NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060046

Metagenome / Metatranscriptome Family F060046

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060046
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 51 residues
Representative Sequence TSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKIICI
Number of Associated Samples 44
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.73 %
% of genes near scaffold ends (potentially truncated) 90.23 %
% of genes from short scaffolds (< 2000 bps) 94.74 %
Associated GOLD sequencing projects 43
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine
(57.143 % of family members)
Environment Ontology (ENVO) Unclassified
(93.985 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.481 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.04%    β-sheet: 0.00%    Coil/Unstructured: 38.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF11302DUF3104 14.29
PF01786AOX 2.26
PF01751Toprim 0.75
PF02569Pantoate_ligase 0.75
PF00171Aldedh 0.75
PF00583Acetyltransf_1 0.75
PF14233DUF4335 0.75
PF13508Acetyltransf_7 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.75
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.75
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.75
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.25 %
UnclassifiedrootN/A0.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001955|GOS2237_1010390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus929Open in IMG/M
3300001964|GOS2234_1038182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus2051Open in IMG/M
3300001969|GOS2233_1113686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1796Open in IMG/M
3300002033|GOS24894_10174336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus874Open in IMG/M
3300002040|GOScombined01_101394886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1375Open in IMG/M
3300002040|GOScombined01_105293021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus807Open in IMG/M
3300005432|Ga0066845_10397047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus534Open in IMG/M
3300005606|Ga0066835_10160678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus747Open in IMG/M
3300005960|Ga0066364_10341224All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006305|Ga0068468_1088415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus2259Open in IMG/M
3300006305|Ga0068468_1129460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1820Open in IMG/M
3300006305|Ga0068468_1132191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2009Open in IMG/M
3300006305|Ga0068468_1148763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1305Open in IMG/M
3300006316|Ga0068473_1629024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus510Open in IMG/M
3300006329|Ga0068486_1177187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1485Open in IMG/M
3300006329|Ga0068486_1180305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus561Open in IMG/M
3300006329|Ga0068486_1189584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus800Open in IMG/M
3300006329|Ga0068486_1192584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus831Open in IMG/M
3300006329|Ga0068486_1234224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus570Open in IMG/M
3300006329|Ga0068486_1241930All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006329|Ga0068486_1278961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus609Open in IMG/M
3300006334|Ga0099675_1130147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1731Open in IMG/M
3300006334|Ga0099675_1229724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus788Open in IMG/M
3300006334|Ga0099675_1246501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus825Open in IMG/M
3300006334|Ga0099675_1309601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus805Open in IMG/M
3300006334|Ga0099675_1354189All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300006334|Ga0099675_1494795Not Available648Open in IMG/M
3300006334|Ga0099675_1705034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus551Open in IMG/M
3300006337|Ga0068495_1224130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus530Open in IMG/M
3300006337|Ga0068495_1229367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1020Open in IMG/M
3300006337|Ga0068495_1261656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1916Open in IMG/M
3300006337|Ga0068495_1282664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1394Open in IMG/M
3300006337|Ga0068495_1316606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus576Open in IMG/M
3300006337|Ga0068495_1365260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1035Open in IMG/M
3300006337|Ga0068495_1371431All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006337|Ga0068495_1400239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus671Open in IMG/M
3300006337|Ga0068495_1423605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus705Open in IMG/M
3300006337|Ga0068495_1473867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp.1157Open in IMG/M
3300006345|Ga0099693_1214777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus731Open in IMG/M
3300006345|Ga0099693_1243734All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300006345|Ga0099693_1247752All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300006345|Ga0099693_1277557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus593Open in IMG/M
3300006345|Ga0099693_1375901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus649Open in IMG/M
3300006350|Ga0099954_1106143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus2077Open in IMG/M
3300006350|Ga0099954_1116160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus3247Open in IMG/M
3300006350|Ga0099954_1117084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus693Open in IMG/M
3300006350|Ga0099954_1117119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1336Open in IMG/M
3300006350|Ga0099954_1137365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus868Open in IMG/M
3300006350|Ga0099954_1145652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus923Open in IMG/M
3300006350|Ga0099954_1149942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus610Open in IMG/M
3300006350|Ga0099954_1164248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1280Open in IMG/M
3300006350|Ga0099954_1174237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus719Open in IMG/M
3300006350|Ga0099954_1186646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus762Open in IMG/M
3300006350|Ga0099954_1206083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1906Open in IMG/M
3300006350|Ga0099954_1288204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus505Open in IMG/M
3300006350|Ga0099954_1289818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1171Open in IMG/M
3300006350|Ga0099954_1327851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus708Open in IMG/M
3300006350|Ga0099954_1382617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus926Open in IMG/M
3300006350|Ga0099954_1407275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus600Open in IMG/M
3300006351|Ga0099953_1259257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus841Open in IMG/M
3300006351|Ga0099953_1302962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus542Open in IMG/M
3300006351|Ga0099953_1342510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus862Open in IMG/M
3300006351|Ga0099953_1371608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus752Open in IMG/M
3300006413|Ga0099963_1087084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus2759Open in IMG/M
3300006413|Ga0099963_1088538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1799Open in IMG/M
3300006413|Ga0099963_1102625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1819Open in IMG/M
3300006413|Ga0099963_1110344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1090Open in IMG/M
3300006413|Ga0099963_1133069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus740Open in IMG/M
3300006413|Ga0099963_1140365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1005Open in IMG/M
3300006413|Ga0099963_1156555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1332Open in IMG/M
3300006413|Ga0099963_1171982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus908Open in IMG/M
3300006413|Ga0099963_1181450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus668Open in IMG/M
3300006413|Ga0099963_1245266All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300006413|Ga0099963_1258229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus595Open in IMG/M
3300006413|Ga0099963_1320247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus783Open in IMG/M
3300006478|Ga0100224_1276026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus643Open in IMG/M
3300006480|Ga0100226_1128956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1181Open in IMG/M
3300006480|Ga0100226_1293985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus843Open in IMG/M
3300006480|Ga0100226_1324106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus583Open in IMG/M
3300006480|Ga0100226_1332997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus547Open in IMG/M
3300006480|Ga0100226_1355154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus603Open in IMG/M
3300006480|Ga0100226_1399873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus618Open in IMG/M
3300006480|Ga0100226_1492741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus532Open in IMG/M
3300006481|Ga0100229_1168448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1260Open in IMG/M
3300006481|Ga0100229_1198262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus926Open in IMG/M
3300006481|Ga0100229_1226655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus855Open in IMG/M
3300006481|Ga0100229_1231056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus941Open in IMG/M
3300006481|Ga0100229_1231716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus675Open in IMG/M
3300006481|Ga0100229_1279861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus652Open in IMG/M
3300006481|Ga0100229_1279862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1281Open in IMG/M
3300006481|Ga0100229_1285348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus749Open in IMG/M
3300006481|Ga0100229_1317083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 9401826Open in IMG/M
3300006842|Ga0068494_122876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1198Open in IMG/M
3300007112|Ga0101560_1095135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus596Open in IMG/M
3300007333|Ga0079270_1064779All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300007333|Ga0079270_1131765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus594Open in IMG/M
3300007333|Ga0079270_1415733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus571Open in IMG/M
3300009790|Ga0115012_10852207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus742Open in IMG/M
3300009790|Ga0115012_12077062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus506Open in IMG/M
3300011309|Ga0138368_1134763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus699Open in IMG/M
3300011315|Ga0138402_1025715All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300012919|Ga0160422_10725324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus635Open in IMG/M
3300012920|Ga0160423_10357325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1001Open in IMG/M
3300012928|Ga0163110_11060887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus647Open in IMG/M
3300012928|Ga0163110_11581118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus533Open in IMG/M
3300012936|Ga0163109_10201368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1461Open in IMG/M
3300012936|Ga0163109_10320343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1135Open in IMG/M
3300012936|Ga0163109_10863861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 9401661Open in IMG/M
3300012936|Ga0163109_11133550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus571Open in IMG/M
3300012954|Ga0163111_11290864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus716Open in IMG/M
3300020270|Ga0211671_1020815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1294Open in IMG/M
3300020366|Ga0211489_10229971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus523Open in IMG/M
3300020391|Ga0211675_10400445All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300020420|Ga0211580_10194409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus840Open in IMG/M
3300020424|Ga0211620_10103998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1223Open in IMG/M
3300020424|Ga0211620_10231512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus790Open in IMG/M
3300020433|Ga0211565_10244703All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300020446|Ga0211574_10204001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus859Open in IMG/M
3300020448|Ga0211638_10571694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus532Open in IMG/M
3300020457|Ga0211643_10508422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus592Open in IMG/M
3300020465|Ga0211640_10682209All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300020467|Ga0211713_10340014All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300026081|Ga0208390_1073202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus873Open in IMG/M
3300031785|Ga0310343_10040742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus2768Open in IMG/M
3300031785|Ga0310343_10160051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1508Open in IMG/M
3300031785|Ga0310343_10200457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1364Open in IMG/M
3300031785|Ga0310343_10331158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus1086Open in IMG/M
3300031785|Ga0310343_10340962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus1071Open in IMG/M
3300031785|Ga0310343_10557359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus848Open in IMG/M
3300031785|Ga0310343_10915583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus661Open in IMG/M
3300031785|Ga0310343_11001286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus631Open in IMG/M
3300031785|Ga0310343_11212868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus570Open in IMG/M
3300031785|Ga0310343_11549095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus500Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine57.14%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.77%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.77%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.52%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater6.02%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine6.02%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.26%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.75%
Stylissa Sp. (Marine Sponge)Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge)0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001955Marine microbial communities from Gulf of Panama, Panama - GS021EnvironmentalOpen in IMG/M
3300001964Marine microbial communities from Rosario Bank, Honduras - GS018EnvironmentalOpen in IMG/M
3300001969Marine microbial communities from Yucatan Channel, Mexico - GS017EnvironmentalOpen in IMG/M
3300002033Marine microbial communities from the Sargasso Sea - GS000a &bEnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300005960Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_AEnvironmentalOpen in IMG/M
3300006305Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025mEnvironmentalOpen in IMG/M
3300006316Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000mEnvironmentalOpen in IMG/M
3300006329Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500mEnvironmentalOpen in IMG/M
3300006334Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025mEnvironmentalOpen in IMG/M
3300006337Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025mEnvironmentalOpen in IMG/M
3300006345Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075mEnvironmentalOpen in IMG/M
3300006350Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075mEnvironmentalOpen in IMG/M
3300006351Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045mEnvironmentalOpen in IMG/M
3300006413Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025mEnvironmentalOpen in IMG/M
3300006478Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125mEnvironmentalOpen in IMG/M
3300006480Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075mEnvironmentalOpen in IMG/M
3300006481Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025mEnvironmentalOpen in IMG/M
3300006842Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_1_0025mEnvironmentalOpen in IMG/M
3300007112Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', st5dcHost-AssociatedOpen in IMG/M
3300007333Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_B metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300011309Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 Surf_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011315Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S21 Surf_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300020270Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042)EnvironmentalOpen in IMG/M
3300020366Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146)EnvironmentalOpen in IMG/M
3300020391Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020448Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020467Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957)EnvironmentalOpen in IMG/M
3300026081Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2237_101039033300001955MarineVLLKLTNKIKINKVVTKGIKGIRVVEFMRLPTGKICI*
GOS2234_103818243300001964MarineKLTNKIKINTDVTKGIKGIRVVEFMKFPTKKNMYLT*
GOS2233_111368653300001969MarineNDPIKAEPNKDNTTSAVTGFVNLLSVLLKLTNKIKINNEVTKGIKGMRVVEFMKFPTKIICI*
GOS24894_1017433613300002033MarinePIKAEPNKDNTTSAVTGFVNLLSVLLKLTNKIKINNEVTKGIKGMRVVEFMKFPTKIICI
GOScombined01_10139488633300002040MarineAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
GOScombined01_10529302143300002040MarineSVLLKLANKIRIKKDVTKGIKGIRVVEFMKFPTEKICI*
Ga0066845_1039704713300005432MarineLVNLLSVLLKLTNKTKINKEVKRGIKGIRIVEFIKVPTKKICI*
Ga0066835_1016067813300005606MarineLKLANKIRIKKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0066364_1034122423300005960MarineVLIKPELNKDNATSAVTGFVNLLSVLLKLTNKIKMNKEITKGIKGIRVVEFMKFPKEINMYLT*
Ga0068468_108841553300006305MarineVTGFVNLLIVLLKLTNKTKINKAVTRGIKGIRIVVFMKLLTKKYVSN*
Ga0068468_112946063300006305MarineLLSVLLKLTNKTKINKEVKKGIKGIRIVEFIKVPTKKICI*
Ga0068468_113219113300006305MarineGFVNLLSVLLKLAYKIRINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0068468_114876353300006305MarineSNKHIKAELNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0068473_162902413300006316MarineDNETSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFITKIISI*
Ga0068486_117718713300006329MarineLIKAELDKDNATSAVTGFVNLLIVLLKLTNKIKINKVVTRGIKGIRIVEFMKFPTKIICI
Ga0068486_118030513300006329MarineGVLSKLANKIRINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0068486_118958443300006329MarineVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0068486_119258433300006329MarineMKAELNKDNATSAVTGFVSLLSVLLKLINKIKINKEVTKGIRGIRVVEFMKFPTEKICI*
Ga0068486_123422413300006329MarineSKELIKAELNKDNATSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKINMYLI*
Ga0068486_124193023300006329MarineKLANKIKMNKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0068486_127896113300006329MarineSNELTKAEPNKDNATSAVTGFVSLLSVLLKLTNKIKINKEVAKGIKGIRVVEFMKFPTKIICI*
Ga0099675_113014763300006334MarineTGFVNLLSVLLKLTNKIKINKAVNRGNKGIRMVEFMKLPTKIICI*
Ga0099675_122972413300006334MarineFVNLLSVLLKLTSKIKIIKEVTKGIKGIRVIEFMKFPTKIMCI*
Ga0099675_124650133300006334MarineETSAVTGFVNLLSVLLKLTNKIKINKDVTKGIKGMRVVEFIKFPTKIICI*
Ga0099675_130960113300006334MarineSAVTGFVNLFNVLLKLTSKIKINKVVTRGIKGIRIVEFMKFPTKIICI*
Ga0099675_135418943300006334MarineVTSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFSTK*
Ga0099675_149479523300006334MarineMYFFKIANELIKAELNKDNATRAVTGFVNLLTVLLKLTNKTKINKEVTKGIKVMRVDEFMKLPTEIICI*
Ga0099675_170503413300006334MarineNELIKAELNKDNATNAVTGFVNLLSVLLKLTNKIKINIEVTKGIKGIRVVEFMKFPTK*
Ga0068495_122413023300006337MarineVENELIKAELNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0068495_122936743300006337MarineELNKDNATSAVTGFVNLLSVLLKLANKIIIKKEVTKGIKGIRVVEFMKFPKKIIGI*
Ga0068495_126165643300006337MarineMQKDKIRINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0068495_128266413300006337MarineYELIKAELNKDNATSAVTGFVNLLSVLLKLANKIRTNKEVTKGIKGIRVVEFMKFPTKIICN*
Ga0068495_131660633300006337MarineAVTGFVNLLRVLLKLANKIRINKEVIKGIKGIRVVEFMKFPMEIICI*
Ga0068495_136526013300006337MarineVRIKAEVNNDNASCAVTGFVSLLRVQLKLTNKIKINKEVIKGIKGIRVAEFMKFPTKIICI*
Ga0068495_137143113300006337MarineATSAVTGFVNLLSVLLKLANKIRINKEVAKGIKGIRVVEFMKFPTKNNMYLT*
Ga0068495_140023933300006337MarineDTFPSSNKDNAISAVTGFVNLLSVLLKLTNKTKINKAVTRGIKGIRIVEFIKFPTKIICI
Ga0068495_142360533300006337MarineAELNKDNATSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0068495_147386713300006337MarineLNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKNMYLT*
Ga0099693_121477713300006345MarineIKAELNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0099693_124373413300006345MarineLIKAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTEIICI
Ga0099693_124775213300006345MarineMKAEPNKDNATSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0099693_127755733300006345MarineFTVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTKKICI*
Ga0099693_137590133300006345MarineELNKDNAISAVTGFVNLLSVLLKLTNKIKMNKEVTRGIKGIRVVEFMKFPTKIICI*
Ga0099954_110614313300006350MarineGFVNLLSVLLKLANKIRINKEVNKGIKGIRVVEFIKFPTKIMCI*
Ga0099954_111616013300006350MarineLNKDNATSAVTGFVNLLSVLLKLANKIKINKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0099954_111708433300006350MarineTGFVNLLRVLLKLANKIRINKEVNKGIKGIRVVEFMKFPTKIISI*
Ga0099954_111711963300006350MarineVVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0099954_113736533300006350MarineALIKAELNKDNAISAVTGLVNLLSVLLKLTNKIKMNKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0099954_114565213300006350MarineELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVTKGIRGIRVVEFMKFPTEKICI*
Ga0099954_114994233300006350MarineLIKAELNKDNTTSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGMRVAEFMKFPTKIICI
Ga0099954_116424853300006350MarineTKAELTKDNATREVTGFVSLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0099954_117423733300006350MarineELNKDNATSAVTGFVSLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0099954_118664633300006350MarineKAELNKDNATNAVTGFVNLLSVLLKLTNKIKINREVTKGIKGIRVVEFMKFPTKIICI*
Ga0099954_120608313300006350MarineLSVMLKLTNKIKINKEITIGIKGMRVVEFMKFPTEIICI*
Ga0099954_128820413300006350MarineIAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0099954_128981843300006350MarineNKHIKAELNKDNATNAVTGFVNLLSVLLKLINKIKIKKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0099954_132785113300006350MarineLIKAELNKDNATSAVTGFVNLLIVLLKLINKIKINKQVTKGIKGIRVVEFMKFTTKIISI
Ga0099954_138261733300006350MarineAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0099954_140727513300006350MarineLIKAELNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRDVEFMKIPTENICI
Ga0099953_125925743300006351MarineKDNKTSVVTGFVNLLSVLLKLTSKIRINKEVTKGTKGMRVVEFMKFPKKIIYI*
Ga0099953_130296213300006351MarineLLRIVKKAYKAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0099953_134251043300006351MarineLIKAELNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI
Ga0099953_137160833300006351MarineIKAELNIDNATSAVTGFVNLLSVLLKLANKIRINKEVIKGIKGIRVVEFMKFPTEKNMYLT*
Ga0099963_108708483300006413MarineLNKDNATSAETGFVNLLRVLLKLIYKIKINKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0099963_108853863300006413MarineSNADNKDNAISAVTGFVSLFIVLLKLTNKVKINKVVTRGIKGIRVVEFIKFPSK*
Ga0099963_110262563300006413MarineSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPKKIICI*
Ga0099963_111034413300006413MarineYFLKIANKLIKAELNKDSATSAVTGFVNVKRSVETYNKIKMNKEVTKGIKGMRVVEFIKFPTKIMYI*
Ga0099963_113306913300006413MarineLNKDNATSAVTGFVNLLSVLLKLTNKIQINKEVNKGIKGIRVVEFMKFPTEKICI*
Ga0099963_114036513300006413MarineTIAVTGFVNLFSVLLKLANRIKINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0099963_115655553300006413MarineVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTKIISI*
Ga0099963_117198213300006413MarineTSAVTGFVSLLSVLLKLTNKTKINKEVKKGIKGIRIVEFMKFPTKMNF*
Ga0099963_118145013300006413MarineIIAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRDVEFIKFPTKIMCI*
Ga0099963_124526613300006413MarineTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTE*
Ga0099963_125822913300006413MarineDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0099963_132024733300006413MarineTIAVTGFVNLLSVLLKLTNKVKINKEVAKGIKGIRVVEFMKFPKKIICI*
Ga0100224_127602613300006478MarineKLIKAELNKDNATIAVTGFVNLLSVLLKLANKIRINKEVTKGIKGMRVVEFMKFPT*
Ga0100226_112895643300006480MarineIEAELNKDNATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0100226_129398543300006480MarineSVLLKLANKIRTNKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0100226_132410613300006480MarineVTGFVNLLSVLLKLINKININKEVTKGIKGIRVVVFMKFPTKVMRI*
Ga0100226_133299723300006480MarineLLNLANKIRINKEVTKGIIGIRVVEFMKFHTKIICI*
Ga0100226_135515413300006480MarineVTGFVNLLSVLLKLTNKTKIDKAVQRGIKGIRIVEIMKLPTKIICI*
Ga0100226_139987313300006480MarineFVNLLSVLLKLANKISINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0100226_149274123300006480MarineLIKAELNKDNATSAVTGFVNLLRVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKIIRN
Ga0100229_116844853300006481MarineIKAELNKDNATSAVTGFVNLLSVLLKLANKTRMNTEVTKGIKGIRVVEFMKFPTKIICI*
Ga0100229_119826213300006481MarineKAELNKDNATSPVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0100229_122665513300006481MarineLIKAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVIEFMKFPTEIICI
Ga0100229_123105623300006481MarineMLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKKICI*
Ga0100229_123171633300006481MarineIKAELNKDNATSALTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0100229_127986113300006481MarineLMFLIRIKKEVTKGIKGIRVVEFMKFPTEMIMYLT*
Ga0100229_127986213300006481MarineATSAVTGFVNLLSVLLKLTNKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0100229_128534813300006481MarineKAELNKDNATSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTEIICI*
Ga0100229_131708343300006481MarineVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVIEFMKFPTKIICI*
Ga0068494_12287613300006842MarineKAEPNKDNATSAVTGFVNLLSVLLKLINKIKINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0101560_109513513300007112Stylissa Sp. (Marine Sponge)NATSAVTGFVNLLSVLLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0079270_106477913300007333MarineMLIKEELNKDKVTSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIR
Ga0079270_113176523300007333MarineLKLANKIRIKKEVTKGIKGIRVVEFMKFPTEKICI*
Ga0079270_141573323300007333MarineTGFVNLLSVLLKLTNKIKINKDVTNGIKGIRVVEFMRFPTKIMCI*
Ga0115012_1085220723300009790MarineTSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0115012_1207706213300009790MarineNKDNATSAVTGFVNLLSVLLKLTNKTKINKAVARGIKGIRIDEFIKFPTKNNMYLT*
Ga0138368_113476313300011309MarineLLSVLLKLANKIRINKEVTKGTKGIRVVEFMKFPTEIICI*
Ga0138402_102571513300011315MarineSNELIKAEPNKDNATSAVTGFVNLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0160422_1072532423300012919SeawaterAVTGFVNLLRVLLKHTNKIKINKEVTKGIKGIRVVEFIKFPTKIICI*
Ga0160423_1035732513300012920Surface SeawaterKLTNKIKINKAVTRGIKGIRIVEFMKLSTKIICI*
Ga0163110_1106088723300012928Surface SeawaterIKAELNKDNAITAVIGFVNLLIVLLKLANKTRINKAVARGIKGIRIDVFKKFPTNKTSI*
Ga0163110_1158111813300012928Surface SeawaterSNVPIKAELNKDNAISAVTGFVNLLSVLLKLTNKIKINKAVTRGIKGIRIVEFMKLSTKIICI*
Ga0163109_1020136843300012936Surface SeawaterMKAELNKDSATSAVTGFVNLFSVLLKLTNKIKINKAVIRGIKGIRTIEFKKFPKKIICI*
Ga0163109_1032034323300012936Surface SeawaterKLTNKIKINKEVTKGIKGIRVVEFMKFPTKIICI*
Ga0163109_1086386113300012936Surface SeawaterLLSVLLKLTNKIKINKAVTRGIKGIRIVEFMKLSTKIICI*
Ga0163109_1113355023300012936Surface SeawaterNLLSVLLKVTNKIQINKEVTKGIKGIRIIEFMKFSTKIIYI*
Ga0163111_1129086423300012954Surface SeawaterSGTGFGKLISVLLKLNNKKKINKAVTRGIKGIRIVEFMKLSTKIICI*
Ga0211671_102081543300020270MarineELIKAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKAVTRGIKGIRIVEFMKFPTKIIC
Ga0211489_1022997113300020366MarineLLSVLLKLANKIRINKEVTKGIKGIRVVEFMKFPTKKICI
Ga0211675_1040044513300020391MarineMKAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVNKGIKGIRVVEFMKFPTKIICI
Ga0211580_1019440923300020420MarineLLSVLLKLTNKIKINNEVTKGIKGIIVVEFMKFPTKKIGI
Ga0211620_1010399813300020424MarineAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTKIIMYMI
Ga0211620_1023151233300020424MarineAELNKDNATSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMKFPTKISKYLT
Ga0211565_1024470313300020433MarineMKAELNKDNSTSAVTGFVNLLSVLLKLTNKIKINKEVTKGIKGIRVVEFMNFPTKTICI
Ga0211574_1020400123300020446MarineNELIKAELNKDNATNAVTGFVNLLRVLLKLTNKIKIKREVTKGIKGIRVVEFMKFPTKTICI
Ga0211638_1057169413300020448MarineLLKLTNKIKINKAVTRGIKGIRIVEFIKFPTNVRCI
Ga0211643_1050842223300020457MarineISAVTGFVNLLSVLLKLTNKIKINKAVTRGIKGIRIVEFMKFPTKRICI
Ga0211640_1068220913300020465MarineIKAELNKDNPIIAVTGLVNLFTVLLKLTNKTKINKATIIGSNGIRIDILIEFSTN
Ga0211713_1034001413300020467MarineAELNKDNAISAVTGFVNLLIVLLKLANKTKINKAVTRGAKGIRIDVLIKFPTNKISI
Ga0208390_107320213300026081MarineAVTGFVNLLSVLLKLAHKIRINKEVTKGIKGIRVAEFMKFPTKIICI
Ga0310343_1004074253300031785SeawaterAVTGFVNLLIVLLKLTNKIKINKEVIKGIKGIRIVEFMKFPTKIICI
Ga0310343_1016005143300031785SeawaterELNKDNPTSAVTGFVNLLSVLLKLANKININKEVTKGIKGIRIIEFMKFPTKIICI
Ga0310343_1020045743300031785SeawaterSAVTGFVNLLSVLLKLTNKIKINKEVTRGNKGIRVIEFMKFPTKVKRI
Ga0310343_1033115823300031785SeawaterSAVTGFVNLLRVLLKLANKIKINKEVIKGIKGIRVVEFMKLLTKIICN
Ga0310343_1034096233300031785SeawaterFVNLLSVLLKLTNKIKINKEVTKGIKGMRVVEFMKFPTKIIYI
Ga0310343_1055735913300031785SeawaterELNKDNPTSAVTGFVNLLSVLLKLANKININKEVTKGIKGIRIIEFMKFPTKIIYI
Ga0310343_1091558313300031785SeawaterDNATNPVTGFVNLLSVLLKLTNKIKINKEVIRGIKGMRIVEFMKFPT
Ga0310343_1100128623300031785SeawaterGFVNLLSVLLKLANKIKINKEVTRGIKGIRIVEFIKFPTKIICI
Ga0310343_1121286833300031785SeawaterKDNATSAVTGFVNLLSVLLKLANKIKINKAVIRGIKGIRIAVFMKFPTKIICI
Ga0310343_1154909513300031785SeawaterTSVVTGFVNLLIVLLKFTNKIKINKAVTRGIKGIRVVEFMKFPTKIICI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.