllosphere	LSSIIKKREIESAFAPYVGFGVLMISNLGTNEILMRYIAALVP*KF
Ga0182160_10397651	3300015281	Miscanthus Phyllosphere	LSSISKKGEIESVFAPYVGFGVLMTSKLGANVILIRYVTAIS
Ga0182160_10491911	3300015281	Miscanthus Phyllosphere	LSSITKKEEIESAFAPVVGFGVLMTSKLGTNKILMKYIESFKRVDLR*
Ga0182160_10581381	3300015281	Miscanthus Phyllosphere	KFFHSYKSLSWLSSITKKGEIESAFAPYVDFGVLMTSKLGTNVILMRYVIII*
Ga0182160_10742642	3300015281	Miscanthus Phyllosphere	ESAFAPYVGFGVLMTSRLGTNVILMRYVAAISPIKDSKS*
Ga0182124_10254241	3300015282	Miscanthus Phyllosphere	MITKSLSVTESAFAPYVGFGVLMTSKLGTNVILIRYVAAISPMKDS
Ga0182156_10239182	3300015283	Miscanthus Phyllosphere	FKFFHSYKSLSLLSSITKKGEIESAFAPYVGFGVLLTSKLGTNVILVRYVAAFSPMKDSKS*
Ga0182156_10405321	3300015283	Miscanthus Phyllosphere	QKFKFFHSYKSLSWLSSITKNRETESAFAPYVGFGVLMTSKLGTNDILIRYIVALVP*
Ga0182173_10231911	3300015288	Miscanthus Phyllosphere	LSSITKTGEIKSAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMK
Ga0182173_10410572	3300015288	Miscanthus Phyllosphere	ESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0182173_10543111	3300015288	Miscanthus Phyllosphere	MSESAFAPYVGFGVLMTSKLGTNVVLMRYAVAISPVKESKS*
Ga0182138_10304741	3300015289	Miscanthus Phyllosphere	LSSINKNGEIESAFAPYVGFGVLITSKLGTNVVLMRYVTII
Ga0182138_10537391	3300015289	Miscanthus Phyllosphere	MGFMRLNSESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0182126_10543231	3300015294	Miscanthus Phyllosphere	LSSITKKGELESAFAPYVGFGVLMTSKLGTNVILMRYV
Ga0182126_10775211	3300015294	Miscanthus Phyllosphere	SWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTTISPMKDSKS*
Ga0182175_10451801	3300015295	Miscanthus Phyllosphere	IESAFAPYVGFGVLMTSKLGTNEILMRYIAALVP*
Ga0182107_10083512	3300015299	Miscanthus Phyllosphere	MFQIEDLKSAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0182107_10542751	3300015299	Miscanthus Phyllosphere	LSSIAKKGEIESAFAPYVGFGVLMTSKLGTNEILM
Ga0182107_10592351	3300015299	Miscanthus Phyllosphere	ATKMGFGVLMTSKLETNVILMRYVTAISPVKELKS*
Ga0182107_10645611	3300015299	Miscanthus Phyllosphere	LSSITKKGEIESAFAAYVGFGVLMTSKLGTNGILMRYIV
Ga0182143_10509101	3300015302	Miscanthus Phyllosphere	LSSITKKGEIKSVFAPYMGLGVLMTSKLGTNEILMIYI
Ga0182143_10920472	3300015302	Miscanthus Phyllosphere	FAPYVGFGVLMTYKLGTNAILMRYVAAISPIKDSKS*
Ga0182123_10432381	3300015303	Miscanthus Phyllosphere	LSSITKKGEIKSAFAPYVGFGVLMASKLGTNEILMRYIAALV
Ga0182123_10678811	3300015303	Miscanthus Phyllosphere	KGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0182123_10856051	3300015303	Miscanthus Phyllosphere	LIAESAFAPYVGFGVLMTSKLGTNVIFMRYVAAISPMKDSKS*
Ga0182112_10238113	3300015304	Miscanthus Phyllosphere	LSSITKNGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDS
Ga0182112_10509351	3300015304	Miscanthus Phyllosphere	SLSWLSSITKNGEIKSAFAPYMGFVVLMTSKLGTNEVLMRYIAPLVP*
Ga0182112_10694051	3300015304	Miscanthus Phyllosphere	VGETAFAPFVGFGVLMTFKLRTYVILMRYVAVISPMKDSK
Ga0182158_10934391	3300015305	Miscanthus Phyllosphere	AFAPYVGFGVLMTSKLGTNVILMRYVASISPVKQSKS*
Ga0182158_11007301	3300015305	Miscanthus Phyllosphere	YYSYKSLSWLLSIIEKGEIESAFAPVVGFGVLMAFKIGTNEILLRYIAALVP*
Ga0182144_10309651	3300015307	Miscanthus Phyllosphere	IESAFAPYVGFGVLITSKLGTNVILMRYVVAISPMKDSKS*
Ga0182142_10124291	3300015308	Miscanthus Phyllosphere	SSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS*
Ga0182140_10439601	3300015314	Miscanthus Phyllosphere	LSSITKKEEIESAFAPYVGFGVLMTSKLGTNVILIRYVVAISPMKDS
Ga0182109_10997931	3300015342	Miscanthus Phyllosphere	YKSLSWLSSITKKGEIESVFAPYIGFGVLMTSKLGTHVILLRYVAAISSMKDLKS*
Ga0182109_11857681	3300015342	Miscanthus Phyllosphere	WLSSITKKGEIESAFAPYVCFAVLMTSKLGTNEILMRYIVALVP*
Ga0182109_12069231	3300015342	Miscanthus Phyllosphere	PYVGFGVLMTSKLGTNMILMRYVAAISPIKDSKS*
Ga0182155_10477491	3300015343	Miscanthus Phyllosphere	SLSWLSSITKKREIKSAFAPYVGFCVLMTSKLGANVILMRYVAAISPMKDSKS*
Ga0182155_10833101	3300015343	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSK
Ga0182155_11261721	3300015343	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNMILMRYVAAISP
Ga0182155_12233941	3300015343	Miscanthus Phyllosphere	LSSITKKGEIESVFAPYVGFGVLMTSKLGTNMILIRYVAAISPIKDLKS*
Ga0182189_10683292	3300015344	Miscanthus Phyllosphere	LSSITKKGKIKSAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMK
Ga0182189_10873341	3300015344	Miscanthus Phyllosphere	PLAIRTFHPYVGFGVLMTFKLGTYVILMRHVVAISPMNDSKS*
Ga0182189_11328721	3300015344	Miscanthus Phyllosphere	MTLESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDS
Ga0182111_11301242	3300015345	Miscanthus Phyllosphere	ESAFAPYVGFGVLITSKLGTNVILMRYVAAISPMKDSKS*
Ga0182111_11464191	3300015345	Miscanthus Phyllosphere	LSSITKKGEVESAFAPYMGFGVLMTSKLGANEILLRYIAALVP*
Ga0182111_11834211	3300015345	Miscanthus Phyllosphere	LLSITEKEEIESAFAPVVGFGVLMAFKIGTNEILLRYIAALVPWKI*
Ga0182139_11397331	3300015346	Miscanthus Phyllosphere	PYVGFGVLVTFKLGTNVNLMRYVAAISSMKDSKS*
Ga0182139_11754891	3300015346	Miscanthus Phyllosphere	AFAPYVGFGVMMTSKLWTNVVLMRYDAAISDMKESMS*
Ga0182139_12121701	3300015346	Miscanthus Phyllosphere	VEAESVFTLYMGFGVLMTFKLGTNVILTRYVAVISPMKDSNS*
Ga0182177_12312111	3300015347	Miscanthus Phyllosphere	KFIHSYKSLRWLSSIIKKGEIESAFAPIVVFCVLMIFNLGTQEILLRYIVALVP*
Ga0182161_11682841	3300015351	Miscanthus Phyllosphere	HFYKSLSWLSSITKKGEIESAFAPYVGCGALMTSKLRTNMILMRYVAAISSMKDLKSQ*
Ga0182161_12077381	3300015351	Miscanthus Phyllosphere	KSLSWLSSITKKEEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS*
Ga0182161_12138562	3300015351	Miscanthus Phyllosphere	PYVCFGVLMTSKLGTNMILMRNVAAISPMKDFKS*
Ga0182161_12339352	3300015351	Miscanthus Phyllosphere	KFIHSYKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVVLMRYVAAISPVKESKS
Ga0182159_12066372	3300015355	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILIRYVAAISPMKDSKS*
Ga0182159_12498041	3300015355	Miscanthus Phyllosphere	LSSITKKEEIESAFAPVVGFGVLMTSKLGTNEILLRYIVALVP*
Ga0182159_12828382	3300015355	Miscanthus Phyllosphere	ESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPIKDSKS*
Ga0182159_13177022	3300015355	Miscanthus Phyllosphere	EIESAFASYVGFGVLMTSKLGTNVILMRYIAAVSPMKESKS*
Ga0182145_10934411	3300015361	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAVISPMKD
Ga0182203_10211891	3300017404	Miscanthus Phyllosphere	SAFVPYVTFGVLMTSKLGTNVILIRYVAAISPMKNSKS
Ga0182204_10143331	3300017409	Miscanthus Phyllosphere	DQGFKSAFAPYVDFGVLITSKLGTNMILMRYVTAINPMKNSKS
Ga0182204_10222731	3300017409	Miscanthus Phyllosphere	SITKKGEIKSAFSPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS
Ga0182204_10553441	3300017409	Miscanthus Phyllosphere	SAFAPYVGFSVLMTSKLGTNVILMRYVIAISPIKD
Ga0182207_10960311	3300017410	Miscanthus Phyllosphere	ITKKREIESAFAPYVGFGVLMTSKLGTNVILMRYVVAISPMKDSKS
Ga0182208_10908051	3300017411	Miscanthus Phyllosphere	IESAFTPYVGFGVLMTSKLGTNVILMRYVVAISPIKDSKS
Ga0182208_11275851	3300017411	Miscanthus Phyllosphere	EIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS
Ga0182222_10191271	3300017413	Miscanthus Phyllosphere	ESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPVKESKS
Ga0182222_10934971	3300017413	Miscanthus Phyllosphere	SAFAPYVGFGVLMTFKLGTNVILMRYVTAISPMKNSKS
Ga0182222_10952661	3300017413	Miscanthus Phyllosphere	WLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVLLMRYVTAFSPMKDSKS
Ga0182222_11036441	3300017413	Miscanthus Phyllosphere	ITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS
Ga0182202_11084441	3300017415	Miscanthus Phyllosphere	LSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS
Ga0182202_11331061	3300017415	Miscanthus Phyllosphere	SWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVI
Ga0182230_10300773	3300017417	Miscanthus Phyllosphere	ESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS
Ga0182228_10915181	3300017420	Miscanthus Phyllosphere	WLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVTAISPVKESKS
Ga0182219_10613761	3300017424	Miscanthus Phyllosphere	LSWLSSVTKNGKIKSAFAPYVGFGVLMTSKLGTNVILMRYVAVISSMKDLKS
Ga0182219_10683641	3300017424	Miscanthus Phyllosphere	LSSINKNGEIESAIAPYVGFGILMTSKLETNEVVMRYIAALVP
Ga0182219_10722512	3300017424	Miscanthus Phyllosphere	RIKSAFAPYVGFGVFMTSKLGTNVILMRYVAAISPMKDSKS
Ga0182219_10845571	3300017424	Miscanthus Phyllosphere	GEIESAFAPYVGFGVLMTSKLGTNMILMRYVTAISPMKDSKS
Ga0182219_10889241	3300017424	Miscanthus Phyllosphere	FAPYVGFGVLMTSKLWTNVILMRHVTTISPMKESKS
Ga0182224_10732171	3300017425	Miscanthus Phyllosphere	LHFNESLSWLSSITKKREIESAFAPYVGFGVLMTSKLGTNEILMRYIVALVP
Ga0182224_11032011	3300017425	Miscanthus Phyllosphere	LSSITKKGETESAFAPYVGFGVLMTSKLGTNVILMRYV
Ga0182190_10476781	3300017427	Miscanthus Phyllosphere	LSSITKKGEIKSAFAPYVGFGVLMTSKLGTNVILMRHVAAISPMKESKS
Ga0182192_10884192	3300017430	Miscanthus Phyllosphere	YKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS
Ga0182192_11399371	3300017430	Miscanthus Phyllosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNEILMRY
Ga0182221_10390211	3300017442	Miscanthus Phyllosphere	KKGEIESAFASYVGFGVLMTSKLGTNVILMRYVTVISPMKDSKS
Ga0182193_10929301	3300017443	Miscanthus Phyllosphere	SITKKGEIESAFAPYVGFGVLMTSKLGTNVILIRYVAAISPMKDSKSX
Ga0182193_11115801	3300017443	Miscanthus Phyllosphere	LITKKGEIESAFAPYVGFGVLMTSKLGINVILMRYVAAISPMKESKSX
Ga0182193_11218661	3300017443	Miscanthus Phyllosphere	TSMINDVESAFVPYVCFGVLMTFKLWANMILMRYVVAISPTKDLKS
Ga0182193_11909711	3300017443	Miscanthus Phyllosphere	SITKKGEIESAFAPYVGFGVLMTSKLGTNVILMGYVAAIIPMKDSKSX
Ga0182233_10858951	3300017680	Miscanthus Phyllosphere	APYVGFGVLMTSRLGTNVILMRYVVAISPMKDSKS
Ga0182233_11021751	3300017680	Miscanthus Phyllosphere	ITKKGEIESIFAPYVGFGVLMTSKLGTNVILMRYVTVISPMKDSKS
Ga0182218_10057521	3300017683	Miscanthus Phyllosphere	WLSSITKKREIESAFAPYVGFGVLMTSKLGTNVILMRYIAAFVP
Ga0182218_10521821	3300017683	Miscanthus Phyllosphere	LLSITKKEEIESAFAPYVGFGVLMTSKLGTNVILMRYIA
Ga0182218_10548061	3300017683	Miscanthus Phyllosphere	SYKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVISMRYVAATSPMKDSKS
Ga0182218_10812841	3300017683	Miscanthus Phyllosphere	HSYKSLSWLSSIIKKREIESAFAPYVGFGVLMISNLGTNEILMRYIAALVP
Ga0182218_10959481	3300017683	Miscanthus Phyllosphere	LGFKSFKIFHSYKSLSWLSSITKNREIESEFAPYVGFGVWMTSKLWTNVSLMRYAVAISP
Ga0182225_10890521	3300017684	Miscanthus Phyllosphere	AFAPYVGFGVLMTSKLGTNVILMRYVAAISPVKESKS
Ga0182227_10394891	3300017685	Miscanthus Phyllosphere	SYKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTKVILMRYVAAISPMKESKS
Ga0182205_11322102	3300017686	Miscanthus Phyllosphere	YKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILIRYVAAISPMKDSKSX
Ga0182231_10956322	3300017689	Miscanthus Phyllosphere	KKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPVKESKSX
Ga0182231_11180901	3300017689	Miscanthus Phyllosphere	QNGHIESAFVPYVSFGVLMTFKLGTNEFLMRYIAALVP
Ga0182223_10742382	3300017690	Miscanthus Phyllosphere	TKKGEIKSAFAPYVGFGVLMTSKLGTNVILMRHVAAISPMKESKS
Ga0207642_108036331	3300025899	Miscanthus Rhizosphere	LSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMR
Ga0207642_108825431	3300025899	Miscanthus Rhizosphere	WGSKSFKIFHSYKSLSWLSSITKKGEIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS
Ga0207702_106233992	3300026078	Corn Rhizosphere	SYKSLSWLSSITKKGKIESAFAPYVGFGVLMTSKLGTNVILMRYVAAISPMKDSKS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F060060

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences