Basic Information | |
---|---|
Family ID | F060058 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 42 residues |
Representative Sequence | AGCTLKGSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.24 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.496 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.774 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.120 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.150 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF02572 | CobA_CobO_BtuR | 82.71 |
PF01039 | Carboxyl_trans | 4.51 |
PF05635 | 23S_rRNA_IVP | 2.26 |
PF01797 | Y1_Tnp | 2.26 |
PF08245 | Mur_ligase_M | 1.50 |
PF01927 | Mut7-C | 0.75 |
PF01212 | Beta_elim_lyase | 0.75 |
PF07992 | Pyr_redox_2 | 0.75 |
PF02954 | HTH_8 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 82.71 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 4.51 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 4.51 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 4.51 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 2.26 |
COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.50 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.75 |
COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.75 |
COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.75 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.75 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.75 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.75 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.75 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.75 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.75 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.75 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.75 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.75 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.75 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.75 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.50 % |
Unclassified | root | N/A | 1.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100146226 | Not Available | 585 | Open in IMG/M |
3300000956|JGI10216J12902_108593397 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300002899|JGIcombinedJ43975_10073729 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300004156|Ga0062589_101718351 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300004156|Ga0062589_102433994 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300004643|Ga0062591_102605803 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005290|Ga0065712_10136343 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300005293|Ga0065715_10492682 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300005295|Ga0065707_10628756 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005331|Ga0070670_100650508 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300005332|Ga0066388_104473673 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300005334|Ga0068869_100233901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1461 | Open in IMG/M |
3300005354|Ga0070675_101540310 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300005355|Ga0070671_101113567 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005440|Ga0070705_101859309 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005444|Ga0070694_100224490 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300005445|Ga0070708_100127587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2352 | Open in IMG/M |
3300005457|Ga0070662_100217088 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300005459|Ga0068867_100063906 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
3300005530|Ga0070679_101771648 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005536|Ga0070697_100758354 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300005545|Ga0070695_100219632 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300005546|Ga0070696_100579160 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005547|Ga0070693_100467047 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300005554|Ga0066661_10555351 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005559|Ga0066700_10977443 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300005564|Ga0070664_100201845 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300005564|Ga0070664_101190234 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300005577|Ga0068857_100463196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1186 | Open in IMG/M |
3300005578|Ga0068854_100300077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
3300005617|Ga0068859_100261640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1821 | Open in IMG/M |
3300005618|Ga0068864_101068070 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300005618|Ga0068864_102060923 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005618|Ga0068864_102314767 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300005841|Ga0068863_101123056 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300005842|Ga0068858_100727121 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300005842|Ga0068858_101928978 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005843|Ga0068860_100173485 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
3300006034|Ga0066656_10291043 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300006237|Ga0097621_101926283 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300006755|Ga0079222_10307711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300006796|Ga0066665_10760610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300006800|Ga0066660_11221967 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300006804|Ga0079221_11406539 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300006806|Ga0079220_11080473 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300009036|Ga0105244_10368124 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300009038|Ga0099829_11448432 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300009100|Ga0075418_12011149 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300009137|Ga0066709_104634484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300009148|Ga0105243_12603882 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300009156|Ga0111538_10686937 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300009156|Ga0111538_12842750 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300009162|Ga0075423_12760336 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300009174|Ga0105241_11396866 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300009174|Ga0105241_11877752 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009174|Ga0105241_12132587 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300009176|Ga0105242_12386977 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300009789|Ga0126307_10232140 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300009789|Ga0126307_11731208 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010038|Ga0126315_11003543 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300010042|Ga0126314_10171456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1520 | Open in IMG/M |
3300010046|Ga0126384_11841220 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010047|Ga0126382_10382410 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300010303|Ga0134082_10429132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300010304|Ga0134088_10326404 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300010325|Ga0134064_10303023 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300010360|Ga0126372_11920478 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300010362|Ga0126377_13600762 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300010371|Ga0134125_12779088 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300010373|Ga0134128_10853761 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300010375|Ga0105239_12377019 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010397|Ga0134124_12692268 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010399|Ga0134127_11141365 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300010400|Ga0134122_10059064 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
3300010403|Ga0134123_12795117 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300011269|Ga0137392_11169436 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300011412|Ga0137424_1143425 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300012189|Ga0137388_11398413 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300012189|Ga0137388_12004415 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012202|Ga0137363_10643573 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300012204|Ga0137374_10573202 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300012206|Ga0137380_10759260 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300012351|Ga0137386_10941635 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012685|Ga0137397_10945720 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300012898|Ga0157293_10116805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300012918|Ga0137396_10687295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300012925|Ga0137419_10619039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300012927|Ga0137416_10947269 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300012955|Ga0164298_10135754 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300012960|Ga0164301_10374763 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300012977|Ga0134087_10813116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300012989|Ga0164305_11458425 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300013297|Ga0157378_11083957 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300013297|Ga0157378_13030011 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300013306|Ga0163162_11443046 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300013306|Ga0163162_11916672 | Not Available | 678 | Open in IMG/M |
3300013306|Ga0163162_13370906 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300015264|Ga0137403_10663155 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300015373|Ga0132257_100856697 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300015373|Ga0132257_102126699 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300018476|Ga0190274_12520809 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300018482|Ga0066669_10052153 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
3300019767|Ga0190267_11622401 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300025313|Ga0209431_10615957 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300025917|Ga0207660_10934750 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300025918|Ga0207662_11138782 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300025920|Ga0207649_10870815 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025923|Ga0207681_10373231 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300025925|Ga0207650_10675306 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300025925|Ga0207650_11052713 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300025925|Ga0207650_11865315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300025940|Ga0207691_10403186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1166 | Open in IMG/M |
3300025941|Ga0207711_10427876 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300025945|Ga0207679_11729019 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300025971|Ga0210102_1017128 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300026088|Ga0207641_10884360 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300026089|Ga0207648_10529717 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300026095|Ga0207676_11653747 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300026116|Ga0207674_12019030 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300026118|Ga0207675_101271344 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300026377|Ga0257171_1071634 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300027645|Ga0209117_1143337 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300027880|Ga0209481_10765990 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300028380|Ga0268265_10513143 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300030496|Ga0268240_10184143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300031546|Ga0318538_10699163 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300031716|Ga0310813_10526714 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300031740|Ga0307468_100475049 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300031858|Ga0310892_10827353 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300032074|Ga0308173_10611284 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300032180|Ga0307471_102226042 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300032211|Ga0310896_10429150 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300034177|Ga0364932_0302169 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.51% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.01% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.01% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.26% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.50% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1001462261 | 3300000364 | Soil | GCTLRGDCKQIEQQIVPLLQDAIKRSNGLKDLTEDALK* |
JGI10216J12902_1085933972 | 3300000956 | Soil | LKGSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI* |
JGIcombinedJ43975_100737292 | 3300002899 | Soil | LKGSWEEVETTIVALLQDAVKRANGARDITEDALKETESVI* |
Ga0062589_1017183511 | 3300004156 | Soil | HRNAAGCTLKGSWEDAESEIVALLQDAVKRANGSKDFTDDALKTA* |
Ga0062589_1024339942 | 3300004156 | Soil | AGCTLRGSWEEAETVIVGLLQEAVKRADHLNDITEDALRESVV* |
Ga0062591_1026058031 | 3300004643 | Soil | AGCTLKGSWEEAETTIIALLQDAVKRANGARDLTEDALLGSL* |
Ga0065712_101363431 | 3300005290 | Miscanthus Rhizosphere | GGHRNAAGCTLKGSWEDAETMIIALLQDAVKRANGARDITEDALKEESFI* |
Ga0065715_104926821 | 3300005293 | Miscanthus Rhizosphere | AAGCTLKGSWEEAEQTIVSLLLDAVRRANGSADVTEDALKETESVI* |
Ga0065707_106287561 | 3300005295 | Switchgrass Rhizosphere | GCTLKGSWEEAETIIVRLLQDAVKRANGDLTEDALKESVA* |
Ga0070670_1006505081 | 3300005331 | Switchgrass Rhizosphere | TLRGSWDEVETTIVGLLQDAVKRANGARDITEDALKEPESVI* |
Ga0066388_1044736731 | 3300005332 | Tropical Forest Soil | NAAGCTLKGSWEEAETLIVRLLQDAVKRANGDMTEDALKESVA* |
Ga0068869_1002339013 | 3300005334 | Miscanthus Rhizosphere | AGCTLKGDWEVVETEIVALLLEAVKRANGLKDVTEDALREAS* |
Ga0070675_1015403101 | 3300005354 | Miscanthus Rhizosphere | GCTLRGSWEEAETMIVGLLQDAVKRANGTHDITEDGLKETESVI* |
Ga0070671_1011135671 | 3300005355 | Switchgrass Rhizosphere | AGCTLKGSWEEAEATIMALLQDAVNRANGARDITEDALKETESVI* |
Ga0070705_1018593091 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AGCTLKGSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI* |
Ga0070694_1002244903 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | HRNAAGCTLRGSWEEAETLIVGLLQDAVKRANGARDITEDALKETESVI* |
Ga0070708_1001275871 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GHRNAAGCTLEGTWEEAEQRIVSLLRDAVDRANGSRDITEDRLK* |
Ga0070662_1002170881 | 3300005457 | Corn Rhizosphere | GCTLRGSWEEAETVIVGLLQDAVKRANGSGDITEDALKESVV* |
Ga0068867_1000639061 | 3300005459 | Miscanthus Rhizosphere | HRNAAGCTLKGDWEEVETEIVSLLQEAVKRANGLKDITEDALKDPGLMSV* |
Ga0070679_1017716482 | 3300005530 | Corn Rhizosphere | AGCTLRGKWEDAENTIVGLLLDAVKRANGARDITEDALKETESVI* |
Ga0070697_1007583541 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GHRNAAGCTLRGSWEEAETVIVGLLQDAVKRANGSGDITEDALKESVV* |
Ga0070695_1002196321 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RGAWEDAENMIVALLIDAVKRANGARDITEDALKETESVI* |
Ga0070696_1005791602 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | CTLRGKWEDAENTIVGLLLDAVKRANGARDITEDALKETESVI* |
Ga0070693_1004670471 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGCTLKGDWEEVETEIVSLLQEAVKRANGLKDITEDALKDPGLMSV* |
Ga0066661_105553511 | 3300005554 | Soil | HRNAAGCTLKGNLESVERQVVPLLQDAIKRANGLRDITEDALK* |
Ga0066700_109774431 | 3300005559 | Soil | CTLKGTWEEAEQRIVSLLRDAVDRANGSRDITEDRLK* |
Ga0070664_1002018453 | 3300005564 | Corn Rhizosphere | NAAGCTLKGDWEEVETEIVSLLQEAVKRANGLKDITEDALKDPGLMSV* |
Ga0070664_1011902341 | 3300005564 | Corn Rhizosphere | AGCTLKGSWEEAETEIVRLLQDAVKRANGDMTEDALKESVA* |
Ga0068857_1004631961 | 3300005577 | Corn Rhizosphere | SWEDAENTIVGLLLDAVKRANGARDITEDALKETESVI* |
Ga0068854_1003000773 | 3300005578 | Corn Rhizosphere | SWEEAETIIMGLLQDAVKRANGLRDITEDALSQT* |
Ga0068859_1002616404 | 3300005617 | Switchgrass Rhizosphere | CTLKGSWEEAETTIVRLLQNAVKRADGDMTEDALKESVA* |
Ga0068864_1010680701 | 3300005618 | Switchgrass Rhizosphere | GCTLRGSWEEAETVIVGLLQDAVKRANGTSDITEDALKESVA* |
Ga0068864_1020609231 | 3300005618 | Switchgrass Rhizosphere | AGCTLRGSWEEAETMIVGLLQDAVKRANGARDITEDALKETESVI* |
Ga0068864_1023147671 | 3300005618 | Switchgrass Rhizosphere | AAGCTLKGSWEEAETEIVRLLQDAVKRANGDMTEDALKESVA* |
Ga0068863_1011230562 | 3300005841 | Switchgrass Rhizosphere | AGCTLRGAWEDAENTIVALLLDAVKRANGARDITEDALKETESVI* |
Ga0068858_1007271211 | 3300005842 | Switchgrass Rhizosphere | CTLRGSWEEAETLIVGLLQDAVKRANGARDITEDALKETESVI* |
Ga0068858_1019289781 | 3300005842 | Switchgrass Rhizosphere | RNAAGCTLKGSWEDAETMIIALLQDAVKRANGARDITEDALKEESFI* |
Ga0068860_1001734854 | 3300005843 | Switchgrass Rhizosphere | TLKGSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI* |
Ga0066656_102910431 | 3300006034 | Soil | NAAGCTLEGSWDEVEQKIVPLLQDAVKRANGLKDITEDALKEQ* |
Ga0097621_1019262831 | 3300006237 | Miscanthus Rhizosphere | GGGGHRNAAGCTLKGNCEQIEQQVIPLMQDAIKRSNGLKDLTEDALK* |
Ga0079222_103077113 | 3300006755 | Agricultural Soil | RNAAGCTLKGSWEEAETTIVALLQDAVKRANGARDITEDALKEESVI* |
Ga0066665_107606101 | 3300006796 | Soil | CTLKGDWDEIEQQVVPLLRDAVERANGLKDVTEDALK* |
Ga0066660_112219672 | 3300006800 | Soil | AGCTLRGTWEEAEEKIIALLQDAVKRANGSAEIAEDALAD* |
Ga0079221_114065391 | 3300006804 | Agricultural Soil | LKGSWEEAETMIVRLLQDAVKRASNVDLTEDALKESVA* |
Ga0079220_110804731 | 3300006806 | Agricultural Soil | HRNAAGCTLRGSWEEAETVIVGLLQDAVKRANGVSDITEDALKESVA* |
Ga0105244_103681242 | 3300009036 | Miscanthus Rhizosphere | LKGDWEEVETEIVSLLQEAVKRANGLKDITEDALKDPGLMSV* |
Ga0099829_114484322 | 3300009038 | Vadose Zone Soil | IRRNAAGCTLKGDWDEIEQKVVPLLRDAVERANGLKDVTEDALISSE* |
Ga0075418_120111491 | 3300009100 | Populus Rhizosphere | EAENTIVGLLLDAVKRANGAGDITEDALKETESVI* |
Ga0066709_1046344841 | 3300009137 | Grasslands Soil | NAAGCTLKGNREQIEQQIVPLLQDAIKRSNGLKDLTEDALK* |
Ga0105243_126038822 | 3300009148 | Miscanthus Rhizosphere | LRGTWEEAEEKIIGLLQDAVQRANGAADKTEDAPKE* |
Ga0111538_106869373 | 3300009156 | Populus Rhizosphere | WEDAETMIVGLLQDAVERANGARDITEDALTEPVV* |
Ga0111538_128427501 | 3300009156 | Populus Rhizosphere | VESEIMSLLLDAVKRANGARDITEDALRDPGVTV* |
Ga0075423_127603362 | 3300009162 | Populus Rhizosphere | WEEAESTIVALLQDAVKRANGARDITEDALKDPVV* |
Ga0105241_113968661 | 3300009174 | Corn Rhizosphere | HRNAAGCTLRGSWEEAETIIMGLLQDAVKRANGLKDITEDALTQL* |
Ga0105241_118777522 | 3300009174 | Corn Rhizosphere | HRNAAGCTLKGSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI* |
Ga0105241_121325872 | 3300009174 | Corn Rhizosphere | KGSWEDAESEIVALLQDAVNRANGLKDVTEDALKTA* |
Ga0105242_123869772 | 3300009176 | Miscanthus Rhizosphere | WEEAETTIVALLQDAVKRANGARDITEDALKETESVI* |
Ga0126307_102321401 | 3300009789 | Serpentine Soil | GSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI* |
Ga0126307_117312082 | 3300009789 | Serpentine Soil | AAGCTLRGSWEEAETMIVGLLQEAVKRADHLHDITEDALKESVV* |
Ga0126315_110035432 | 3300010038 | Serpentine Soil | RNAAGCTLRGSWEEAENTIVSLLLDAVKRTNGASDITEDALKETESVI* |
Ga0126314_101714564 | 3300010042 | Serpentine Soil | ENTIVSLLQGAVKRANGAADITEDALKDAETESVI* |
Ga0126384_118412202 | 3300010046 | Tropical Forest Soil | LKGTWEEAEAEIVALLLDAVKRANGAKDITEDRDHNPESVI* |
Ga0126382_103824101 | 3300010047 | Tropical Forest Soil | GGHRNAAGCTLRGSSAEIEQKVVPLLQDAIKRANGSKDLTEDALSEPPAIAGG* |
Ga0134082_104291321 | 3300010303 | Grasslands Soil | NAAGCTVKGEVCEVEQQVVPLLQDAVKRANGAKDMTEDALK* |
Ga0134088_103264041 | 3300010304 | Grasslands Soil | AAGCTLEGSWDEVEQKVVPLLQDAVKRANGLKDITEDALKEGQ* |
Ga0134064_103030232 | 3300010325 | Grasslands Soil | GCTLKGNLESVERQVVPLLQDAIKRANGLRDITEDALK* |
Ga0126372_119204782 | 3300010360 | Tropical Forest Soil | CTLKGSWEEAETMIVGLLQDAVKRANGARDITEDALKEESFI* |
Ga0126377_136007621 | 3300010362 | Tropical Forest Soil | GSWEEAETVIVGLLQDAVKRANGLNDITEDALRESVA* |
Ga0134125_127790881 | 3300010371 | Terrestrial Soil | AGCTLKGSWEEAETTIVALLQDAVKRANGARDLTEDALKETESVI* |
Ga0134128_108537613 | 3300010373 | Terrestrial Soil | GDWEEVETEIVSLLQEAVKRANGLKDITEDALKDPGLMSV* |
Ga0105239_123770191 | 3300010375 | Corn Rhizosphere | GCTLRGSWEEAENLIVVLLLEAVKRANGARDITEDALKDTEPVV* |
Ga0134124_126922682 | 3300010397 | Terrestrial Soil | AAGCTLRGSWEEAETTIVRLLQEAVKRANGDLTEDALKESVA* |
Ga0134127_111413651 | 3300010399 | Terrestrial Soil | NAAGCTLRGNWDDVESEIMSLLLDAVKRANGARDITEDALRDPGVTV* |
Ga0134122_100590641 | 3300010400 | Terrestrial Soil | AGCTLKGSWEEAETMIVRLLQDAVKRANNVDLTEDALKESVA* |
Ga0134123_127951171 | 3300010403 | Terrestrial Soil | TLRGSWEEAETVIVGLLQDAVKRANGSGDITEDALKESVV* |
Ga0137392_111694362 | 3300011269 | Vadose Zone Soil | RNAAGCTLRGTWEEAEEKIIALLQDAVERANGDITEDALKD* |
Ga0137424_11434251 | 3300011412 | Soil | HRNAAGCTLKGSWEEAEAQIVTLLLDAVKRANGSRDITEDALKDVGLMSV* |
Ga0137388_113984131 | 3300012189 | Vadose Zone Soil | RNAAGCTLRGTWEEAEEKIIALLQDAVERANGLADITEDALISE* |
Ga0137388_120044151 | 3300012189 | Vadose Zone Soil | RNAAGCTLKGDLAELEEKLVPLLQDAVKRANGLKDITEDALLSSEGSRQ* |
Ga0137363_106435732 | 3300012202 | Vadose Zone Soil | WEEAEEKIIALLQDAVERANGLADITEDALAGID* |
Ga0137374_105732022 | 3300012204 | Vadose Zone Soil | NAAGCTLRGTWEEAEEKIIALLQDAVERANGSRDITEDALDSE* |
Ga0137380_107592602 | 3300012206 | Vadose Zone Soil | GCTLEGSWDEVEKKVVPLLQDAVKRANGLKDITEDALIDSEGSKH* |
Ga0137386_109416352 | 3300012351 | Vadose Zone Soil | RNAAGCTLTGPWEDAEQRIVSLLRDAVDRANGGQDITEDSLK* |
Ga0137397_109457201 | 3300012685 | Vadose Zone Soil | NAAGCTLKGDWDEIERQVVPLLRNAVERANGLKDLTEDALK* |
Ga0157293_101168051 | 3300012898 | Soil | KGSWEEAETMIIGLLQDAVKRANGARDITEDALKETESVI* |
Ga0137396_106872951 | 3300012918 | Vadose Zone Soil | GGGHRNAAGCTLKGNLLELEQKLVPLLQDAVKRANGLKDITEDALSEPPAVAGG* |
Ga0137419_106190391 | 3300012925 | Vadose Zone Soil | CTLRGDWDEIEKQIVPLLRDAVERANGLKDVTEDALK* |
Ga0137416_109472691 | 3300012927 | Vadose Zone Soil | AGCTLKGDWDEIEQRLVPLLRDAVERANGLKDVTEDALK* |
Ga0164298_101357541 | 3300012955 | Soil | TWEEAETVIVGLLQDAVKRANGLRDITEDALKESVA* |
Ga0164301_103747632 | 3300012960 | Soil | RGSWEDVESEIVALLQDAVKRANGSRDITEDALKTA* |
Ga0134087_108131161 | 3300012977 | Grasslands Soil | GGGHRNAAGCTVKGEVGEVEQQVVPLLQDAVKRANGAKDMTEDALK* |
Ga0164305_114584252 | 3300012989 | Soil | EEAETVIVGLLQDAVKRANGLRDITEDALKESVA* |
Ga0157378_110839573 | 3300013297 | Miscanthus Rhizosphere | WEEAETTIMALLQDAVKRANGARDITEDALKETESVI* |
Ga0157378_130300112 | 3300013297 | Miscanthus Rhizosphere | HRNAAGCTVKGEGCEVEQQVVPLLQDAVKRANGAKDMTDDALK* |
Ga0163162_114430462 | 3300013306 | Switchgrass Rhizosphere | GCTLRGSWEEAETLIVGLLQDAVKRANGARDITEDALKETESVI* |
Ga0163162_119166723 | 3300013306 | Switchgrass Rhizosphere | GHRNAAGCTLKGNCEQIEQQVIPLMQDAIKRSNGLKDLTEDALK* |
Ga0163162_133709061 | 3300013306 | Switchgrass Rhizosphere | GGHRNAAGCTLHGSWEEAETIIMGLLQDAVKRANGLRDITEDALSQT* |
Ga0137403_106631551 | 3300015264 | Vadose Zone Soil | LTGSWEEAERLIVGLLQDAVQRANGMKDITEDALRDSEPESVV* |
Ga0132257_1008566972 | 3300015373 | Arabidopsis Rhizosphere | AAGCTLRGSWEEVESEIVVLLQDAVKRANGSRDITEDAVKQG* |
Ga0132257_1021266991 | 3300015373 | Arabidopsis Rhizosphere | GSWEEAETVIVGLLQDAVKRATGLGDVTEDALRESVA* |
Ga0190274_125208091 | 3300018476 | Soil | EAETTIVALLQDAVKRANGAADITEDALKETESVI |
Ga0066669_100521531 | 3300018482 | Grasslands Soil | AGCTLKGNLESVERQVVPLLQDAIKRANGLRDITEDALK |
Ga0190267_116224012 | 3300019767 | Soil | HRNAAGCTLRGTWEEAEEKIIGLLQHAVERANGSSEASEE |
Ga0209431_106159572 | 3300025313 | Soil | LKGSWEEAENEIVSLLRDAVERANGLKDITEDTLQNSETKSKM |
Ga0207660_109347502 | 3300025917 | Corn Rhizosphere | AGCTLRGAWEDAENTIVALLLDAVKRANGARDITEDALKETESVI |
Ga0207662_111387821 | 3300025918 | Switchgrass Rhizosphere | RNAAGCTLRGTWEEAEEKIIALLQDAVARANGLADITEDALIGTE |
Ga0207649_108708151 | 3300025920 | Corn Rhizosphere | KGSWEEAETTIMALLQDAVKRANGARDITEDALKETESVI |
Ga0207681_103732311 | 3300025923 | Switchgrass Rhizosphere | CTLRGSWEEVENQITSLLQDAVGRANGNPDVTDDGLREES |
Ga0207650_106753061 | 3300025925 | Switchgrass Rhizosphere | NAAGCTLRGSWDEVETTIVGLLQDAVKRANGARDITEDALKEPESVI |
Ga0207650_110527131 | 3300025925 | Switchgrass Rhizosphere | HRNAAGCTLKGSWEEAETTIVALLQDAVKRANGARDITEDALKESVI |
Ga0207650_118653151 | 3300025925 | Switchgrass Rhizosphere | CTLKGSWEEAETMIVALLQDAVKRANGARDITEDALKETESII |
Ga0207691_104031863 | 3300025940 | Miscanthus Rhizosphere | CCTLHGSWEEAETIIMGLLQDAVKRANGLRDITEDALSQT |
Ga0207711_104278763 | 3300025941 | Switchgrass Rhizosphere | SWEEAETTIVALLQDAVKRANGARDITEDALKEESFI |
Ga0207679_117290192 | 3300025945 | Corn Rhizosphere | NAAGCTLKGSWEEAETTIMALLQDAVKRANGARDITEDALKEESFI |
Ga0210102_10171281 | 3300025971 | Natural And Restored Wetlands | NAAGCTLRGSWEEAETTIIGLLQDAVKRANGVSDITEDALKDGESVL |
Ga0207641_108843601 | 3300026088 | Switchgrass Rhizosphere | LRGTWEEAEEKIIGLLQDAVERANGSAEVTEDALKD |
Ga0207648_105297171 | 3300026089 | Miscanthus Rhizosphere | LHGSWEEAETIIMGLLQDAVKRANGLRDITEDALSQT |
Ga0207676_116537471 | 3300026095 | Switchgrass Rhizosphere | RNAAGCTLRGSWEEAETTIVGLLQDAVKRANGARDITEDALIER |
Ga0207674_120190302 | 3300026116 | Corn Rhizosphere | RNAAGCTLKGDWEEVETEIVSLLQEAVKRANGLKDITEDALKDPGLMSV |
Ga0207675_1012713441 | 3300026118 | Switchgrass Rhizosphere | GCTLKGSWEEAERTIVALLQDAVKRANGARDITEDALKESVI |
Ga0257171_10716342 | 3300026377 | Soil | HRNAAGCTLRGTWEEAEEKIIGLLQDAVERANGAADKTEDELKE |
Ga0209117_11433371 | 3300027645 | Forest Soil | CTLRGTWEEAEEKIIALLQDAVERANGDITEDALKQ |
Ga0209481_107659902 | 3300027880 | Populus Rhizosphere | AGCTLKGSWEEAETTIVALLQDAVNRANGFGDITEDALKDSELLSH |
Ga0268265_105131433 | 3300028380 | Switchgrass Rhizosphere | GCTLRGSWEEAETTIVALLQDAVKRANGARDITEDALIER |
Ga0268240_101841432 | 3300030496 | Soil | NAAGCTLRGSWEEAETVIVGLLQEAVKRANGLNDITEDALRESVA |
Ga0318538_106991631 | 3300031546 | Soil | RNAAGCTLKGNCEQIEQQIVPLLQDAIKRSNGTSDLTEDALK |
Ga0310813_105267141 | 3300031716 | Soil | HRNAAGCTLRGSWEEAETVIVGLLQDAVKRANGRSDITEDALKESVA |
Ga0307468_1004750491 | 3300031740 | Hardwood Forest Soil | CTLRGSWEEAETMIVGLLQDAVKRANGARDITEDALKDTEPESVI |
Ga0310892_108273532 | 3300031858 | Soil | LRGSWEEAETTIVRLLQDAVKRANGDLTEDALKESVA |
Ga0308173_106112843 | 3300032074 | Soil | KGSWEEAETTIVALLQDAVKRANGARDITEDALKETESVI |
Ga0307471_1022260422 | 3300032180 | Hardwood Forest Soil | RGTWEEAEEKIIALLQDAVKRANGSAEITEDALKEL |
Ga0310896_104291501 | 3300032211 | Soil | RNAAGCTLRGNCEEIEQQVVPLLQDAIKRANGSKDLTEDSLK |
Ga0364932_0302169_480_602 | 3300034177 | Sediment | CTLRGTWEEAEEKIIALLQDAVERANGSADITEDALADGE |
⦗Top⦘ |