| Basic Information | |
|---|---|
| Family ID | F060014 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTA |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.99 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 91.73 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.797 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 20.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13581 | HATPase_c_2 | 74.44 |
| PF07228 | SpoIIE | 17.29 |
| PF13191 | AAA_16 | 2.26 |
| PF03704 | BTAD | 0.75 |
| PF13466 | STAS_2 | 0.75 |
| PF08281 | Sigma70_r4_2 | 0.75 |
| PF01740 | STAS | 0.75 |
| PF06271 | RDD | 0.75 |
| PF04542 | Sigma70_r2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.75 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.75 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.75 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.75 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.75 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.25 % |
| Unclassified | root | N/A | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001449|JGI20208J14878_1034745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300004631|Ga0058899_10028082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 886 | Open in IMG/M |
| 3300005331|Ga0070670_101494840 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005339|Ga0070660_100373520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1176 | Open in IMG/M |
| 3300005365|Ga0070688_101073441 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005435|Ga0070714_100692941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 983 | Open in IMG/M |
| 3300005437|Ga0070710_10653224 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005471|Ga0070698_101337500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300005541|Ga0070733_10290334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1080 | Open in IMG/M |
| 3300005587|Ga0066654_10399235 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005944|Ga0066788_10131757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
| 3300005994|Ga0066789_10170592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 921 | Open in IMG/M |
| 3300006028|Ga0070717_10889760 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300006354|Ga0075021_11129003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
| 3300009012|Ga0066710_102094508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 832 | Open in IMG/M |
| 3300009520|Ga0116214_1213068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
| 3300010301|Ga0134070_10446513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300010326|Ga0134065_10096688 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300010359|Ga0126376_12441042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300010371|Ga0134125_11110850 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300010373|Ga0134128_11768589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
| 3300010398|Ga0126383_10656325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1125 | Open in IMG/M |
| 3300010865|Ga0126346_1093025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300010876|Ga0126361_10042843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300011411|Ga0153933_1069636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300012089|Ga0153924_1047429 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012206|Ga0137380_11777623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300012285|Ga0137370_10622901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
| 3300012356|Ga0137371_10890340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 677 | Open in IMG/M |
| 3300012361|Ga0137360_10829986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 796 | Open in IMG/M |
| 3300012917|Ga0137395_10290822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1155 | Open in IMG/M |
| 3300012985|Ga0164308_10512442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1006 | Open in IMG/M |
| 3300013105|Ga0157369_11224383 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300014150|Ga0134081_10156523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 751 | Open in IMG/M |
| 3300014157|Ga0134078_10319370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300014166|Ga0134079_10645943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300014501|Ga0182024_12967206 | Not Available | 501 | Open in IMG/M |
| 3300015371|Ga0132258_10591399 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300016357|Ga0182032_10961294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 728 | Open in IMG/M |
| 3300017926|Ga0187807_1082887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1003 | Open in IMG/M |
| 3300017961|Ga0187778_11254821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300017975|Ga0187782_10623883 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300017995|Ga0187816_10340436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
| 3300018009|Ga0187884_10475842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300018013|Ga0187873_1344679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
| 3300018044|Ga0187890_10817993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300018062|Ga0187784_10552042 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300020070|Ga0206356_10232747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300020081|Ga0206354_10420269 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300020081|Ga0206354_10962912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1391 | Open in IMG/M |
| 3300020579|Ga0210407_11094866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 604 | Open in IMG/M |
| 3300020579|Ga0210407_11324565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300020580|Ga0210403_11246754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300020581|Ga0210399_10748873 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300020583|Ga0210401_10846299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
| 3300021170|Ga0210400_10442085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1073 | Open in IMG/M |
| 3300021180|Ga0210396_10965087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
| 3300021361|Ga0213872_10339603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300021388|Ga0213875_10418480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
| 3300021420|Ga0210394_10776857 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300021420|Ga0210394_11146467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
| 3300021474|Ga0210390_10020340 | All Organisms → cellular organisms → Bacteria | 5397 | Open in IMG/M |
| 3300021477|Ga0210398_10926231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
| 3300022531|Ga0242660_1099267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 710 | Open in IMG/M |
| 3300022531|Ga0242660_1213581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300022533|Ga0242662_10093691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300024232|Ga0247664_1074603 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300025633|Ga0208480_1002622 | All Organisms → cellular organisms → Bacteria | 6321 | Open in IMG/M |
| 3300025898|Ga0207692_10533295 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300025905|Ga0207685_10233857 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300025918|Ga0207662_10030542 | All Organisms → cellular organisms → Bacteria | 3127 | Open in IMG/M |
| 3300025928|Ga0207700_10994324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300025937|Ga0207669_10163161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1577 | Open in IMG/M |
| 3300025949|Ga0207667_10990831 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300026067|Ga0207678_10033684 | All Organisms → cellular organisms → Bacteria | 4462 | Open in IMG/M |
| 3300026291|Ga0209890_10237878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 571 | Open in IMG/M |
| 3300026322|Ga0209687_1100887 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300026356|Ga0257150_1006996 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300026467|Ga0257154_1050692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 643 | Open in IMG/M |
| 3300026496|Ga0257157_1084654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300026550|Ga0209474_10650367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300027050|Ga0209325_1024472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300027076|Ga0208860_1001130 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300027505|Ga0209218_1034928 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300027641|Ga0208827_1092121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 917 | Open in IMG/M |
| 3300027787|Ga0209074_10191750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 762 | Open in IMG/M |
| 3300027855|Ga0209693_10441612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
| 3300027862|Ga0209701_10718323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300027911|Ga0209698_10302382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1266 | Open in IMG/M |
| 3300028072|Ga0247675_1047775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
| 3300028780|Ga0302225_10449341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
| 3300028781|Ga0302223_10271023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300028789|Ga0302232_10018510 | All Organisms → cellular organisms → Bacteria | 3982 | Open in IMG/M |
| 3300028789|Ga0302232_10577717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300028806|Ga0302221_10551295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300028877|Ga0302235_10227611 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300028879|Ga0302229_10154908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1060 | Open in IMG/M |
| 3300029882|Ga0311368_10756218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300030056|Ga0302181_10088731 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300030056|Ga0302181_10453229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
| 3300030494|Ga0310037_10197867 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300030524|Ga0311357_11365096 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300030677|Ga0302317_10444963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
| 3300030738|Ga0265462_12187147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300030862|Ga0265753_1068268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300031040|Ga0265754_1038805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300031233|Ga0302307_10349393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 754 | Open in IMG/M |
| 3300031234|Ga0302325_10111369 | All Organisms → cellular organisms → Bacteria | 5075 | Open in IMG/M |
| 3300031234|Ga0302325_10469599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1918 | Open in IMG/M |
| 3300031525|Ga0302326_10059759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7168 | Open in IMG/M |
| 3300031525|Ga0302326_12021917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 743 | Open in IMG/M |
| 3300031680|Ga0318574_10291565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 948 | Open in IMG/M |
| 3300031680|Ga0318574_10361076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus | 847 | Open in IMG/M |
| 3300031682|Ga0318560_10318091 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031715|Ga0307476_11074403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 591 | Open in IMG/M |
| 3300031718|Ga0307474_11612056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300031724|Ga0318500_10156315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1075 | Open in IMG/M |
| 3300031748|Ga0318492_10061473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1779 | Open in IMG/M |
| 3300031768|Ga0318509_10697616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300031782|Ga0318552_10162834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
| 3300031823|Ga0307478_11516556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300031910|Ga0306923_12215489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
| 3300031942|Ga0310916_11316388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
| 3300032008|Ga0318562_10874646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300032054|Ga0318570_10407296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300032055|Ga0318575_10029142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2400 | Open in IMG/M |
| 3300032515|Ga0348332_14776040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
| 3300032895|Ga0335074_10022872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8812 | Open in IMG/M |
| 3300032895|Ga0335074_10159147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2839 | Open in IMG/M |
| 3300032895|Ga0335074_11343540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
| 3300032896|Ga0335075_11229970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300032955|Ga0335076_10810210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300032955|Ga0335076_11035608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.50% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001449 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20208J14878_10347452 | 3300001449 | Arctic Peat Soil | MKKNCEAAVHAVGGAAVIELAGEVDGGAAGVLNAA |
| Ga0058899_100280823 | 3300004631 | Forest Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQTAVGTHADLGT |
| Ga0070670_1014948401 | 3300005331 | Switchgrass Rhizosphere | MTSACEATTRTLSGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDT |
| Ga0070660_1003735201 | 3300005339 | Corn Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTAS |
| Ga0070688_1010734411 | 3300005365 | Switchgrass Rhizosphere | MTSACEATTRTLSGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHD |
| Ga0070714_1006929413 | 3300005435 | Agricultural Soil | MASMCEATTRVLPGAAVIELSGEVDGSAATVLTDAYAQAVTPD |
| Ga0070710_106532243 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSACEATTRTLPGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHD |
| Ga0070698_1013375002 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQTAV |
| Ga0070733_102903341 | 3300005541 | Surface Soil | MTSACEATTRVLPGTAVIELSGEVDGSAATVLTDAYARAVTPDSDPGTVVLD |
| Ga0066654_103992353 | 3300005587 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTAGPEAQDTVVLDFAAV |
| Ga0066788_101317572 | 3300005944 | Soil | MTSMCEATTRVLPGAAVIELAGEVDGSAADVLNAAYERVVTASADSADLDTVVLDFAA |
| Ga0066789_101705921 | 3300005994 | Soil | MKKACEASVRALPGAAVIELTGEVDGGAAGVLTAAYERA |
| Ga0070717_108897601 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAPVLTDAY |
| Ga0075021_111290031 | 3300006354 | Watersheds | MTSACEATTRALPGAAVIELSGEVDGSAAAILTEAYERAVTTGPENHDT |
| Ga0066710_1020945083 | 3300009012 | Grasslands Soil | MTSACEATTRALPGAAIIELSGEVDGAAATVLTDAYERAITASADAQDTVVLDFAAVDYI |
| Ga0116214_12130683 | 3300009520 | Peatlands Soil | MCEATTRALPGAAVIELSGEVDGSAATVLTEAYAQAVTPDSD |
| Ga0134070_104465132 | 3300010301 | Grasslands Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYERAVTAG |
| Ga0134065_100966881 | 3300010326 | Grasslands Soil | MTSACEATTRALPGAAVIELSGEVDGSAATVMTDAYERAVTAGPESHDTVVLDSSM |
| Ga0126376_124410421 | 3300010359 | Tropical Forest Soil | VLPGAAVIELSGEVDGSAATVLTEAYERAVEASPENHDTV |
| Ga0134125_111108501 | 3300010371 | Terrestrial Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDTVVLDF |
| Ga0134128_117685893 | 3300010373 | Terrestrial Soil | MTTACEATTRTLPGAAVIELSGEVDGSAAAVLTDAYERAVTASPEN |
| Ga0126383_106563251 | 3300010398 | Tropical Forest Soil | MTSACEATTRVLPGAAVIELSGEVDGSAATVLTEAYERAVETSPENHDTV |
| Ga0126346_10930253 | 3300010865 | Boreal Forest Soil | MTSACEATTRVLPGTAVIELSGEVDGSAATVLTTAYERAVTEG |
| Ga0126361_100428432 | 3300010876 | Boreal Forest Soil | MCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQTAVGTHADLS |
| Ga0153933_10696361 | 3300011411 | Attine Ant Fungus Gardens | MCEATTRVLPGAAVIELSGEVDGSAADVLTDAYVSAVGTSA |
| Ga0153924_10474291 | 3300012089 | Attine Ant Fungus Gardens | MASTCEATTRIVPGAAVIELSGDIDGSAAAILTAAYAEAVNGDSPEALGTVVLDFAAVDY |
| Ga0137380_117776232 | 3300012206 | Vadose Zone Soil | MTSACEATTRALPGAAVIELSGEVDGSAAKVLTDAY |
| Ga0137370_106229011 | 3300012285 | Vadose Zone Soil | MTSACEATTRALPGAAVIELSGEVDGSAAVVLTDAYERAVTAGP |
| Ga0137371_108903403 | 3300012356 | Vadose Zone Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERA |
| Ga0137360_108299863 | 3300012361 | Vadose Zone Soil | MCEATTRVLPGAAVIELSGEVDGSAAAVLTDAYERAVSAGGDGAGSDLGTVVLDFAVVNYTNST |
| Ga0137395_102908221 | 3300012917 | Vadose Zone Soil | MCEATTRVLPGAAVIELSGEVDGSAAKVLTDAYERGVTESPETQGT |
| Ga0164308_105124421 | 3300012985 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTASPETPAT |
| Ga0157369_112243833 | 3300013105 | Corn Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDTVV |
| Ga0134081_101565232 | 3300014150 | Grasslands Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTAGPE |
| Ga0134078_103193701 | 3300014157 | Grasslands Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTAGPETQDTVVLDFA |
| Ga0134079_106459432 | 3300014166 | Grasslands Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTACPESHDT |
| Ga0182024_129672062 | 3300014501 | Permafrost | VRAVGGAAVIELTGEVDGGAAGVLNAAYEQAVAEGEPGTVVLD |
| Ga0132258_105913994 | 3300015371 | Arabidopsis Rhizosphere | MTSACEATTRTLPGAAVIELSGEVDGSAATVLTEA |
| Ga0182032_109612943 | 3300016357 | Soil | MTSACVATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTAGPET |
| Ga0187807_10828873 | 3300017926 | Freshwater Sediment | MTSTCEAATRVLPGAAVIELSGEVDGSAATVLTAAYEQAVS |
| Ga0187778_112548211 | 3300017961 | Tropical Peatland | MTSVCEARTRVLPGAAVIELSGEVDGAAVEVLTAAYEDALGAGTDFGAVVLDFAAVDYINST |
| Ga0187782_106238831 | 3300017975 | Tropical Peatland | MASMCEATTRIVPGAAVIELSGDVDGSAAAILTSAYDRAVNGHDGPEPVGTVVLDFAAVD |
| Ga0187816_103404362 | 3300017995 | Freshwater Sediment | MASMCEATTRVLPGAAVIELSGEVDGSAATVLTDAYARAVTPDSDPSTVVLDFS |
| Ga0187884_104758421 | 3300018009 | Peatland | MTSMCEATTRVLPGAAVIELAGEVDGSAAEVLTAAYKRA |
| Ga0187873_13446791 | 3300018013 | Peatland | MTSMCEATTRVLPGAAVIELAGEVDGSAAGVLTAAYERAVTASADSADL |
| Ga0187890_108179932 | 3300018044 | Peatland | MTSMCEATTRVVPGAAVIELSGEVDGSAADVLTDAYATAVGTNADLGTVVLDFA |
| Ga0187784_105520421 | 3300018062 | Tropical Peatland | MASTCEATTRIVPGAAVIELSGEVDGSAAVVLTKAYESAVSGHDGPDNVGTVVLDFAA |
| Ga0206356_102327472 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSKCETHIRQLPNCAVIELRGEVDGSAATVLSAAY |
| Ga0206354_104202693 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSKCETHIRQLPNCAVIELSGEVDGSAATVLSAAY |
| Ga0206354_109629121 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTA |
| Ga0210407_110948661 | 3300020579 | Soil | MTSACEATTRTLPGAAVIALSGEVDGSAAAVLTAAYERAIKDEPEMSTAVSTV |
| Ga0210407_113245652 | 3300020579 | Soil | MTSRCDATTRTMPGAAVIELTGEVDGTAADVLTAAYQAA |
| Ga0210403_112467542 | 3300020580 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYER |
| Ga0210399_107488733 | 3300020581 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAILTEAYERAVTTGPE |
| Ga0210401_108462991 | 3300020583 | Soil | MKKSCEAAVHAVGGTAVIELTGEVDGGAAGVLNAAYEQAVGSGDPGTVVL |
| Ga0210400_104420851 | 3300021170 | Soil | MTSTCEATTRTLPGAAVIALSGEVDGSAAAVLTAAYERAIKDEPEMSTAVNTV |
| Ga0210396_109650871 | 3300021180 | Soil | MKKSCEAAVHAVGGTAVIELTGEVDGGAAGVLNAAYEQAVGSGEPGTVVLDF |
| Ga0213872_103396032 | 3300021361 | Rhizosphere | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYLAAVGTH |
| Ga0213875_104184802 | 3300021388 | Plant Roots | MTSACEATTRVLPGAAVIELSGEVDGSAATVLTAAYEQAVAVGLEPPSPE |
| Ga0210394_107768571 | 3300021420 | Soil | MTSRCEATTRTMPGAAVIELTGEVDGTAADVLTAAYQAAVTGTDVGVVVL |
| Ga0210394_111464672 | 3300021420 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAATVLTDAYERAVTAGAEDQDTVVLDFA |
| Ga0210390_100203401 | 3300021474 | Soil | MASMCEATTRIVPGAAVIELSGDVDGSAAAILTAAYAEAVNADSP |
| Ga0210398_109262312 | 3300021477 | Soil | MASTCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQTAVGTHADL |
| Ga0242660_10992673 | 3300022531 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAV |
| Ga0242660_12135811 | 3300022531 | Soil | MTSACEATTRTLPGAAVIELSGEVDGSAAAVLTDAYERAVTAGADSH |
| Ga0242662_100936911 | 3300022533 | Soil | MTSACEATTRTLSGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDTV |
| Ga0247664_10746031 | 3300024232 | Soil | MTTACEATTRTLPGAAVIELSGEVDGSAAAVLTDAYER |
| Ga0208480_10026225 | 3300025633 | Arctic Peat Soil | MKEAAMKKSCEAAVHPVGGAAVIELTGEVDGGAAGVLNAAYEQA |
| Ga0207692_105332953 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYE |
| Ga0207685_102338573 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDTVVL |
| Ga0207662_100305421 | 3300025918 | Switchgrass Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAATVLTDAYERAVTASPENH |
| Ga0207700_109943243 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MASMCEAKTRVVPGAAVIELSGEVDGSAADVLTDAYAAAVDHDA |
| Ga0207669_101631613 | 3300025937 | Miscanthus Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYE |
| Ga0207667_109908313 | 3300025949 | Corn Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYERAVTA |
| Ga0207678_100336841 | 3300026067 | Corn Rhizosphere | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDTVVLDFA |
| Ga0209890_102378781 | 3300026291 | Soil | MKKACEASVRALPGAAVIELTGEVDGGAAGVLTAAYERAIA |
| Ga0209687_11008872 | 3300026322 | Soil | VQSKCETSIRSLPGCAVIELRGEVDGSAAATLSAAYDGAA |
| Ga0257150_10069963 | 3300026356 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQA |
| Ga0257154_10506921 | 3300026467 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQAAVGTHA |
| Ga0257157_10846541 | 3300026496 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQSAVG |
| Ga0209474_106503672 | 3300026550 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAY |
| Ga0209325_10244723 | 3300027050 | Forest Soil | MTSACEATTRTLPGAAVIELSGEVDGSAAAVLTDAYERA |
| Ga0208860_10011303 | 3300027076 | Forest Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAY |
| Ga0209218_10349281 | 3300027505 | Forest Soil | MTSRCEATTRTMPGAAVIELTGEVDGTAADVLTAAYQAAVTGTDVGIVVLD |
| Ga0208827_10921211 | 3300027641 | Peatlands Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQAVAQ |
| Ga0209074_101917503 | 3300027787 | Agricultural Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTDAYERAVTAGPDSHDTVVLD |
| Ga0209693_104416122 | 3300027855 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTDAYRSAVGTNADLGTVV |
| Ga0209701_107183232 | 3300027862 | Vadose Zone Soil | MTSTCEAATRVLPGAAVIELSGEVDGSAAAVLIGAYERA |
| Ga0209698_103023821 | 3300027911 | Watersheds | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQTAVGTDADL |
| Ga0247675_10477752 | 3300028072 | Soil | MTTACEATTRTLPGAAVIELSGEVDGSAAAVLTDAYERAVTASPENHDTVVL |
| Ga0302225_104493412 | 3300028780 | Palsa | MTSMCEATTRVLPGAAIIELAGEVDGSAAEVLTDAYKRAVSASAESGDLGTVVLD |
| Ga0302223_102710231 | 3300028781 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAEVLTGAYKRAVAASADSADIGTVVLD |
| Ga0302232_100185104 | 3300028789 | Palsa | MTSMCEATTRVLPGAAIIELAGEVDGSAAEVLTDAY |
| Ga0302232_105777172 | 3300028789 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAAVLTAAYERAVTASADSADLGTVVLDFA |
| Ga0302221_105512951 | 3300028806 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAEVLTAAYKRAV |
| Ga0302235_102276111 | 3300028877 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAAVLTDAYERAVTASADSA |
| Ga0302229_101549081 | 3300028879 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAAVLTDAYERAVTASADSADLGTIVLDFAAVDYI |
| Ga0311368_107562182 | 3300029882 | Palsa | MTSMCEATTRALPGAAVIELAGEVDGSAAAVLTAAYERAVTAR |
| Ga0302181_100887311 | 3300030056 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAEVLTGAYKRAVAASADSADIGTVVL |
| Ga0302181_104532291 | 3300030056 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAAVLTAAYERAVTASADSADL |
| Ga0310037_101978671 | 3300030494 | Peatlands Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQTAVGTDADLGT |
| Ga0311357_113650962 | 3300030524 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAEVLTAAYKRAVAASADSADLGTVVLDFAAVD |
| Ga0302317_104449632 | 3300030677 | Palsa | MTSMCEATTRALPGAAVIELRGEVDGSAAAVLNAAYERAVEAGHAADSDP |
| Ga0265462_121871472 | 3300030738 | Soil | MCEATTRALPGAAVIELAGEVDGSAATVLTAAYKIK |
| Ga0265753_10682682 | 3300030862 | Soil | MASMCEATTRVLPGAAIIELSGEVDGAAADVLTNAYQSAVGTHA |
| Ga0265754_10388052 | 3300031040 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQ |
| Ga0302307_103493933 | 3300031233 | Palsa | MTSMCEATTRVLPGAAIIELAGEVDGSAAEVLTDAYKRAVTASA |
| Ga0302325_101113694 | 3300031234 | Palsa | MKRACEASVRALPGAAVIELTGEVDGGAAGVLTAAYERAIADGEP |
| Ga0302325_104695993 | 3300031234 | Palsa | MASTCEATTRAVPGAAVIELSGEVDGSAADVLTDAYAQAVGGDAALGTVV |
| Ga0302326_100597591 | 3300031525 | Palsa | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTDAYRNA |
| Ga0302326_120219173 | 3300031525 | Palsa | MTSMCEATTRVLPGAAVIELAGEVDGSAAAVLTAAYE |
| Ga0318574_102915651 | 3300031680 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYERAVAASPEDHDTV |
| Ga0318574_103610763 | 3300031680 | Soil | MASMCEAMTRVLPGAAVIELSGEVDGSAAAVLTDAYQR |
| Ga0318560_103180911 | 3300031682 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTNAYQSAVGTHADLG |
| Ga0307476_110744032 | 3300031715 | Hardwood Forest Soil | MKKSCEAAVHAVGGTAVIELTGEVDGGAAGVLNAAYEQAVGSGEPGTVV |
| Ga0307474_116120561 | 3300031718 | Hardwood Forest Soil | MKKTCEAAVHAVGGAAVIELAGEVDGGAAGVFNAAYEQA |
| Ga0318500_101563151 | 3300031724 | Soil | MASMCEATTRVLPGAAIIELSGEVDGSAADVLTRAYQSAVGAQADLG |
| Ga0318492_100614731 | 3300031748 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYERAVAASP |
| Ga0318509_106976161 | 3300031768 | Soil | MASMCEATTRVLPGAAIIELSGEVDGSAATVLTDAYAQAV |
| Ga0318552_101628343 | 3300031782 | Soil | MMSTCEATTRSLPGAAVIELSGEVDGTAAAVLTEAYERAVTASP |
| Ga0307478_115165561 | 3300031823 | Hardwood Forest Soil | MKKSCEAAVHAVGGAAVIELTGEVDGGAAGVLNAAY |
| Ga0306923_122154892 | 3300031910 | Soil | MASMCEAMTRVLPGAAVIELSGEVDGSAAAVLTDAYQRAVTPETDPGTVVLDFAA |
| Ga0310916_113163881 | 3300031942 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAAAVLTEAYERAVAA |
| Ga0318562_108746462 | 3300032008 | Soil | MASMCKATTRALPGAAVIELSGEVDGSAAAVLTDAYQRAVTLGDPGTVVLDF |
| Ga0318570_104072961 | 3300032054 | Soil | MTSACEATTRALPGAAVIELSGEVDGSAATVLTEAYERA |
| Ga0318575_100291421 | 3300032055 | Soil | MASMCEATTRVLPGAAIIELSGEVDGSAATVLTDAYAQAVTPDT |
| Ga0348332_147760402 | 3300032515 | Plant Litter | MTSTCEAATRVLPGAAVIELSGEVDGSAATVLTAAYEQAVGAG |
| Ga0335074_100228729 | 3300032895 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAATVLTDAYAQAVTPDSDPSTV |
| Ga0335074_101591471 | 3300032895 | Soil | MASMCEATTRVLPGAAVIELSGEVDGSAADVLTGAYQSAVGTSADLGTVVLDFA |
| Ga0335074_113435401 | 3300032895 | Soil | MTSRCDATTRTMPGAAVIELSGEVDGTAADVLTAAYQAAVTG |
| Ga0335075_112299702 | 3300032896 | Soil | MPSVCEATTRVLPGAAVIELTGEVDGSAATVLTSAYLTAVG |
| Ga0335076_108102101 | 3300032955 | Soil | MKKTCEAVVHTVADAAVIELTGEVDGAAAGVLTAAYEDAV |
| Ga0335076_110356083 | 3300032955 | Soil | MTSTCEAATRVLPGAAVIELSGEVDGSAVTVLTAAYEQAVGAAPDL |
| ⦗Top⦘ |