NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059993

Metagenome / Metatranscriptome Family F059993

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059993
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 141 residues
Representative Sequence LWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Number of Associated Samples 111
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 21.37 %
% of genes near scaffold ends (potentially truncated) 34.59 %
% of genes from short scaffolds (< 2000 bps) 98.50 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (80.451 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(33.083 % of family members)
Environment Ontology (ENVO) Unclassified
(79.699 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(58.647 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 33.14%    Coil/Unstructured: 66.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF05018CFA20_dom 2.26



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.45 %
UnclassifiedrootN/A19.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003909|JGI26087J52781_1036006Not Available527Open in IMG/M
3300004507|Ga0008280_1011286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae655Open in IMG/M
3300005941|Ga0070743_10148420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae779Open in IMG/M
3300007665|Ga0102908_1030643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1025Open in IMG/M
3300008935|Ga0103738_1060583All Organisms → cellular organisms → Eukaryota528Open in IMG/M
3300008958|Ga0104259_1039043All Organisms → cellular organisms → Eukaryota509Open in IMG/M
3300008993|Ga0104258_1062859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae693Open in IMG/M
3300008993|Ga0104258_1068388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae663Open in IMG/M
3300009055|Ga0102905_1079491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae667Open in IMG/M
3300009071|Ga0115566_10414887Not Available774Open in IMG/M
3300009172|Ga0114995_10213826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1069Open in IMG/M
3300009172|Ga0114995_10298085All Organisms → cellular organisms → Eukaryota888Open in IMG/M
3300009422|Ga0114998_10639067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae502Open in IMG/M
3300009432|Ga0115005_10481848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae988Open in IMG/M
3300009436|Ga0115008_10356649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1037Open in IMG/M
3300009440|Ga0115561_1198681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae764Open in IMG/M
3300009445|Ga0115553_1145133Not Available977Open in IMG/M
3300009472|Ga0115554_1439746Not Available508Open in IMG/M
3300009505|Ga0115564_10255978All Organisms → cellular organisms → Eukaryota → Sar890Open in IMG/M
3300009507|Ga0115572_10250361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1013Open in IMG/M
3300009526|Ga0115004_10871436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae537Open in IMG/M
3300009543|Ga0115099_10844723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae826Open in IMG/M
3300009592|Ga0115101_1575032All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Olpidiomycota → Olpidiomycotina → Olpidiomycetes → Olpidiales → Olpidiaceae → Olpidium → Olpidium bornovanus871Open in IMG/M
3300009606|Ga0115102_10228342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae827Open in IMG/M
3300012414|Ga0138264_1307447Not Available563Open in IMG/M
3300012414|Ga0138264_1572914All Organisms → cellular organisms → Eukaryota → Sar587Open in IMG/M
3300012767|Ga0138267_1013079Not Available712Open in IMG/M
3300012767|Ga0138267_1075833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae607Open in IMG/M
3300012782|Ga0138268_1466977Not Available756Open in IMG/M
3300012954|Ga0163111_11952803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae590Open in IMG/M
3300012969|Ga0129332_1154119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae798Open in IMG/M
3300016729|Ga0182056_1021219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae757Open in IMG/M
3300016740|Ga0182096_1080440Not Available801Open in IMG/M
3300016740|Ga0182096_1399935All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota619Open in IMG/M
3300016751|Ga0182062_1471700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae615Open in IMG/M
3300017957|Ga0181571_10322425Not Available970Open in IMG/M
3300018567|Ga0188858_109635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae541Open in IMG/M
3300018980|Ga0192961_10099621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae879Open in IMG/M
3300018980|Ga0192961_10108835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae841Open in IMG/M
3300018982|Ga0192947_10256111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae560Open in IMG/M
3300018989|Ga0193030_10175345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae701Open in IMG/M
3300019021|Ga0192982_10183157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae743Open in IMG/M
3300019022|Ga0192951_10300623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae606Open in IMG/M
3300019095|Ga0188866_1018666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae725Open in IMG/M
3300019103|Ga0192946_1056538Not Available576Open in IMG/M
3300019200|Ga0180036_1038465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae811Open in IMG/M
3300019261|Ga0182097_1302728Not Available773Open in IMG/M
3300021303|Ga0210308_1054301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae664Open in IMG/M
3300021336|Ga0210307_1057494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae720Open in IMG/M
3300021342|Ga0206691_1395816Not Available732Open in IMG/M
3300021345|Ga0206688_10958614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae626Open in IMG/M
3300021350|Ga0206692_1765345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae528Open in IMG/M
3300021355|Ga0206690_10834593Not Available691Open in IMG/M
3300021378|Ga0213861_10263893Not Available902Open in IMG/M
3300021378|Ga0213861_10524570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae557Open in IMG/M
3300021389|Ga0213868_10545621Not Available616Open in IMG/M
3300021872|Ga0063132_104861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae759Open in IMG/M
3300021874|Ga0063147_108790All Organisms → cellular organisms → Eukaryota538Open in IMG/M
3300021875|Ga0063146_119484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae556Open in IMG/M
3300021950|Ga0063101_1124311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae509Open in IMG/M
3300024343|Ga0244777_10327571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae963Open in IMG/M
3300025690|Ga0209505_1070565Not Available1062Open in IMG/M
3300025701|Ga0209771_1100282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae961Open in IMG/M
3300025869|Ga0209308_10150283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae1071Open in IMG/M
3300025879|Ga0209555_10164616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae914Open in IMG/M
3300025890|Ga0209631_10274481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae828Open in IMG/M
3300025894|Ga0209335_10282333Not Available714Open in IMG/M
3300025897|Ga0209425_10534744All Organisms → cellular organisms → Eukaryota532Open in IMG/M
3300027249|Ga0208175_1026007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae619Open in IMG/M
3300027687|Ga0209710_1166703Not Available783Open in IMG/M
3300027752|Ga0209192_10368320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae502Open in IMG/M
3300027780|Ga0209502_10260720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae765Open in IMG/M
3300027791|Ga0209830_10218814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae879Open in IMG/M
3300027849|Ga0209712_10601207All Organisms → cellular organisms → Eukaryota611Open in IMG/M
3300028575|Ga0304731_10836690Not Available530Open in IMG/M
3300028671|Ga0257132_1106474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae598Open in IMG/M
3300030670|Ga0307401_10361562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae659Open in IMG/M
3300030709|Ga0307400_10617577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae678Open in IMG/M
3300031540|Ga0308143_119032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae688Open in IMG/M
3300031579|Ga0308134_1110223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae630Open in IMG/M
3300031602|Ga0307993_1085380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae795Open in IMG/M
3300031729|Ga0307391_10616445Not Available615Open in IMG/M
3300031734|Ga0307397_10443113Not Available602Open in IMG/M
3300031738|Ga0307384_10518434All Organisms → cellular organisms → Eukaryota565Open in IMG/M
3300031739|Ga0307383_10345418Not Available725Open in IMG/M
3300031739|Ga0307383_10626050All Organisms → cellular organisms → Eukaryota544Open in IMG/M
3300032463|Ga0314684_10505694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae709Open in IMG/M
3300032463|Ga0314684_10548021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae676Open in IMG/M
3300032470|Ga0314670_10261857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae890Open in IMG/M
3300032470|Ga0314670_10399971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae720Open in IMG/M
3300032481|Ga0314668_10302388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae827Open in IMG/M
3300032481|Ga0314668_10387862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae721Open in IMG/M
3300032491|Ga0314675_10298779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae804Open in IMG/M
3300032492|Ga0314679_10515633All Organisms → cellular organisms → Eukaryota534Open in IMG/M
3300032517|Ga0314688_10282732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae879Open in IMG/M
3300032518|Ga0314689_10394589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae727Open in IMG/M
3300032518|Ga0314689_10471913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae657Open in IMG/M
3300032518|Ga0314689_10529161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae614Open in IMG/M
3300032519|Ga0314676_10335866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae892Open in IMG/M
3300032519|Ga0314676_10503288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae720Open in IMG/M
3300032522|Ga0314677_10238376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae943Open in IMG/M
3300032540|Ga0314682_10436284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae722Open in IMG/M
3300032615|Ga0314674_10355357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae763Open in IMG/M
3300032616|Ga0314671_10374628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae777Open in IMG/M
3300032651|Ga0314685_10735634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae529Open in IMG/M
3300032666|Ga0314678_10413873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae609Open in IMG/M
3300032707|Ga0314687_10380211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae780Open in IMG/M
3300032707|Ga0314687_10608846Not Available608Open in IMG/M
3300032714|Ga0314686_10356730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae728Open in IMG/M
3300032723|Ga0314703_10158904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae932Open in IMG/M
3300032723|Ga0314703_10249679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae736Open in IMG/M
3300032724|Ga0314695_1371108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae544Open in IMG/M
3300032726|Ga0314698_10266550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae781Open in IMG/M
3300032726|Ga0314698_10539049All Organisms → cellular organisms → Eukaryota519Open in IMG/M
3300032732|Ga0314711_10253654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae904Open in IMG/M
3300032732|Ga0314711_10356597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae758Open in IMG/M
3300032733|Ga0314714_10599403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae609Open in IMG/M
3300032733|Ga0314714_10746564All Organisms → cellular organisms → Eukaryota → Sar532Open in IMG/M
3300032734|Ga0314706_10439607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae630Open in IMG/M
3300032742|Ga0314710_10256591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae721Open in IMG/M
3300032743|Ga0314707_10237659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae936Open in IMG/M
3300032745|Ga0314704_10581191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae612Open in IMG/M
3300032746|Ga0314701_10360834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae659Open in IMG/M
3300032746|Ga0314701_10375949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae644Open in IMG/M
3300032747|Ga0314712_10262729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae822Open in IMG/M
3300032750|Ga0314708_10311635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae773Open in IMG/M
3300032751|Ga0314694_10260529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae740Open in IMG/M
3300032752|Ga0314700_10673428All Organisms → cellular organisms → Eukaryota546Open in IMG/M
3300032752|Ga0314700_10758170Not Available508Open in IMG/M
3300032754|Ga0314692_10366760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae780Open in IMG/M
3300033572|Ga0307390_10697494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae637Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater33.08%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.05%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.27%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.02%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.26%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.51%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.76%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.01%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.26%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.26%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.50%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.75%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.75%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.75%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027249Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26087J52781_103600613300003909MarineDSSDSAVSMDLHSEGLYVVGTIGPSGEIRQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLLWVERGVDVVGGDISSHDLEY
Ga0008280_101128613300004507MarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLLWVERGVDVVGGDISSHDLEY*
Ga0070743_1014842013300005941EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVGGDISSHDLEY*
Ga0075493_157121213300006396AqueousSLSLGLAGNGQEELEFGRKLVFGVQSVREIDSPDSAVSVDLDSEGLYVVGTIGSSGEIRQVELNLIPSLVKSHRHCADEWLDSGGALVVGGSESSSHTLVIEHLDLESEVLFEVLDDHDQERQLDSKRLLGVERSVDVVGGHVGSHDLQHGRLDIGVGDSLDVAVSDLFVPNL
Ga0102908_103064313300007665EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVSGDISSHDLEY*
Ga0103738_106058313300008935Ice Edge, Mcmurdo Sound, AntarcticaFWRKLVFGIESVGEINSSDSAVSMNLNSESLYVVGTIGSSGEITEIELNLVPALIKSHWHSTDKWLDSGCGLIVRCSESTSNALVIKDLYLEGEVFLEVLDNHDQERKLDSQCLLWVKRSIDIVG*
Ga0104259_103904313300008958Ocean WaterLVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIGQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDGKCLLWVKRSVDVVG*
Ga0104258_106285923300008993Ocean WaterLRFTSNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSEGLYVVGTVSSPCEIGQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDGKCLLWVKRSVDVVG*
Ga0104258_106838813300008993Ocean WaterRLTSDWQEKFELWWKLILSVKSIREVNSSNSAVSVDLNSESFYIVGTVSSSCEIGQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALIIQNLNFESEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNR*
Ga0102905_107949113300009055EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGFYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALVIEDLHLKGEVLLQVLDDHDQERKLDGKCLLWVERGVDVVSGDISSHDLEY*
Ga0115566_1041488723300009071Pelagic MarineEPVGEVDSSDSAVRMDLHPQRLYVVGTISSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG*
Ga0114995_1021382613300009172MarineLWLTSNWQEELEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDSKCLLWVKRSVDVVG*
Ga0114995_1029808523300009172MarineLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVFLKVLDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG*
Ga0114998_1063906723300009422MarineLALRFTGNWQEKVGFWGKLVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESE
Ga0115005_1048184823300009432MarineLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN*
Ga0115008_1035664923300009436MarineLALRFTGNWQEKFEFWGKLVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG*
Ga0115561_119868113300009440Pelagic MarineLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQVELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN*
Ga0115553_114513323300009445Pelagic MarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMDLHSEGLYVVCTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGSGLIVGGSESTSNALIIEDLHLEGEVLLQVLDDHDQERKLDGKGLLWVQWRVDVVGGDISSHDLEY*
Ga0115554_143974613300009472Pelagic MarineDSSDSAVSMDLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGSGLIVGGSESTSNALIIEDLHLEGEVLLQVLDDHDQERKLDGKGLLWVQWGVDVVGGDISSHDLEY
Ga0115564_1025597813300009505Pelagic MarineMMDSLSLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSLIKSHRHGANKWLDSGSGLIVGGSESSSNTLIIQNLDLEGEVFLQVLNDHDQERKLNS*
Ga0115572_1025036113300009507Pelagic MarineLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG*
Ga0115004_1087143613300009526MarineLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQGRQLDGKC
Ga0115099_1084472313300009543MarineLWLTSDWQEKFELWWKLILSVKSIREVNSSNSAVSVDLNSESFYIVGTVSSSCEIGQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALIIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNR*
Ga0115101_157503213300009592MarineLTLWLTSDWQEKFELWWKLILSVKSIREVNSSNSAVSVDLNSESFYIVGTVSSSCEIGQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALVIQNLNFECEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNR*
Ga0115102_1022834213300009606MarineLTLWLTSDWQEKFELWWKLILSVKSIREVNSSNSAVSVDLNSESFYIVGTVSSSCEIGQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALIIQNLNFESEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNR*
Ga0138264_130744713300012414Polar MarineLWRKLILGVKSIGEIDSSNSAVSMDLNSKSLYVVGTIGSSGEIGQVELNLVPALIKSHRHSTDKWLDSGCGLIVRCSESTSNALVIKDLNLEGEVFLQILDDHDQERKLDSQCLLWVKRSIDVVG*
Ga0138264_157291413300012414Polar MarineLWFTSNWQEKLELWWELIFSIESVGEIDSSASAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSFIKSHRHGANKWLDSGSGLIVGGSESSSDTLIIQNLDLEGEVFLQVLNDHDQERKLDS*
Ga0138267_101307913300012767Polar MarineVGVRIGIESVGEINSSDSAVSMNLNSESLYIVGTVGSSCEITEIELNLVPALIKSHRHSTDEWLDSGCGLIVRCSESTSNALVIKDLNLEGKVFLQILDDHDQERKLDSQCLLWVKRSIDVVG*
Ga0138267_107583313300012767Polar MarineLWFTSNWQEKLELWWKLIFSIESIGEIDSSDSAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSFIKSHRHGANKWLDSGSGLIVGGSESSSDTLIIQNLDLKGEVFLQVLNDHDQERKLDS*
Ga0138268_146697723300012782Polar MarineLALRFSCNRQEKLEFWWEFVFGIESVGEINSSDSAVSMNLNSESLYIVGTVGSSCEITEIELNLVPALIKSHRHSTDEWLDSGCGLIVRCSESTSNALVIKDLNLEGEVFLQILDDHDQERKLDSQCLLWVKRSIDVVG*
Ga0163111_1195280313300012954Surface SeawaterMFIFTISNHTDNLAYKGLVFKPPAYSKCDLLVLSVSLSLRLASDGQEEFELWGKLIFGVKSIREVNSSDSAVGVDLHSEGLNVVGTVSSPGEIRQVKLNLVPALIKSHGHGANEGLDSGGGLIVGGSESTSNGLVIQDLHLEGEVLLQVLDDHDQERKLD
Ga0129332_115411913300012969AqueousLWFTGDWQEKLELWWELIFSVKSVGEIDSSDSAVSMDLNSKGLYVVSTISSSGEIRQVELNLIPSLIKSHGHCANEWLDSCCRLIVGGSESSSDTLIIQNLNLESEVLLQVLNDHDQERKLNGQGFLWVKRSIDIVGGYVGSHDFEN*
Ga0182056_102121913300016729Salt MarshLWLTGNWQEKLELWWELVFGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGKIGQVELNLIPALIKSHGHCANEWLDSGCRLIVGGSESTSNALIIEYLHLEGEVLLQVLDDHDQERKLNGKGLLWIERGVDVVGGDISSHDLEY
Ga0182096_108044023300016740Salt MarshLWLTGNWQEKLELWWELVFGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGKIGQVELNLIPALIKSHGHCANEWLDSGCRLIVGGSESTSNALIIEYLHFEGEVLLQVLDDHDQERKLDGKGLLWIERGVDVVGGDISSHDLEY
Ga0182096_139993513300016740Salt MarshGSLSLRFSSNGQEKLELWWKLILSVESVREIDSSNSAVCMNLNSQGLYVVGTISSSGEIRQVELNLIPAFIKSHWHGTDEWLDSCGTLIIGGSESSSHALIIEYLDLKSEVLFQVLDDHDQERKLDGQGLFWIKRSVNIVCSICSPCEI
Ga0182062_147170023300016751Salt MarshLWLTGNWQEKLELWWELVFGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGKIGQVELNLIPAFIKSHGHCANEWLDSGCRLIVGGSESTSNALIIEYLHLEGEVLLQVLDDHDQERKLDGKGLLWIERGVDVVGGDISSH
Ga0181571_1032242513300017957Salt MarshLWLTGNWQEKLELWWELVFGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGKIGQVELNLIPALIKSHGHCANEWLDSGCRLIVGGSESTSNALIIEYLHLEGEVLLQVLDDHDQERKLDGKGLLWIERGVDVVGGDISSHDLEY
Ga0188858_10963513300018567Freshwater LakeLLNHSLSLWFTSNWQEKFELWWELIFSVESVGEIDSSNSAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSLIKSHRHGANKWLDSGSGLIVGGSESSSNTLIIQNLDLEGEVFLQVLN
Ga0192961_1009962113300018980MarineLTLWLTSDWQEKFELWWKLILGVKSIREVNSSNSAVGVDLNSESFYIVGTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNRRLNIWISDSLDVTVSDLLIPNLERLGSDGIKNG
Ga0192961_1010883513300018980MarineLSLWLTSDWQEKFELWWKLILGVKSIREVNSSNSAVGVDLNSESFYIVGTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNRRLNIWISDSLDVTVSDLLIPNLERLGSDGIKNG
Ga0192961_1019328413300018980MarineWQEKFELWWKLILGVKSIREVNSSNSAVGVDLNSESFYIVGTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNRRLNIWISDSLDVTVSDLLIPNLERLGSDGIKNG
Ga0192947_1025611113300018982MarineLSLWLSSNWQEKLELWGELVLGIESVGEVNSSNSAVSMNLNSESLYVVGTVSSSGEIGEIELNLIPSFIQSHRHGTDEWLDSCSRLIVGSSESSSYALVIQYLNLESEVFLQVLDDHDQERKLD
Ga0193030_1017534513300018989MarineLGLTSNGQEQFEFGREFVLGVESVGEVDSSNSAVGVDLNSESLYVVGTVSSSGEIRQVELDLIPSLIESHGHGTDEGLDSGGRLIVRGSEPTSNALVIQDLNFESEVLLQVLDDHDQEGQLDGQSLFGVQRGVDVVSRHIGSHDLQHG
Ga0192982_1018315713300019021MarineLRFSCNRQEKLEFWWEFVFGIESVGEINSSDSAVSMNLNSESLYVVGTVGSSCEIREIELNLVPALIKSHRHSTDKWLDSGCGLIVRCSESTSNALVIKDLNLEGEVFLQILDDHDQERKLDSQCLLWVKRSIDVVG
Ga0192951_1030062313300019022MarineLLNHSLSLWFTSNWQEKFELWWELIFSVESVGEIDSSDSAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSLIKSHRHGANKWLDSGSGLIVGGSESSSKTLIIQNLDLEGEVFLQVLNDHDQERKLDS
Ga0188866_101866623300019095Freshwater LakeLWFTSDWQEKLELWWKLVFGIESIGEIDSSNSAVGVDLNSESLYVVGTVGSSGEIRQVELNLIPAFIKSHRHGTDERLYTSSRLIVGGSESSSNTLVIEYLNLEGEVFLQVLDDHDQERKLDSKGLLWVERSVDVVGGDIGSHNLKNR
Ga0192946_105653813300019103MarineLVFGIESVGEIDSSNSAVSMDLNSEGLYVVGTIGSSGEVTKVELNLVPSLIKSHWHGTDKWLDSGSRLIVRCSESTSDTLIIKYLNLESEVFLKVLDNHDQEWKLDSQSLLWVEWSIDVI
Ga0180036_103846523300019200EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALVIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVSGDISSHDLEY
Ga0182097_130272823300019261Salt MarshLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGKIGQVELNLIPALIKSHGHCANEWLDSGCRLIVGGSESTSNALIIEYLHLEGEVLLQVLDDHDQERKLDGKGLLWIERGVDVVGGDISSHDLEY
Ga0210308_105430113300021303EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALVIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVGGDISSHDLEY
Ga0210307_105749423300021336EstuarineIGSLSLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVGGDISSHDLEY
Ga0206691_139581613300021342SeawaterLVDWLACNWQEELEFWWKLIFSIESVREIDSSYSAVSMNLHSESLNIVGTIRSSGEIRQVELNLVPSFIKSHWHCANERLDSGSRLIVGSSESSSNLLIIENLNLESEVFLQVLNDHDQERQLNGQSLLWVKRSIDIVGGDIGSHNFKN
Ga0206688_1095861413300021345SeawaterIQSEFSLWLSLSTSLSLWLTSNWQEKLELWWELVLGVESIREVNSSNSAIGMNLNSECLNVVGTISSSGEIRQVELNLIPALIQSHGHRTDEWLHTGGRLIVGRSESSSYALIIQDLHFESEVLLQVLDDHDQEWQLNCQSFLWIKWCVNVVG
Ga0206692_176534513300021350SeawaterVTRLESGGWFCKRLSGCSHGLWLTSNWQEELELWWELVLGVKSVGEVDTTDTAVSVDLDSEGLNVVGTVGTSGEIRQVELNLIPALIESHWHGANEWLHSGGGLVVGGTEATSDVLVVQDLHFEGEVLLQVLDDHDQEWKLDGEGLLWVNWASDEVGGDV
Ga0206690_1083459313300021355SeawaterLLVSIVISRIYSLVDWFAGNWQEELEFWWKLIFSIESVGEINSSYSAISMDLHSESLNIVGTISSSGEIRQVELNLVPSFIKSHWHCANERLDSGSRLIVGSSESSSNLLVIKNLNLESEVFLQVLNDHDQERQLNGQCLLWVKRSIDIVGGDISSHDFKN
Ga0213861_1026389313300021378SeawaterMGSLSLWLTSNWQEELELWWELVLGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGSGLIVGGSESTSNALIIEDLHLEGEVLLQVLDDHDQERKLDGKGLLWVQWRVDVVGGDISSHDLEY
Ga0213861_1052457013300021378SeawaterLSIQQLRFIAWLSDLLQRSLTLWFTGDWQEKLELWWELIFSVKSVGEIDSSDSAVSMDLNSKGLYVVSTISSSGEIRQVELNLIPSLIKSHGHCANEWLDSCCRLIVGGSESSSYT
Ga0213868_1054562113300021389SeawaterQRSLTLWFTGDWQEKLELWWELIFSVKSVGEIDSSDSAVSMDLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGSGLIVGGSESTSNALIIEDLHLEGEVLLQVLDDHDQERKLDGKGLLWVQWRVDVVGGDISSHDLEY
Ga0063132_10486123300021872MarineLTLWLTSDWQEKFELWWKLILSVKSIREVNSSNSAVSVDLNSESFYVVGTVSSSCEIGQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSYALVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSVDVVGGHIGTHDLQNR
Ga0063147_10879013300021874MarineLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVFLKVLDDHDQERKLDGKSFLWVERSIDVVG
Ga0063146_11948413300021875MarineLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVFLKVLDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0063101_112431113300021950MarineKYSPEGRSNFRIIKCCFRYSKEXSSLTLRFTGNWQEKLELWGELVFGVESVGEIDSSNSAVCMDLNSKSLYVVGTISSPCEIGQVELNLIPSLIQSHRHCANEWLYSGGRLIVRGSESSSYALIIKYLYLESEVFLQVLNDHDQER
Ga0244777_1032757123300024343EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVGGDISSHDLEY
Ga0209505_107056523300025690Pelagic MarineMGSLSLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMDLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGSGLIVGGSESTSNALIIEDLHLEGEVLLQVLDDHDQERKLDGKGLLWVQWRVDVVGGDISSHDLEY
Ga0209771_110028223300025701MarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLLWVERGVDVVGGDISSHDLEY
Ga0209308_1015028323300025869Pelagic MarineLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0209555_1016461613300025879MarineVTDPLLRGLPPSYITVRIMGCSLALGLAGNGQEELELGRQLVLGVESVGEVDSPDSAVGVDLHSQGLDVVGSVGSSGEVGQVELDLVPSLVQSHGHRADEWLDSGGRLVVGGSESPPDALVVEHLDLEGEVLLQVLDDHDQEGQLDGQGLLGVEGGVDVVGGHVSSHDLKD
Ga0209631_1027448113300025890Pelagic MarineVSRRSTAYSLGSLAGDWKEKLEFWRELIFGVESVGEVNSTDPAVGVDLDSEGLNIVGTVSSSCEIGQVELDLVPAFVKSHGHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0209335_1028233313300025894Pelagic MarineLSLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMDLDSKSLYVVGTVSSSGEIRQIELNLIPSLIKSHRHRANERLDSGGGLIVRGSESSSHALVIEDLHLEGEVLLQVLDDHDQERKLDGKCLLWVEWSIDVVS
Ga0209425_1053474413300025897Pelagic MarineLGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0208175_102600713300027249EstuarineLWLTGNWQEELELWWELVLGVESIGEIDSSDSAVSMNLHSEGLYVVGTIGPSGEIGQVELNLIPALIKSHWHCANEWLDSGGGLIVGGSESTSNALIIEDLHLKGEVLLQVLDDHDQERKLDGKCLFWVERRVDVVSG
Ga0209710_116670313300027687MarineVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDSKCLLWVKRSVDVVG
Ga0209192_1036832023300027752MarineLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLN
Ga0209502_1026072023300027780MarineLRFTSNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDSKCLLWVKRSVDVVG
Ga0209830_1021881413300027791MarineLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDGKCLLWVKRSIDVVG
Ga0209712_1060120713300027849MarineQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0304731_1083669013300028575MarineGLTGNGQEQFELGRELVLGVESVGEVDSSNSAVGVDLDSQGLYVVGTVSSPGEIRQVELNLIPALIESHGHGTDEGLDSGGGLVVGGSESTSDTLVVQDLHFEGEVLLQVLDDHDQEGQLDGEGLLGVQRGVDVVSRHIGSHDLEHR
Ga0257132_110647413300028671MarineLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVRGSESSSDTLVIQNLNFEGEVFLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0307401_1036156213300030670MarineLRFTGNWQEKLEFWGELVFGIESVGEIDSSNSTVCMNLNSKGLYVIGTVSSPCEIGQVELNLIPAFIQSHGHCANKRLYSGGRLIVGGSESSSYALIIKYLYLESEVFFQVLNDHDQERQLDGKCLLRVKRGVNVVG
Ga0307400_1061757713300030709MarineLRFTGNWQEKLEFWGELVFGIESVGEIDSSNSAVCMNLNSKGLYVIGTVSSPCEIGQVELNLIPALIQSHGHSANKRLYSSGGLIVGGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDGKCLLRVKRGVNVVG
Ga0308143_11903213300031540MarineLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDSKCLLWVKRSVDVVG
Ga0308134_111022313300031579MarineSDEESCSSTACSVGTLWFTGNWQEKFELWRKLILGIEYVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQER
Ga0307993_108538013300031602MarineLRFTGNWQEKLEFWGELVFGIESVGEIDSSNSAVCMDLNSKGLYVIGTVSSPCEIGQVELNLIPALIQSHGHCANKRLYSSGGLIVGGSESSSYALVIKYLYLESEVFLQVLNDHDQERQLDGKCLLRVKRGVNVVG
Ga0307391_1061644513300031729MarineDGQEQLELRRQFLFGVETVGKVDTTDTAVRMNLHTQGLNVVGTVGSSCEIREIELNLVPALIKSHRHSTDKWLDSGCGLIVRCSESTSNALVIKDLYLEGEVFLEVLDNHDQERKLDSQCLLWVKRSIDIVG
Ga0307397_1044311313300031734MarineNSSNSAVSMNLYSESLYIVSTIGSSCEVTQVELNLVPAFIKSHWHCADKWLYSGRGLIVGCSESTSNALIIKDLNLEGEVFLQVLDNHDQEWKLDGQCFLWIKRSIDIVSRNISSHDFKD
Ga0307384_1051843413300031738MarineLEFWGELVFGIESVGEIDSSNSTVCMDLNSKSLYVIGTVSSPCEIGQVELNLIPALIQSHGHCTNERLYSGGRLIVGGSESSSYALIIKYLYLESEVFFQVLNDHDQERQLDGKSLLWVERGIDVVG
Ga0307383_1034541813300031739MarineLRFSCNWQEKLEFWWEFVFGIESVGEINSSDSAVSMNLNSESLYVVGTVGSSCEIREIELNLVPALIKSHRHSTDKWLDSGCGLIVRCSESTSNALVIKDLNLEGEVFLQILDDHDQERKLDSQCLLWVKRSIDVVG
Ga0307383_1062605013300031739MarineVFGIESVGEIDSSNSAVSMDLNSEGLYVVGTIGSSGEVTKVELNLVPSLIKSHWHGTDKWLDSGSRLIVRCSESTSDTLIIKYLNLESEVFLKVLDNHDQEWKLDSQSLLWVEWSIDVIS
Ga0314684_1050569413300032463SeawaterLRFTGNWQEKFEFWGEFVLGIESVGEIDSSNSAVSMDLNSKGVYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314684_1054802123300032463SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQEGKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314670_1026185723300032470SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314670_1039997113300032470SeawaterLRFTGNWQEKFEFWGEFVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGINVVG
Ga0314668_1030238813300032481SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314668_1038786213300032481SeawaterLALRFTGNWQEKFEFWGKLVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGINVVG
Ga0314675_1029877923300032491SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVGVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314679_1051563313300032492SeawaterWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQEGKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314688_1028273213300032517SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLYLEGEVLLQVLNDHDQEGKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314689_1039458913300032518SeawaterLRFTGNWQEKFEFWGEFVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314689_1047191313300032518SeawaterLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVKRSIDVVGGHIGTHDLQNG
Ga0314689_1052916113300032518SeawaterLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPAFIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG
Ga0314676_1033586623300032519SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLHLEGEVLLQVLNDHDQEGKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314676_1050328813300032519SeawaterLRFTGNWQEKFEFWGKLVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGINVVG
Ga0314677_1023837623300032522SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANKWLDSGSGLIVGGSESSSNTLIIQNLDLEGEVFLQVLNDHDQERKLNS
Ga0314682_1043628413300032540SeawaterLRFTGNWQEKFEFWGKLVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314674_1035535723300032615SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314671_1037462813300032616SeawaterLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHRHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG
Ga0314685_1073563413300032651SeawaterLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG
Ga0314678_1041387313300032666SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314687_1038021123300032707SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314687_1060884613300032707SeawaterLNNPGKTFLLFIYGSRQTASSLVGWLSGDWQEELEFRWQFVLCVKSIGEVDSSYSAVSMDLDSEGLDVVSTVGSSSEIRQVELNLVPSLIQSHWHCANEWLHSSGRLIVGGSESSSHLLVIQNLHLEGEVFLQVLDDHDQERKLDSKGLLWVQWGVDVVSGYVGSHDLKHR
Ga0314686_1035673013300032714SeawaterLALRFTGNWQEKFEFWGEFVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314703_1015890423300032723SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQEGKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314703_1024967913300032723SeawaterLLNHSLSLWFTSNWQEKFEFWGEFVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGINVVG
Ga0314695_137110813300032724SeawaterWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPAFIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG
Ga0314698_1026655013300032726SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGSGLIVGGSESSSNTLIIQNLDLEGEVFLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314698_1053904913300032726SeawaterESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314711_1025365423300032732SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQEGKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314711_1035659713300032732SeawaterLALRFTGNWQEKFEFWGKLVLGIESVGEIDSSNSAVSMDLNSKGLYVVGTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314714_1059940313300032733SeawaterLLNHSLSLWFTSNWQEKFELWWELIFSVESVGEIDSSDSAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSLIKSHRHGANKWLDSGSGLIVGGSESSSNTLIIQNLDLEGEVFLQVLNDHDQERKLDS
Ga0314714_1074656413300032733SeawaterLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVV
Ga0314706_1043960713300032734SeawaterLVACITDLLNHSLSLWFTSNWQEKFELWWELIFSVESVGEIDSSDSAVSVDLNSKGLYVIGTVGSSGEIRQVELNLIPSLIKSHRHGANKWLDSGSGLIVGGSESSSNTLIIQNLDLEGEVFLQVLNDHDQERKLDS
Ga0314710_1025659113300032742SeawaterLRFTGNWQEKFEFWGEFVLGIESVGEIDSSNSAVSMDLNSKGLYIVSTISSPCEIGQVELNLIPAFIQSHGHCANKWLYSGGRLIVGGSESSSYALVIKYLYFESEVFLQVLNDHDQERQLDGKCLLWVKRGIDVVG
Ga0314707_1023765923300032743SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314704_1058119113300032745SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRGVDVVGRH
Ga0314701_1036083413300032746SeawaterLSLWLTSDWQEKFELWWKLILGVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEILLKVLDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0314701_1037594913300032746SeawaterLRFTGNWQEKLEFWGELVLGVESVGEIDSSNSAVCMDLNSKGLYVVGTVSSPCKIRQVELNLIPALIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG
Ga0314712_1026272913300032747SeawaterLSLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLHLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0314708_1031163513300032750SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIKYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314694_1026052923300032751SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVDVVGRHIGSHDLEN
Ga0314700_1067342813300032752SeawaterFELWWKLILSVKSIREVDSSNSAVGVDLNSESFYIVCTVSSSCEIRQVELNLVPALIQSHWHGTDEWLDSGGRLIVGGSESSSDTLVIQNLNFEGEVLLKILDDHDQERKLDGKSFLWVERSIDVVGGHIGTHDLQNG
Ga0314700_1075817013300032752SeawaterGEIDSSNSAVCMDLNSKGLYVVGTVSSPCEIRQVELNLIPAFIQSHGHCANKRLYSGGRLIVRGSESSSYALVIKYLYLESEVFFQVLNDHDQERQLDGKCLLWVKRSVDVVG
Ga0314692_1036676023300032754SeawaterLWLTGNWQEKLELWWELVFGVESVGEIDSSDSAVSVDLNSKGLYVVGTVSSSGEIRQIELNLIPSLIKSHRHGANERLDSGGRLIVRGSESSSYALVIEYLYLEGEVLLQVLNDHDQERKLNGQGLLWVKRGVNVVGRHIGSHDLEN
Ga0307390_1069749413300033572MarineGTTRRLSSYVCSLALRFSCNRQEKLEFWWEFVFGIESVGEINSSDSAVSMNLNSESLYVVGTVGSSSEITKIELNLIPALIKSHRHSTDKWLDSGCGLIVRCSESTSNALVIKDLNLEGEVFLQILDDHDQERKLDSQCLLWVKRSIDVVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.