Basic Information | |
---|---|
Family ID | F059944 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 44 residues |
Representative Sequence | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 7.52 % |
% of genes near scaffold ends (potentially truncated) | 93.98 % |
% of genes from short scaffolds (< 2000 bps) | 96.24 % |
Associated GOLD sequencing projects | 61 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (95.489 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (45.113 % of family members) |
Environment Ontology (ENVO) | Unclassified (88.722 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.218 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF00145 | DNA_methylase | 4.51 |
PF14279 | HNH_5 | 2.26 |
PF05869 | Dam | 2.26 |
PF01844 | HNH | 1.50 |
PF03354 | TerL_ATPase | 0.75 |
PF02675 | AdoMet_dc | 0.75 |
PF09723 | Zn-ribbon_8 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 4.51 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.75 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.50 % |
Unclassified | root | N/A | 1.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109213772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300003277|JGI25908J49247_10041036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1250 | Open in IMG/M |
3300003393|JGI25909J50240_1079292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300003394|JGI25907J50239_1105478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300003404|JGI25920J50251_10074653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300003404|JGI25920J50251_10126049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300003411|JGI25911J50253_10191043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300003411|JGI25911J50253_10191624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300003429|JGI25914J50564_10073400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300003497|JGI25925J51416_10153716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300003616|JGI25928J51866_1113060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300004240|Ga0007787_10345943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300005580|Ga0049083_10102789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300005580|Ga0049083_10339551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300005581|Ga0049081_10165477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300006484|Ga0070744_10198236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300006805|Ga0075464_10345265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300007972|Ga0105745_1178717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300007973|Ga0105746_1308651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300007992|Ga0105748_10527941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300009068|Ga0114973_10322020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300009068|Ga0114973_10560982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300009152|Ga0114980_10440312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300009152|Ga0114980_10462862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300009152|Ga0114980_10611001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300009155|Ga0114968_10089685 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300009155|Ga0114968_10155775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1352 | Open in IMG/M |
3300009155|Ga0114968_10491619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300009155|Ga0114968_10514597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009155|Ga0114968_10625289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300009155|Ga0114968_10698871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300009159|Ga0114978_10229767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300009159|Ga0114978_10351462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300009160|Ga0114981_10213938 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
3300009163|Ga0114970_10410829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300009163|Ga0114970_10760142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300009164|Ga0114975_10557033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009180|Ga0114979_10630328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300009180|Ga0114979_10667962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300009181|Ga0114969_10554041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300009183|Ga0114974_10374075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300009183|Ga0114974_10604449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300009183|Ga0114974_10662080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300009183|Ga0114974_10720173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300009184|Ga0114976_10094665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1710 | Open in IMG/M |
3300009184|Ga0114976_10502897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300009184|Ga0114976_10503583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300009184|Ga0114976_10658058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300009187|Ga0114972_10361881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
3300010160|Ga0114967_10303042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300010160|Ga0114967_10507085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300010885|Ga0133913_13055668 | Not Available | 1113 | Open in IMG/M |
3300010885|Ga0133913_13187750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1085 | Open in IMG/M |
3300012012|Ga0153799_1013393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1750 | Open in IMG/M |
3300013372|Ga0177922_10057241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300013372|Ga0177922_10685079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300013372|Ga0177922_10830590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300013372|Ga0177922_10838444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300017701|Ga0181364_1044245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300017701|Ga0181364_1071012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300017716|Ga0181350_1042788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
3300017716|Ga0181350_1051100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
3300017716|Ga0181350_1069295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300017716|Ga0181350_1086869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300017716|Ga0181350_1141989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300017722|Ga0181347_1167638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300017736|Ga0181365_1036966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300017736|Ga0181365_1108330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300017736|Ga0181365_1131774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017736|Ga0181365_1145093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300017736|Ga0181365_1151239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300017774|Ga0181358_1252233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300017777|Ga0181357_1158887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
3300017777|Ga0181357_1216282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300017777|Ga0181357_1232927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300017777|Ga0181357_1248514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300017778|Ga0181349_1259638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300017778|Ga0181349_1269317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300017778|Ga0181349_1269943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300017778|Ga0181349_1273987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300017780|Ga0181346_1047042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
3300017780|Ga0181346_1165712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300017780|Ga0181346_1270187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300017784|Ga0181348_1047999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1753 | Open in IMG/M |
3300017784|Ga0181348_1169361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300017784|Ga0181348_1245159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300017785|Ga0181355_1141131 | Not Available | 976 | Open in IMG/M |
3300017785|Ga0181355_1279782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300017785|Ga0181355_1315540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300017785|Ga0181355_1344970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300019784|Ga0181359_1123199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300019784|Ga0181359_1236337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300020160|Ga0211733_10773903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2267 | Open in IMG/M |
3300020161|Ga0211726_10213905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2424 | Open in IMG/M |
3300022190|Ga0181354_1126508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300022190|Ga0181354_1149059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300022190|Ga0181354_1150479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300022407|Ga0181351_1243023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300027193|Ga0208800_1021791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300027621|Ga0208951_1154779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300027644|Ga0209356_1184050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300027644|Ga0209356_1187266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300027688|Ga0209553_1084022 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
3300027688|Ga0209553_1202897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300027688|Ga0209553_1280847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300027732|Ga0209442_1191184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300027734|Ga0209087_1304569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300027754|Ga0209596_1155859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300027759|Ga0209296_1333115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300027763|Ga0209088_10327683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300027770|Ga0209086_10104316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1446 | Open in IMG/M |
3300027782|Ga0209500_10034850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2805 | Open in IMG/M |
3300027782|Ga0209500_10156193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300027798|Ga0209353_10383584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300027808|Ga0209354_10042904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1818 | Open in IMG/M |
3300027808|Ga0209354_10107907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
3300027808|Ga0209354_10238800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300027892|Ga0209550_10786391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027963|Ga0209400_1029273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3087 | Open in IMG/M |
3300027963|Ga0209400_1372608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300027973|Ga0209298_10227854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300027974|Ga0209299_1105559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300031999|Ga0315274_11830176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300032401|Ga0315275_12780698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300034019|Ga0334998_0654093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300034021|Ga0335004_0224447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1156 | Open in IMG/M |
3300034071|Ga0335028_0592043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300034101|Ga0335027_0175621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1546 | Open in IMG/M |
3300034104|Ga0335031_0063762 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
3300034104|Ga0335031_0708430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300034119|Ga0335054_0710201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300034120|Ga0335056_0434789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300034120|Ga0335056_0688743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 45.11% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 33.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.26% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.01% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.26% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.50% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.75% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.75% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1092137721 | 3300002408 | Freshwater | MMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPS |
JGI25908J49247_100410361 | 3300003277 | Freshwater Lake | VQIDAYRVMMTGYYMMVSIWFALSATAGNKKGDFITCTQSLSV |
JGI25909J50240_10792921 | 3300003393 | Freshwater Lake | MTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPS |
JGI25907J50239_11054783 | 3300003394 | Freshwater Lake | MMDSIWYVLSVIADNKEGDFITCTQSLSVMAVIVRPSSYGLSN |
JGI25920J50251_100746533 | 3300003404 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIV |
JGI25920J50251_101260491 | 3300003404 | Freshwater Lake | MTTDYYVMVSIWFALSATAGNKKGDFITCTQSLSVMAVIV |
JGI25911J50253_101910433 | 3300003411 | Freshwater Lake | MMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYGL |
JGI25911J50253_101916241 | 3300003411 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYGL |
JGI25914J50564_100734002 | 3300003429 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
JGI25925J51416_101537161 | 3300003497 | Freshwater Lake | VQIDAYRVMMTGYYMMVSIWFALSATAGNKKGDFITCTQS |
JGI25928J51866_11130601 | 3300003616 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYGL |
Ga0007787_103459431 | 3300004240 | Freshwater Lake | VYRVMMTGYYMMDSIWYVLSVTVDNKEGDFITCMHNLNVMDASATPSSYGLSS* |
Ga0049083_101027891 | 3300005580 | Freshwater Lentic | YRVMMTGYYMMVSIWFVLSATAGNKKGDFITCTPSLSVMAVIVRLSSYGLSS* |
Ga0049083_103395511 | 3300005580 | Freshwater Lentic | MTTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPS |
Ga0049081_101654771 | 3300005581 | Freshwater Lentic | MMDSIWYVLSVIADNKEGDFITCMHNLNVMDVIVRPSF |
Ga0070744_101982362 | 3300006484 | Estuarine | TDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIARPNSYGWIS* |
Ga0075464_103452651 | 3300006805 | Aqueous | MMDSIWYVLNVTVDNKEGDFITCTQNLSVMDVIVRPSSYGW |
Ga0105745_11787172 | 3300007972 | Estuary Water | MMTDYYMMVSIWFALSATAGNKKGDFITCTQSLSV |
Ga0105746_13086511 | 3300007973 | Estuary Water | MMTDYYMMVSIWFALNATAGNKKGDFITCTQSLSVMAVIVRPSSYGLS |
Ga0105748_105279412 | 3300007992 | Estuary Water | MMTDYYMMVSIWFALNATAGNKKGDFITCTQSLSVM |
Ga0114973_103220201 | 3300009068 | Freshwater Lake | MMTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVI |
Ga0114973_105609821 | 3300009068 | Freshwater Lake | YYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIARPSSYGLIS* |
Ga0114980_104403121 | 3300009152 | Freshwater Lake | PIDVYRVMMTGYYMMDSIWYVLSVIADNKEGDFIICTHNLSVMDVNVRLSSYG* |
Ga0114980_104628621 | 3300009152 | Freshwater Lake | MTTDYYMMDNIWYVLSVIADNKEGDFIKCTQNSSVMAVIVKPSSYGWIN* |
Ga0114980_106110012 | 3300009152 | Freshwater Lake | MTTDNYMMVSIWFVLSATAGNKKGDFITCTQNLSVMAVIARPSSYGLS |
Ga0114968_100896852 | 3300009155 | Freshwater Lake | MTTDYYMMDSIWYALNVIADNKEGDFITCTQNLSVMAVIVIPSFYGWSN* |
Ga0114968_101557754 | 3300009155 | Freshwater Lake | VQIDAYLVMMTGYYMMVSIWFVLSATAGNKKGDFITCTQNLSVM |
Ga0114968_104916191 | 3300009155 | Freshwater Lake | AYLVMMTGYYMMVSIWFVLSATAGNKKGDFITCTQNLSVMGVIVRPSFYGWIN* |
Ga0114968_105145971 | 3300009155 | Freshwater Lake | VMMTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIARPSSYGLIS* |
Ga0114968_106252891 | 3300009155 | Freshwater Lake | MMDSIWYVLNATAGNKKGDFSTCTQSLSVMGVVAKPSSYGWIS* |
Ga0114968_106988712 | 3300009155 | Freshwater Lake | VYRVMMTGYYMMDSIWYVLSVIADNKEGDFITCTQNL |
Ga0114978_102297671 | 3300009159 | Freshwater Lake | VQIDAYRVMMTGYYMMVSIWFALNATAGNKKGDFIICTQSLSVMGVVERPSSYGLIS* |
Ga0114978_103514623 | 3300009159 | Freshwater Lake | MTTDYYMMDSIWYVLSVIADNKEGDFITCTQNLSVMAV |
Ga0114981_102139381 | 3300009160 | Freshwater Lake | DYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSFYGLSS* |
Ga0114970_104108292 | 3300009163 | Freshwater Lake | MMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYGLS |
Ga0114970_107601421 | 3300009163 | Freshwater Lake | TGYYMMVSIWFVLSATAGNKKGDFITCTQNLSVMAVIVRPSSYG* |
Ga0114975_105570332 | 3300009164 | Freshwater Lake | MMTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYGLS |
Ga0114979_106303281 | 3300009180 | Freshwater Lake | MMTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPS |
Ga0114979_106679622 | 3300009180 | Freshwater Lake | MTTDYYMMDNIWYVLSVIADNKEGDFITCTQNLSVMGVIVRPSSYG |
Ga0114969_105540413 | 3300009181 | Freshwater Lake | MMGSIWYVLSVTVDNKEGDFITCMRNLSVMDVRLKLSSYGW |
Ga0114974_103740751 | 3300009183 | Freshwater Lake | MVSIWFVLSATAGNKKGDFITCTQSLSVMAVIARPSSYGLSS* |
Ga0114974_106044491 | 3300009183 | Freshwater Lake | MTTDYYTMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVR |
Ga0114974_106620803 | 3300009183 | Freshwater Lake | MMDSIWYVLSVIADNKEGDFITCTQNLSVMAVIVRPSSY |
Ga0114974_107201732 | 3300009183 | Freshwater Lake | MMTGYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIARPSSYGL |
Ga0114976_100946651 | 3300009184 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVI |
Ga0114976_105028971 | 3300009184 | Freshwater Lake | MTTDYYVMVSIWFVLSATAGNKKGDFITCTQSLSVM |
Ga0114976_105035831 | 3300009184 | Freshwater Lake | MTTDYYTMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYGL |
Ga0114976_106580581 | 3300009184 | Freshwater Lake | MMVSIWFALSATAGNKKGDFITCTQNLSVMAVIARPSSYGLSS* |
Ga0114972_103618813 | 3300009187 | Freshwater Lake | MMTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYGL |
Ga0114967_103030421 | 3300010160 | Freshwater Lake | MMTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPS |
Ga0114967_105070852 | 3300010160 | Freshwater Lake | MTTDYYVMVSIWFALNATAGNKKGDFITCTQSLSVMAVIV |
Ga0133913_130556681 | 3300010885 | Freshwater Lake | FALSATAGNKKGDFITCTQSLSVMAVIVRPSSYGLSN* |
Ga0133913_131877501 | 3300010885 | Freshwater Lake | RVMMTGYYMMVSIWFALNATAGNKKGDFIICTQSLSVMGVVERPSSYGLIS* |
Ga0153799_10133936 | 3300012012 | Freshwater | MMTGYYMMVSIWYVLSATAGNKKGDFITCTQNLSVMGA |
Ga0177922_100572411 | 3300013372 | Freshwater | TGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIARPSFYGLSS* |
Ga0177922_106850791 | 3300013372 | Freshwater | MMTGYYMMDSIWYVLNVIVDNKEGDFITCTQNLSVMAVIVRPSSYG |
Ga0177922_108305901 | 3300013372 | Freshwater | MTGYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVKPSSYGWIN* |
Ga0177922_108384441 | 3300013372 | Freshwater | TGYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYGLSS* |
Ga0181364_10442452 | 3300017701 | Freshwater Lake | MTTDYYMMVSIWFALNATAGNKKGDFIKCTQNLSVMAVIVRPSSDGW |
Ga0181364_10710122 | 3300017701 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVK |
Ga0181350_10427881 | 3300017716 | Freshwater Lake | MTTDYYMMVSIWFALNATAGNKKGDFITCTLNLSVMG |
Ga0181350_10511001 | 3300017716 | Freshwater Lake | MTTDYYMMVSIWFALNATAGNKKGDFITCTLNLSVMGVVARPSSYGLI |
Ga0181350_10692951 | 3300017716 | Freshwater Lake | MMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Ga0181350_10868691 | 3300017716 | Freshwater Lake | GYYMMVSIWFALSATAGNKKGDFITCTLNLGVMGVIVRPSSYGLSS |
Ga0181350_11419892 | 3300017716 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSS |
Ga0181347_11676381 | 3300017722 | Freshwater Lake | MMTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Ga0181365_10369663 | 3300017736 | Freshwater Lake | VQIDAYRVMMTGYYMMVSIWFVLSATAGNKKGDFITCMHNLNVMDVIVRPSFCGWSS |
Ga0181365_11083303 | 3300017736 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMGVVERPSSYGLI |
Ga0181365_11317742 | 3300017736 | Freshwater Lake | MTTDYYMMVSIWFALNATAGHKKGDFIKCTQRLSVMAV |
Ga0181365_11450931 | 3300017736 | Freshwater Lake | MTTGYYMMDSIWYVLSVIADNKEGDFITCTQSLSVMA |
Ga0181365_11512391 | 3300017736 | Freshwater Lake | MTTDYYMMASIWFALSATAGNKKGDFITCTQNLSVMAVI |
Ga0181358_12522332 | 3300017774 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSS |
Ga0181357_11588871 | 3300017777 | Freshwater Lake | MMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Ga0181357_12162821 | 3300017777 | Freshwater Lake | MMDSIWYVLSVTVDNKEGDFITCTQNLSVMAVIVRPS |
Ga0181357_12329271 | 3300017777 | Freshwater Lake | MMTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRP |
Ga0181357_12485141 | 3300017777 | Freshwater Lake | MTTDYYMMVSIWFVLSAIAGNKKGDFITCTQSLSVMAVIV |
Ga0181349_12596382 | 3300017778 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRP |
Ga0181349_12693172 | 3300017778 | Freshwater Lake | MTTDYYVMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYGL |
Ga0181349_12699431 | 3300017778 | Freshwater Lake | VQIDAYRVMMTGYYMMVSIWFVLSATAGNKKGDFITCTQS |
Ga0181349_12739871 | 3300017778 | Freshwater Lake | YLVMTTDYYMMVSIWFALNATAGNKKGDFITCTLNLSVMGVVARPSSYGLIS |
Ga0181346_10470421 | 3300017780 | Freshwater Lake | HVMTTDYYVMVSIWFVLSATAGNKKGDFITCTQSLSVMGVVARPSSYGLTS |
Ga0181346_11657121 | 3300017780 | Freshwater Lake | VYHVMTTDYYVMVSIWYALSATAGNKKRDFITCTQSLSVMGVVVRPSSYGLIS |
Ga0181346_12701871 | 3300017780 | Freshwater Lake | VQIDAYRVMMTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVI |
Ga0181348_10479991 | 3300017784 | Freshwater Lake | VMTTDYYVMVSIWFVLSATAGNKKGDFITCTQSLSVMGVVARPSSYGLTS |
Ga0181348_11693612 | 3300017784 | Freshwater Lake | MTTGYYMMVSIWFALSATAGNKKGDFITCTQSLSV |
Ga0181348_12451592 | 3300017784 | Freshwater Lake | VYRVMTTDYYMMDSIWYVLSVIADNKEGDFITCTQSLSV |
Ga0181355_11411311 | 3300017785 | Freshwater Lake | TPASRYVYRVMTTDYYMMVSIWFVLSATAGNKEGDFITCTQNLSVMAVIVRPSSYGLSN |
Ga0181355_12797821 | 3300017785 | Freshwater Lake | MTTDYYMMDSIWYVLSVIADNKEGDFITCTQSLSVMAVI |
Ga0181355_13155401 | 3300017785 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Ga0181355_13449702 | 3300017785 | Freshwater Lake | VYLVMMTGYYMMDSIWCVLSVIADNKEGDFITCTQNLSVMAVIVKPSSY |
Ga0181359_11231991 | 3300019784 | Freshwater Lake | MTTDYYVMVSIWFVLSATAGNKKGDFITCTQSLSVMD |
Ga0181359_12363371 | 3300019784 | Freshwater Lake | MMTGYYMMVSIWFALSATAGNKKGDFITCTLDLSVMAVIVRS |
Ga0211733_107739036 | 3300020160 | Freshwater | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVR |
Ga0211726_102139057 | 3300020161 | Freshwater | MMDSIWSVLNVIADNKEGDFITCMRNLSVMDVSVRLSSYG |
Ga0181354_11265081 | 3300022190 | Freshwater Lake | MTTDYYVMVSIWFALSATAGNKKGDFITCTQSLSVMAVI |
Ga0181354_11490592 | 3300022190 | Freshwater Lake | MTTDYYMMVSIWFALNATAGNKKGDFITCTQNLSVMAVIVRPSFYGWIS |
Ga0181354_11504792 | 3300022190 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMGVI |
Ga0181351_12430232 | 3300022407 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIV |
Ga0208800_10217912 | 3300027193 | Estuarine | MTTDYYMMVSIWFALNATAGNKKGDFITCTQSLSVMGVIVRPSSYGLTS |
Ga0208951_11547792 | 3300027621 | Freshwater Lentic | MTTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRPSFYG |
Ga0209356_11840501 | 3300027644 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVRLSSYG |
Ga0209356_11872662 | 3300027644 | Freshwater Lake | MMTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIV |
Ga0209553_10840221 | 3300027688 | Freshwater Lake | MMTDYYMMDSIWFVLSATAGNKKGDFITCTQSLSVMAV |
Ga0209553_12028971 | 3300027688 | Freshwater Lake | MMDSIWYVLSVIADNKEGDFITCTQNLSVMGVVARPSSYG |
Ga0209553_12808471 | 3300027688 | Freshwater Lake | MTTGYYMMVSIWFALSATAGNKKGDFITCTQSLSVMAVIVKP |
Ga0209442_11911841 | 3300027732 | Freshwater Lake | MTTDYYTMVSIWFALSATAGNKKGDFITCTQSLSVM |
Ga0209087_13045692 | 3300027734 | Freshwater Lake | MTTDYYMMDSIWYVLNVIADNKEGDFITCTQSLSVMGVV |
Ga0209596_11558591 | 3300027754 | Freshwater Lake | MMTGYYMMVSIWFVLNATAGNKNGDFITCTQSLSVMAVIVRPSSYGLS |
Ga0209296_13331151 | 3300027759 | Freshwater Lake | MMTGYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMA |
Ga0209088_103276831 | 3300027763 | Freshwater Lake | MMTGYYMMVSIWFVLSATAGNKKGDFITCTQNLSVMAVIVRPSSYGLS |
Ga0209086_101043164 | 3300027770 | Freshwater Lake | MTTDYYVMVSIWFALNATAGNKKGDFITCTQSLSVMAVIVRPSSYGLS |
Ga0209500_100348503 | 3300027782 | Freshwater Lake | SIWYVLSVTVDNKEGDFITCTQSLSVMAVIVRPSSYGLSS |
Ga0209500_101561931 | 3300027782 | Freshwater Lake | MMTGYYMMVSIWFALNATAGNKKGDFIICTQSLSVMGVVERPSSYGLIS |
Ga0209353_103835841 | 3300027798 | Freshwater Lake | MTTDYYMMVSIWFALSATAGNKKGDFITCTQSSSVMAVIV |
Ga0209354_100429041 | 3300027808 | Freshwater Lake | MTGYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Ga0209354_101079071 | 3300027808 | Freshwater Lake | LAPIDAYRVMMTGYYMMDSFWYVLSVTVDNKEGDFITCTQSLSVMAVIVKPSSYGLSS |
Ga0209354_102388001 | 3300027808 | Freshwater Lake | MMTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPSSYG |
Ga0209550_107863912 | 3300027892 | Freshwater Lake | MTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVM |
Ga0209400_102927310 | 3300027963 | Freshwater Lake | MTGYYMMVSIWFVLSATAGNKKGDFITCTQNLSVM |
Ga0209400_13726082 | 3300027963 | Freshwater Lake | IDAYLVMMTGYYMMVSIWFVLSATAGNKKGDFITCTQNLSVMAVIVRPSSYG |
Ga0209298_102278541 | 3300027973 | Freshwater Lake | APIDVYRVMMTGYYMMDSIWYVLSVIADNKEGDFIKCTQNSSVMAVIVKPSSYGWIN |
Ga0209299_11055591 | 3300027974 | Freshwater Lake | VQIDAYLVMTTDYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPS |
Ga0315274_118301762 | 3300031999 | Sediment | MTTDYYMMVSIWFALSATAGNKKGDFITCTLDLSVMA |
Ga0315275_127806981 | 3300032401 | Sediment | MMTGYYMMVSIWFALNATAGNKKGDFITCTQSLSVMAVIVKPSSY |
Ga0334998_0654093_349_498 | 3300034019 | Freshwater | MMTDYYMMVSIWFVLNATAGNKKGDFITCTQSLSVMAVIVKPSSYGLSS |
Ga0335004_0224447_143_292 | 3300034021 | Freshwater | MMTGYYMMDSIWYVLNVIADNKKGDFITCTQNLSVMAVIVKPSSYGWIN |
Ga0335028_0592043_451_597 | 3300034071 | Freshwater | MMTGYYMMVSIWFALSATAGNKKGDFSTCTQSLSVMAVIVRPSSYGLSS |
Ga0335027_0175621_1431_1544 | 3300034101 | Freshwater | MMDSIWYVLSVIADNKEGDFITCMHNLNVMDASVIPSF |
Ga0335031_0063762_2530_2637 | 3300034104 | Freshwater | MMTGYYMMDSIWFVLSATAGNKKGDFIICTQSLSVM |
Ga0335031_0708430_449_577 | 3300034104 | Freshwater | MMTGYYMMVSIWFVLSATAGNKKGDFITCTQSLSVMAVIVRPS |
Ga0335054_0710201_165_314 | 3300034119 | Freshwater | MMTGYYMMDSIWFVLSATAGNKKGDFITCTQSLSVMAVIARPSFYGWSS |
Ga0335056_0434789_453_602 | 3300034120 | Freshwater | MMTGYYMMVSIWFALSAAAGNKKGDFITCTQNLSVMAVIVRPSFYGLNS |
Ga0335056_0688743_126_275 | 3300034120 | Freshwater | MMTGYYMMDSIWYVLNVIADNKEGDFITCTQNLSVMAVIVRPSSYGWSN |
⦗Top⦘ |