NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059936

Metagenome / Metatranscriptome Family F059936

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059936
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 51 residues
Representative Sequence VEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA
Number of Associated Samples 128
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.99 %
% of genes from short scaffolds (< 2000 bps) 95.49 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.947 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.045 % of family members)
Environment Ontology (ENVO) Unclassified
(24.812 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.098 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF07969Amidohydro_3 7.52
PF00313CSD 6.77
PF13464DUF4115 6.02
PF05922Inhibitor_I9 6.02
PF05222AlaDh_PNT_N 5.26
PF01596Methyltransf_3 1.50
PF04978DUF664 1.50
PF12697Abhydrolase_6 1.50
PF00027cNMP_binding 1.50
PF01161PBP 1.50
PF01152Bac_globin 0.75
PF13240zinc_ribbon_2 0.75
PF13416SBP_bac_8 0.75
PF02371Transposase_20 0.75
PF03404Mo-co_dimer 0.75
PF02579Nitro_FeMo-Co 0.75
PF00082Peptidase_S8 0.75
PF01726LexA_DNA_bind 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG1404Serine protease, subtilisin familyPosttranslational modification, protein turnover, chaperones [O] 6.02
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 1.50
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 1.50
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 1.50
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 1.50
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.75
COG3547TransposaseMobilome: prophages, transposons [X] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.70 %
UnclassifiedrootN/A20.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1080991Not Available814Open in IMG/M
3300001205|C688J13580_1057288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300004058|Ga0055498_10100117All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300004058|Ga0055498_10121601Not Available548Open in IMG/M
3300004156|Ga0062589_101407685Not Available680Open in IMG/M
3300004463|Ga0063356_106054905All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300004798|Ga0058859_11472890All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005093|Ga0062594_101741166Not Available653Open in IMG/M
3300005169|Ga0066810_10196627Not Available505Open in IMG/M
3300005172|Ga0066683_10239052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1125Open in IMG/M
3300005179|Ga0066684_10691404All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005330|Ga0070690_101251371All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300005334|Ga0068869_101827416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300005338|Ga0068868_100760880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria871Open in IMG/M
3300005345|Ga0070692_11276465Not Available526Open in IMG/M
3300005365|Ga0070688_100042779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2788Open in IMG/M
3300005441|Ga0070700_101060167All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005444|Ga0070694_100688323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300005456|Ga0070678_100359138All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300005457|Ga0070662_100197116All Organisms → cellular organisms → Bacteria → Proteobacteria1596Open in IMG/M
3300005458|Ga0070681_12010319Not Available506Open in IMG/M
3300005466|Ga0070685_10383750All Organisms → cellular organisms → Bacteria → Proteobacteria969Open in IMG/M
3300005536|Ga0070697_100956815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300005615|Ga0070702_100208879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1298Open in IMG/M
3300005718|Ga0068866_11466208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300005764|Ga0066903_100792970All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300005842|Ga0068858_100888943All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300005885|Ga0075284_1062546Not Available538Open in IMG/M
3300005886|Ga0075286_1006301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1354Open in IMG/M
3300006034|Ga0066656_10442502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300006046|Ga0066652_100688541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium972Open in IMG/M
3300006573|Ga0074055_11774529All Organisms → cellular organisms → Bacteria → Proteobacteria1081Open in IMG/M
3300006794|Ga0066658_10645671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300006903|Ga0075426_10370101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1055Open in IMG/M
3300009137|Ga0066709_103286100Not Available588Open in IMG/M
3300009147|Ga0114129_12181823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300009153|Ga0105094_10904397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300009176|Ga0105242_11369046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300009176|Ga0105242_13195538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300009792|Ga0126374_11320316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300009806|Ga0105081_1033278Not Available692Open in IMG/M
3300009807|Ga0105061_1059808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300009809|Ga0105089_1016990Not Available954Open in IMG/M
3300009822|Ga0105066_1026798Not Available1157Open in IMG/M
3300009837|Ga0105058_1094920Not Available697Open in IMG/M
3300009837|Ga0105058_1177954Not Available525Open in IMG/M
3300010042|Ga0126314_10650968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300010359|Ga0126376_11753585Not Available657Open in IMG/M
3300010401|Ga0134121_12942916Not Available523Open in IMG/M
3300011119|Ga0105246_11826995Not Available581Open in IMG/M
3300011998|Ga0120114_1101205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300012201|Ga0137365_10342122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1106Open in IMG/M
3300012212|Ga0150985_101798804All Organisms → cellular organisms → Bacteria2495Open in IMG/M
3300012285|Ga0137370_10363903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium872Open in IMG/M
3300012359|Ga0137385_11359417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300012396|Ga0134057_1174906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300012405|Ga0134041_1368516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300012410|Ga0134060_1179162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300012469|Ga0150984_103966378All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300012908|Ga0157286_10334614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300012912|Ga0157306_10226592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300012913|Ga0157298_10315690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300012941|Ga0162652_100075288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300012960|Ga0164301_10399814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium961Open in IMG/M
3300012985|Ga0164308_10281720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1311Open in IMG/M
3300012986|Ga0164304_11861593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
3300012988|Ga0164306_11110888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300014295|Ga0075305_1007144All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300014304|Ga0075340_1142426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300014318|Ga0075351_1154671All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300014324|Ga0075352_1274101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300014488|Ga0182001_10264097Not Available674Open in IMG/M
3300014823|Ga0120170_1109348Not Available555Open in IMG/M
3300015359|Ga0134085_10453834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300015371|Ga0132258_10429469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3290Open in IMG/M
3300015371|Ga0132258_13811968All Organisms → Viruses → Predicted Viral1027Open in IMG/M
3300015372|Ga0132256_101832088Not Available715Open in IMG/M
3300015373|Ga0132257_104092916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300017959|Ga0187779_10670009Not Available699Open in IMG/M
3300017966|Ga0187776_11605838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300018032|Ga0187788_10032656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1710Open in IMG/M
3300018066|Ga0184617_1108936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300018072|Ga0184635_10105193All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300018089|Ga0187774_11016685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300019356|Ga0173481_10356549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium701Open in IMG/M
3300019362|Ga0173479_10348891All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300020002|Ga0193730_1109851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300021344|Ga0193719_10269664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300025324|Ga0209640_11060028All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025537|Ga0210061_1011578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1404Open in IMG/M
3300025538|Ga0210132_1032477All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300025899|Ga0207642_10778252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300025908|Ga0207643_10232115Not Available1132Open in IMG/M
3300025922|Ga0207646_11142021Not Available685Open in IMG/M
3300025942|Ga0207689_10469823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1052Open in IMG/M
3300025972|Ga0207668_12072232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300026003|Ga0208284_1018369Not Available574Open in IMG/M
3300026014|Ga0208776_1003313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1355Open in IMG/M
3300026089|Ga0207648_10064657All Organisms → cellular organisms → Bacteria3188Open in IMG/M
3300026121|Ga0207683_11231586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300026298|Ga0209236_1106074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1258Open in IMG/M
3300026325|Ga0209152_10378323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300026327|Ga0209266_1277292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300026523|Ga0209808_1127600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1030Open in IMG/M
3300027277|Ga0209846_1024469All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria979Open in IMG/M
3300027577|Ga0209874_1008633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3040Open in IMG/M
3300028381|Ga0268264_10848931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300028707|Ga0307291_1049848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1006Open in IMG/M
3300028715|Ga0307313_10251885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300028719|Ga0307301_10096851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300028755|Ga0307316_10356566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300028802|Ga0307503_10200158All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300028807|Ga0307305_10517137All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300028809|Ga0247824_10186692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1129Open in IMG/M
3300028872|Ga0307314_10160819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300028880|Ga0307300_10021620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1703Open in IMG/M
3300028881|Ga0307277_10083004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1344Open in IMG/M
3300028881|Ga0307277_10123538Not Available1111Open in IMG/M
3300028884|Ga0307308_10423248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300030336|Ga0247826_10178708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1430Open in IMG/M
3300031184|Ga0307499_10183716Not Available634Open in IMG/M
3300031726|Ga0302321_103394140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031834|Ga0315290_11580286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300032126|Ga0307415_102413068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300032180|Ga0307471_102142920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300032205|Ga0307472_101342408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300032342|Ga0315286_11663483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300032397|Ga0315287_11251254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium852Open in IMG/M
3300032401|Ga0315275_11566619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300032892|Ga0335081_10792942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1133Open in IMG/M
3300033758|Ga0314868_001126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2157Open in IMG/M
3300034090|Ga0326723_0549286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300034643|Ga0370545_130405Not Available569Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.77%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand6.02%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.51%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.01%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.01%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.01%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.01%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.26%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.26%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.26%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.50%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.75%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.75%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.75%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012405Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026003Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026014Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033758Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_AEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_108099113300000881SoilVEALKIPSDGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS*
C688J13580_105728813300001205SoilLAPGPRMATVKAESDIDAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0055498_1010011723300004058Natural And Restored WetlandsVTDVSALRIPSERFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA*
Ga0055498_1012160123300004058Natural And Restored WetlandsRMATVKAVEPVEALKIPADGFQAFLQAHPAVTLSMLKAVVERLREVEQRIDAWMAS*
Ga0062589_10140768533300004156SoilKRMATVKAVEPVEALKIPSDGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS*
Ga0063356_10605490523300004463Arabidopsis Thaliana RhizosphereRATETVEALKIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN*
Ga0058859_1147289023300004798Host-AssociatedATVKAADAVEALRIPGEGFRSFLLENPAVAVAILKAVVERLSEVQERIDAWMAN*
Ga0062594_10174116633300005093SoilKAVEPVEALKIPADGFQAFLQAHPTVALSMLRAVVERLREVEQRIDAWMAS*
Ga0066810_1019662723300005169SoilLFTTGKRMATVKAVEPVRALTIPSEGFQSFLLEHPAVALSMLKAIVERLREVEQRIDAWMAS*
Ga0066683_1023905213300005172SoilLLAPGKRMATVEAGTALSALRIPAEAFQDFLLDHPRAALSIMKQLVVRLREVEQRIDAWMA*
Ga0066684_1069140423300005179SoilPVRALQIPATAFREFVLDHPSVALSMLGALVERLREVEQRIDAWMAG*
Ga0070690_10125137123300005330Switchgrass RhizosphereAALRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN*
Ga0068869_10182741623300005334Miscanthus RhizospherePGPRMATVKAESDVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0068868_10076088023300005338Miscanthus RhizosphereMAILAPGKRMATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0070692_1127646523300005345Corn, Switchgrass And Miscanthus RhizosphereIKIGAEDFQAFLLGRPPVALSMMKLLVVRLREVEQRIDAWMA*
Ga0070688_10004277913300005365Switchgrass RhizosphereRKRIATVRATEEVEALKIPADAFQSFLLGHPSVAVSMLKEIVDRLREVEQRIDAWMAN*
Ga0070700_10106016723300005441Corn, Switchgrass And Miscanthus RhizosphereKAEADVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0070694_10068832313300005444Corn, Switchgrass And Miscanthus RhizosphereMATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0070678_10035913823300005456Miscanthus RhizosphereMATVKAQSDVEAIKIGAEDFQAFLLGRPPVALSMMKQLVVRLREVEQRIDAWMA*
Ga0070662_10019711613300005457Corn RhizosphereRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0070681_1201031913300005458Corn RhizosphereMATVKAVEPVEALKIPSDGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS*
Ga0070685_1038375013300005466Switchgrass RhizosphereGPRMATVKAEADVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0070697_10095681513300005536Corn, Switchgrass And Miscanthus RhizosphereTVSGVSALRVPADAFQAFLLQHPAVGISIMKQLVLRLREVEQRIEAWMA*
Ga0070702_10020887913300005615Corn, Switchgrass And Miscanthus RhizosphereEALKIPADGFQTFLKAHPAVALSMLRAVVERLREVEQRIDAWMAS*
Ga0068866_1146620823300005718Miscanthus RhizosphereVTALRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA*
Ga0066903_10079297023300005764Tropical Forest SoilSKRRSATVKAAQAVEALRIPADGFQAFLMEHPAVALAMLQAVVERLSEVQARIDAWMGNG
Ga0068858_10088894333300005842Switchgrass RhizosphereTVRATEEVAALRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN*
Ga0075284_106254613300005885Rice Paddy SoilTVKAVQPVRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS*
Ga0075286_100630113300005886Rice Paddy SoilVRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS*
Ga0066656_1044250213300006034SoilEMALLAPGKRMATVEAGTALSALRIPAEAFQDFLLDHPRAALSIMKQLVVRLREVEQRIDAWMA*
Ga0066652_10068854113300006046SoilALRVPAEAFQDFLVDHPRVGLSIMKQLVIRLREVEQRIDAWMA*
Ga0074055_1177452923300006573SoilESDVEAVMIHADAFQSFLLGHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0066658_1064567123300006794SoilAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0075426_1037010113300006903Populus RhizosphereEAFQDFLLDHPRVALSIMKQLVIRLREVEQRIDAWMA*
Ga0066709_10328610013300009137Grasslands SoilRAFLLEHSSVSVAMLEALVERLSEIQERIDAWMA*
Ga0114129_1218182323300009147Populus RhizosphereVSAVSALRVPADGFQTFLLQHPAVGISIMKQLVIRLREVEQRIEAWMA*
Ga0105094_1090439723300009153Freshwater SedimentMATVRAVGDLETLRIPAEGFRTFILEHPTVALAMMKALVVRLREVEQRIDAWMA*
Ga0105242_1136904623300009176Miscanthus RhizosphereLAPGPRMATVKAESDVEAVMIHAEAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0105242_1319553813300009176Miscanthus RhizosphereLRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN*
Ga0126374_1132031623300009792Tropical Forest SoilGKRLATVETVTTLSALRVPAEAFQDFLLDHPRVALSIMKQLVIRLREVEQRIDAWMA*
Ga0105081_103327823300009806Groundwater SandMATVRADGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA*
Ga0105061_105980813300009807Groundwater SandLLAPGKRMATVRADGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA*
Ga0105089_101699013300009809Groundwater SandDGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA*
Ga0105066_102679823300009822Groundwater SandFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA*
Ga0105058_109492013300009837Groundwater SandQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA*
Ga0105058_117795423300009837Groundwater SandMATVKAVEPVEAIKIQAEDFRSFLLEHPSVALSMLKALVDRLREVEQRLDAWMAS*
Ga0126314_1065096823300010042Serpentine SoilEAIRIDADSFQSFLLAHPAVAVSMMKQLVVRLREVEQRIDAWMA*
Ga0126376_1175358523300010359Tropical Forest SoilVKVESDVEAIRINAEDFQQFLLAHPAVALSMMKQLVIRLREVEQRIDAWMA*
Ga0134121_1294291623300010401Terrestrial SoilALLAPGPRMATVKAQSHVEAIKIGAEDFQAFLLGRPPVALSMMKQLVVRLREVEQRIDAWMA*
Ga0105246_1182699533300011119Miscanthus RhizosphereGPVEALKIPADGFQTFLKAHPTVALSMLRAVVERLREVEQRIDAWMAS*
Ga0120114_110120513300011998PermafrostERPGRPPGGAPGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0137365_1034212213300012201Vadose Zone SoilPGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0150985_10179880443300012212Avena Fatua RhizosphereFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0137370_1036390323300012285Vadose Zone SoilEVFGEMAILAPGKRMATVRSVSAVAALRVPADGFQAFRLQHPAVGISIMKQLVLRLREVEQRIEAWMA*
Ga0137385_1135941713300012359Vadose Zone SoilRVPADAFQAFLLQHPAVGISIMKQLVVRLREVEQRIDAWMA*
Ga0134057_117490613300012396Grasslands SoilESDVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0134041_136851623300012405Grasslands SoilLLAPGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0134060_117916223300012410Grasslands SoilAEAFQDFLIDHPRVGLSIMKQLVIRLREVEQRIDAWMA*
Ga0150984_10396637823300012469Avena Fatua RhizosphereLLAPGPRMATVKAESDVDAVMIRADAFQAFLLAHPAIAVSMMKQLVIRLREVEQRIDAWMA*
Ga0157286_1033461413300012908SoilLLAPGPRMATVKAEEDVEAIKIGADEFQAFLLSHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0157306_1022659223300012912SoilATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA*
Ga0157298_1031569013300012913SoilEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0162652_10007528813300012941SoilMSGKAKCEMALISSRKRIATVRATEAVEALKIPADAFQSFLLAHPSVAVSMLKEIVDRLREVEQRIDAWMA*
Ga0164301_1039981413300012960SoilLAPGPRMATVKAESDVEAVMIHAEAFQSFLLEHPAVAVSMMKQLVIRLREVDQRIDAWMA
Ga0164308_1028172033300012985SoilRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA*
Ga0164304_1186159313300012986SoilEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0164306_1111088823300012988SoilMATVRTVSAVTALRVPADAFQAFLLQHPAVGISIMKQLVLRLREVEQRIEAWMA*
Ga0075305_100714433300014295Natural And Restored WetlandsSALRIPSERFEALLLDHPSVSVALLKALVLRLREVEQRIDAWMA*
Ga0075340_114242613300014304Natural And Restored WetlandsVSALRIPSERFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA*
Ga0075351_115467113300014318Natural And Restored WetlandsVRAEEDVEALRISEESFRAFLAERPGVALSMMKVLVLRLREVEQRIDAWMG*
Ga0075352_127410113300014324Natural And Restored WetlandsPRMATVKAETDVEAIRIEAESFQSFLLAHPAVSLSMMKQLVIRLREVEQRIDAWMA*
Ga0182001_1026409713300014488SoilIPADAFRTFLLDHPSVAVSTLEELVDRLREVEQRIDAWMAP*
Ga0120170_110934813300014823PermafrostMALITSKKRLATVKATSHVEALRIPADAFRSFLMEHPSVSLSMMKAIVERLREVEQRIDAWMAS*
Ga0134085_1045383433300015359Grasslands SoilDAFQAFLGEHPSVAIAMLRALVDRLREVEERIEAWMGSG*
Ga0132258_1042946963300015371Arabidopsis RhizosphereRMATVRTVSAVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRVEAWMA*
Ga0132258_1381196813300015371Arabidopsis RhizosphereVEALRIPADGFQAFLMDHPAVALAMLQAVIERLGEVQARIDAWMGA*
Ga0132256_10183208833300015372Arabidopsis RhizosphereATVKAVGPVEALKIPADGFQTFLKAHPTVALSMLRAVVERLREVEQRIDAWMAS*
Ga0132257_10409291623300015373Arabidopsis RhizosphereESDVEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA*
Ga0187779_1067000913300017959Tropical PeatlandTVKAVDAVEALRIPADGFNAFLLAHPPIAVAMLRAVVERLGEVQARIDAWMGNG
Ga0187776_1160583823300017966Tropical PeatlandFQAFLMKHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0187788_1003265643300018032Tropical PeatlandAFQAFLMEHPAVGLSMMKALVDRLREVEQRIDAWMAS
Ga0184617_110893623300018066Groundwater SedimentVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA
Ga0184635_1010519333300018072Groundwater SedimentEMAVLAPGKRMATVRADGEVEALRISAEGFQEFLIQRPRVALSMMKALVLRLREVEQRIDAWMA
Ga0187774_1101668513300018089Tropical PeatlandMATVTATEPVEALRIPADAFQAFLMEHPAVGLSMMKALVDRLREDEQRIDAWMAS
Ga0173481_1035654923300019356SoilVEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0173479_1034889133300019362SoilLRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN
Ga0193730_110985113300020002SoilMATVRTVSAVTALRVPADAFQAFLLQHPAVGISIMKQLVLRLREVEQRIEAWMA
Ga0193719_1026966413300021344SoilAPGKRMATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA
Ga0209640_1106002813300025324SoilKRMATVRAEGDVRALRISAEGFQGFLVQRPAVALSMMKALVLRLREVEQRIDAWMA
Ga0210061_101157813300025537Natural And Restored WetlandsTVTAVQPVRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS
Ga0210132_103247723300025538Natural And Restored WetlandsAESDVTAVKIGAEDFQAFLLAHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0207642_1077825213300025899Miscanthus RhizosphereVTALRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA
Ga0207643_1023211513300025908Miscanthus RhizospherePADGFQTFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS
Ga0207646_1114202113300025922Corn, Switchgrass And Miscanthus RhizosphereADAFRSFLMEHPSVSLSMMKAIVERLREVEQRIDAWMAS
Ga0207689_1046982313300025942Miscanthus RhizosphereEADVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0207668_1207223213300025972Switchgrass RhizosphereRMATVRTVSTVTALRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA
Ga0208284_101836933300026003Rice Paddy SoilRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS
Ga0208776_100331343300026014Rice Paddy SoilVRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS
Ga0207648_1006465733300026089Miscanthus RhizosphereKAESDVDAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0207683_1123158613300026121Miscanthus RhizosphereLVSAGKRMATVKAVEPVEALKIPADGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS
Ga0209236_110607433300026298Grasslands SoilAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA
Ga0209152_1037832323300026325SoilPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA
Ga0209266_127729223300026327SoilLLAPGKRMATVEAGTALSALRIPAEAFQDFLLDHPRAALSIMKQLVVRLREVEQRIDAWM
Ga0209808_112760023300026523SoilPGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA
Ga0209846_102446923300027277Groundwater SandLDSLLREHPEVGMFLLRTLVLRLREVEQRIDAWMAP
Ga0209874_100863333300027577Groundwater SandRADGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA
Ga0268264_1084893123300028381Switchgrass RhizosphereAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA
Ga0307291_104984823300028707SoilSTVTALRVPADAFQAFVLRHPAVGLSIMKQLVLRLREVEQRIEAWMA
Ga0307313_1025188523300028715SoilALITAGKRMATVKAVEHVEALKIPADEFQSFLLEHPGVALSMLKAIVERLREVEQRIDAWMAS
Ga0307301_1009685123300028719SoilLAPGKRMATVRADGEVQALRISAEGFQEFLIQRPRVALSMMKALVLRLREVEQRIDAWMA
Ga0307316_1035656623300028755SoilRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN
Ga0307503_1020015813300028802SoilEMALVSAGKRMATVKATSPVEALKIPADAFQDFLVAHPRCAILMMRALVDRLREVEQRIDAWMAN
Ga0307305_1051713713300028807SoilIAPGRRMATVKAVEPVQALRVPADDFQSFLLRHPTVALAMLKAIVLRLREVEQRIDAWMA
Ga0247824_1018669223300028809SoilMALIAPGKRMATVKAVTDVSALRIPSERFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA
Ga0307314_1016081913300028872SoilIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN
Ga0307300_1002162023300028880SoilLAPGPRMATVKAEEDVEAIKIGADEFQAFLLSHPAVAVSMMKQLVIRLREVEQRIDAWMA
Ga0307277_1008300413300028881SoilAVEALRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN
Ga0307277_1012353833300028881SoilALVAPGRRMATVRAVERVRVLKIPAEGFHGFLLEHPRVALAMLKTLAVRLREVEQRIDAWMAY
Ga0307308_1042324813300028884SoilLITAGKRMATVKAVEHVEALKIPADEFQSFLLEHPGVALSMLKAIVERLREVEQRLDAWMAS
Ga0247826_1017870833300030336SoilFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA
Ga0307499_1018371633300031184SoilAGKRMATVKAVGSVEALKIPADGFQTFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS
Ga0302321_10339414023300031726FenTVKAVDAVEALRIPADDFQSFLMEHPSLALSMLKAIVLRLREVEQRIDAWMA
Ga0315290_1158028623300031834SedimentIAPGKRMATVKAVTDVSALRIPAERFETFLLDHPSVSVALLRALVVRLREVEQRIDAWMA
Ga0307415_10241306823300032126RhizosphereALRIPADAFQAFVLEHPNVALSMMRTLVVRLREVEQRIDAWMA
Ga0307471_10214292023300032180Hardwood Forest SoilGKRMATVRTVSAVTALKVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA
Ga0307472_10134240823300032205Hardwood Forest SoilADAFQSFLLEHPAVALSMMKQLVIRLREVEQRIDAWMA
Ga0315286_1166348313300032342SedimentLRIPADAFQSFLLDHPRVAVSMLKALVVRLREVEQRIDAWMGT
Ga0315287_1125125423300032397SedimentERFETFLLDHPSVSVALLRALVVRLREVEQRIDAWMA
Ga0315275_1156661913300032401SedimentRIPADAFQSFLLDHPRVAVSMLKALVVRLREVEQRIDAWMGT
Ga0335081_1079294243300032892SoilRKRMATVRATATVEALRIPASEFQAFLLQHPGVALSMLKALVERLREVEERIDAWMA
Ga0314868_001126_2_1603300033758PeatlandVRATEPVETLRIPADAFQAFLMEHPAVGLSMMKALVDRLREVEQRIDAWMAS
Ga0326723_0549286_389_5323300034090Peat SoilGDVEALRIPAEAFQRFLLDHPSVAVAMLKQLVLRLREVEQRIDAWMA
Ga0370545_130405_437_5683300034643SoilLKIPADGFQTFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.