| Basic Information | |
|---|---|
| Family ID | F059936 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 51 residues |
| Representative Sequence | VEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.99 % |
| % of genes from short scaffolds (< 2000 bps) | 95.49 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.947 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.045 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.812 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF07969 | Amidohydro_3 | 7.52 |
| PF00313 | CSD | 6.77 |
| PF13464 | DUF4115 | 6.02 |
| PF05922 | Inhibitor_I9 | 6.02 |
| PF05222 | AlaDh_PNT_N | 5.26 |
| PF01596 | Methyltransf_3 | 1.50 |
| PF04978 | DUF664 | 1.50 |
| PF12697 | Abhydrolase_6 | 1.50 |
| PF00027 | cNMP_binding | 1.50 |
| PF01161 | PBP | 1.50 |
| PF01152 | Bac_globin | 0.75 |
| PF13240 | zinc_ribbon_2 | 0.75 |
| PF13416 | SBP_bac_8 | 0.75 |
| PF02371 | Transposase_20 | 0.75 |
| PF03404 | Mo-co_dimer | 0.75 |
| PF02579 | Nitro_FeMo-Co | 0.75 |
| PF00082 | Peptidase_S8 | 0.75 |
| PF01726 | LexA_DNA_bind | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1404 | Serine protease, subtilisin family | Posttranslational modification, protein turnover, chaperones [O] | 6.02 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.50 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.50 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.50 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 1.50 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.75 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.70 % |
| Unclassified | root | N/A | 20.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000881|JGI10215J12807_1080991 | Not Available | 814 | Open in IMG/M |
| 3300001205|C688J13580_1057288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300004058|Ga0055498_10100117 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300004058|Ga0055498_10121601 | Not Available | 548 | Open in IMG/M |
| 3300004156|Ga0062589_101407685 | Not Available | 680 | Open in IMG/M |
| 3300004463|Ga0063356_106054905 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300004798|Ga0058859_11472890 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005093|Ga0062594_101741166 | Not Available | 653 | Open in IMG/M |
| 3300005169|Ga0066810_10196627 | Not Available | 505 | Open in IMG/M |
| 3300005172|Ga0066683_10239052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300005179|Ga0066684_10691404 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005330|Ga0070690_101251371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300005334|Ga0068869_101827416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300005338|Ga0068868_100760880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
| 3300005345|Ga0070692_11276465 | Not Available | 526 | Open in IMG/M |
| 3300005365|Ga0070688_100042779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2788 | Open in IMG/M |
| 3300005441|Ga0070700_101060167 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005444|Ga0070694_100688323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 830 | Open in IMG/M |
| 3300005456|Ga0070678_100359138 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005457|Ga0070662_100197116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300005458|Ga0070681_12010319 | Not Available | 506 | Open in IMG/M |
| 3300005466|Ga0070685_10383750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300005536|Ga0070697_100956815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 761 | Open in IMG/M |
| 3300005615|Ga0070702_100208879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1298 | Open in IMG/M |
| 3300005718|Ga0068866_11466208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300005764|Ga0066903_100792970 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300005842|Ga0068858_100888943 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005885|Ga0075284_1062546 | Not Available | 538 | Open in IMG/M |
| 3300005886|Ga0075286_1006301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1354 | Open in IMG/M |
| 3300006034|Ga0066656_10442502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
| 3300006046|Ga0066652_100688541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 972 | Open in IMG/M |
| 3300006573|Ga0074055_11774529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300006794|Ga0066658_10645671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300006903|Ga0075426_10370101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1055 | Open in IMG/M |
| 3300009137|Ga0066709_103286100 | Not Available | 588 | Open in IMG/M |
| 3300009147|Ga0114129_12181823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300009153|Ga0105094_10904397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300009176|Ga0105242_11369046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300009176|Ga0105242_13195538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300009792|Ga0126374_11320316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300009806|Ga0105081_1033278 | Not Available | 692 | Open in IMG/M |
| 3300009807|Ga0105061_1059808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300009809|Ga0105089_1016990 | Not Available | 954 | Open in IMG/M |
| 3300009822|Ga0105066_1026798 | Not Available | 1157 | Open in IMG/M |
| 3300009837|Ga0105058_1094920 | Not Available | 697 | Open in IMG/M |
| 3300009837|Ga0105058_1177954 | Not Available | 525 | Open in IMG/M |
| 3300010042|Ga0126314_10650968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300010359|Ga0126376_11753585 | Not Available | 657 | Open in IMG/M |
| 3300010401|Ga0134121_12942916 | Not Available | 523 | Open in IMG/M |
| 3300011119|Ga0105246_11826995 | Not Available | 581 | Open in IMG/M |
| 3300011998|Ga0120114_1101205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300012201|Ga0137365_10342122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1106 | Open in IMG/M |
| 3300012212|Ga0150985_101798804 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300012285|Ga0137370_10363903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
| 3300012359|Ga0137385_11359417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300012396|Ga0134057_1174906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300012405|Ga0134041_1368516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300012410|Ga0134060_1179162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300012469|Ga0150984_103966378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 587 | Open in IMG/M |
| 3300012908|Ga0157286_10334614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300012912|Ga0157306_10226592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300012913|Ga0157298_10315690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300012941|Ga0162652_100075288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300012960|Ga0164301_10399814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 961 | Open in IMG/M |
| 3300012985|Ga0164308_10281720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1311 | Open in IMG/M |
| 3300012986|Ga0164304_11861593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300012988|Ga0164306_11110888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300014295|Ga0075305_1007144 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300014304|Ga0075340_1142426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300014318|Ga0075351_1154671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300014324|Ga0075352_1274101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300014488|Ga0182001_10264097 | Not Available | 674 | Open in IMG/M |
| 3300014823|Ga0120170_1109348 | Not Available | 555 | Open in IMG/M |
| 3300015359|Ga0134085_10453834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
| 3300015371|Ga0132258_10429469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3290 | Open in IMG/M |
| 3300015371|Ga0132258_13811968 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300015372|Ga0132256_101832088 | Not Available | 715 | Open in IMG/M |
| 3300015373|Ga0132257_104092916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300017959|Ga0187779_10670009 | Not Available | 699 | Open in IMG/M |
| 3300017966|Ga0187776_11605838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300018032|Ga0187788_10032656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1710 | Open in IMG/M |
| 3300018066|Ga0184617_1108936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300018072|Ga0184635_10105193 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300018089|Ga0187774_11016685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300019356|Ga0173481_10356549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300019362|Ga0173479_10348891 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300020002|Ga0193730_1109851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300021344|Ga0193719_10269664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300025324|Ga0209640_11060028 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025537|Ga0210061_1011578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1404 | Open in IMG/M |
| 3300025538|Ga0210132_1032477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
| 3300025899|Ga0207642_10778252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300025908|Ga0207643_10232115 | Not Available | 1132 | Open in IMG/M |
| 3300025922|Ga0207646_11142021 | Not Available | 685 | Open in IMG/M |
| 3300025942|Ga0207689_10469823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
| 3300025972|Ga0207668_12072232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300026003|Ga0208284_1018369 | Not Available | 574 | Open in IMG/M |
| 3300026014|Ga0208776_1003313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1355 | Open in IMG/M |
| 3300026089|Ga0207648_10064657 | All Organisms → cellular organisms → Bacteria | 3188 | Open in IMG/M |
| 3300026121|Ga0207683_11231586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300026298|Ga0209236_1106074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1258 | Open in IMG/M |
| 3300026325|Ga0209152_10378323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300026327|Ga0209266_1277292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300026523|Ga0209808_1127600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1030 | Open in IMG/M |
| 3300027277|Ga0209846_1024469 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 979 | Open in IMG/M |
| 3300027577|Ga0209874_1008633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3040 | Open in IMG/M |
| 3300028381|Ga0268264_10848931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 914 | Open in IMG/M |
| 3300028707|Ga0307291_1049848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1006 | Open in IMG/M |
| 3300028715|Ga0307313_10251885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300028719|Ga0307301_10096851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
| 3300028755|Ga0307316_10356566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 539 | Open in IMG/M |
| 3300028802|Ga0307503_10200158 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300028807|Ga0307305_10517137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300028809|Ga0247824_10186692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1129 | Open in IMG/M |
| 3300028872|Ga0307314_10160819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300028880|Ga0307300_10021620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1703 | Open in IMG/M |
| 3300028881|Ga0307277_10083004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
| 3300028881|Ga0307277_10123538 | Not Available | 1111 | Open in IMG/M |
| 3300028884|Ga0307308_10423248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300030336|Ga0247826_10178708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1430 | Open in IMG/M |
| 3300031184|Ga0307499_10183716 | Not Available | 634 | Open in IMG/M |
| 3300031726|Ga0302321_103394140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300031834|Ga0315290_11580286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300032126|Ga0307415_102413068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300032180|Ga0307471_102142920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300032205|Ga0307472_101342408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300032342|Ga0315286_11663483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300032397|Ga0315287_11251254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
| 3300032401|Ga0315275_11566619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300032892|Ga0335081_10792942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1133 | Open in IMG/M |
| 3300033758|Ga0314868_001126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2157 | Open in IMG/M |
| 3300034090|Ga0326723_0549286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300034643|Ga0370545_130405 | Not Available | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.77% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.01% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.01% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.01% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.26% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.26% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.75% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10215J12807_10809911 | 3300000881 | Soil | VEALKIPSDGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS* |
| C688J13580_10572881 | 3300001205 | Soil | LAPGPRMATVKAESDIDAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0055498_101001172 | 3300004058 | Natural And Restored Wetlands | VTDVSALRIPSERFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA* |
| Ga0055498_101216012 | 3300004058 | Natural And Restored Wetlands | RMATVKAVEPVEALKIPADGFQAFLQAHPAVTLSMLKAVVERLREVEQRIDAWMAS* |
| Ga0062589_1014076853 | 3300004156 | Soil | KRMATVKAVEPVEALKIPSDGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS* |
| Ga0063356_1060549052 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RATETVEALKIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN* |
| Ga0058859_114728902 | 3300004798 | Host-Associated | ATVKAADAVEALRIPGEGFRSFLLENPAVAVAILKAVVERLSEVQERIDAWMAN* |
| Ga0062594_1017411663 | 3300005093 | Soil | KAVEPVEALKIPADGFQAFLQAHPTVALSMLRAVVERLREVEQRIDAWMAS* |
| Ga0066810_101966272 | 3300005169 | Soil | LFTTGKRMATVKAVEPVRALTIPSEGFQSFLLEHPAVALSMLKAIVERLREVEQRIDAWMAS* |
| Ga0066683_102390521 | 3300005172 | Soil | LLAPGKRMATVEAGTALSALRIPAEAFQDFLLDHPRAALSIMKQLVVRLREVEQRIDAWMA* |
| Ga0066684_106914042 | 3300005179 | Soil | PVRALQIPATAFREFVLDHPSVALSMLGALVERLREVEQRIDAWMAG* |
| Ga0070690_1012513712 | 3300005330 | Switchgrass Rhizosphere | AALRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN* |
| Ga0068869_1018274162 | 3300005334 | Miscanthus Rhizosphere | PGPRMATVKAESDVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0068868_1007608802 | 3300005338 | Miscanthus Rhizosphere | MAILAPGKRMATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0070692_112764652 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IKIGAEDFQAFLLGRPPVALSMMKLLVVRLREVEQRIDAWMA* |
| Ga0070688_1000427791 | 3300005365 | Switchgrass Rhizosphere | RKRIATVRATEEVEALKIPADAFQSFLLGHPSVAVSMLKEIVDRLREVEQRIDAWMAN* |
| Ga0070700_1010601672 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | KAEADVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0070694_1006883231 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0070678_1003591382 | 3300005456 | Miscanthus Rhizosphere | MATVKAQSDVEAIKIGAEDFQAFLLGRPPVALSMMKQLVVRLREVEQRIDAWMA* |
| Ga0070662_1001971161 | 3300005457 | Corn Rhizosphere | RADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0070681_120103191 | 3300005458 | Corn Rhizosphere | MATVKAVEPVEALKIPSDGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS* |
| Ga0070685_103837501 | 3300005466 | Switchgrass Rhizosphere | GPRMATVKAEADVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0070697_1009568151 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TVSGVSALRVPADAFQAFLLQHPAVGISIMKQLVLRLREVEQRIEAWMA* |
| Ga0070702_1002088791 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EALKIPADGFQTFLKAHPAVALSMLRAVVERLREVEQRIDAWMAS* |
| Ga0068866_114662082 | 3300005718 | Miscanthus Rhizosphere | VTALRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA* |
| Ga0066903_1007929702 | 3300005764 | Tropical Forest Soil | SKRRSATVKAAQAVEALRIPADGFQAFLMEHPAVALAMLQAVVERLSEVQARIDAWMGNG |
| Ga0068858_1008889433 | 3300005842 | Switchgrass Rhizosphere | TVRATEEVAALRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN* |
| Ga0075284_10625461 | 3300005885 | Rice Paddy Soil | TVKAVQPVRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS* |
| Ga0075286_10063011 | 3300005886 | Rice Paddy Soil | VRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS* |
| Ga0066656_104425021 | 3300006034 | Soil | EMALLAPGKRMATVEAGTALSALRIPAEAFQDFLLDHPRAALSIMKQLVVRLREVEQRIDAWMA* |
| Ga0066652_1006885411 | 3300006046 | Soil | ALRVPAEAFQDFLVDHPRVGLSIMKQLVIRLREVEQRIDAWMA* |
| Ga0074055_117745292 | 3300006573 | Soil | ESDVEAVMIHADAFQSFLLGHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0066658_106456712 | 3300006794 | Soil | AVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0075426_103701011 | 3300006903 | Populus Rhizosphere | EAFQDFLLDHPRVALSIMKQLVIRLREVEQRIDAWMA* |
| Ga0066709_1032861001 | 3300009137 | Grasslands Soil | RAFLLEHSSVSVAMLEALVERLSEIQERIDAWMA* |
| Ga0114129_121818232 | 3300009147 | Populus Rhizosphere | VSAVSALRVPADGFQTFLLQHPAVGISIMKQLVIRLREVEQRIEAWMA* |
| Ga0105094_109043972 | 3300009153 | Freshwater Sediment | MATVRAVGDLETLRIPAEGFRTFILEHPTVALAMMKALVVRLREVEQRIDAWMA* |
| Ga0105242_113690462 | 3300009176 | Miscanthus Rhizosphere | LAPGPRMATVKAESDVEAVMIHAEAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0105242_131955381 | 3300009176 | Miscanthus Rhizosphere | LRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN* |
| Ga0126374_113203162 | 3300009792 | Tropical Forest Soil | GKRLATVETVTTLSALRVPAEAFQDFLLDHPRVALSIMKQLVIRLREVEQRIDAWMA* |
| Ga0105081_10332782 | 3300009806 | Groundwater Sand | MATVRADGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA* |
| Ga0105061_10598081 | 3300009807 | Groundwater Sand | LLAPGKRMATVRADGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA* |
| Ga0105089_10169901 | 3300009809 | Groundwater Sand | DGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA* |
| Ga0105066_10267982 | 3300009822 | Groundwater Sand | FQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA* |
| Ga0105058_10949201 | 3300009837 | Groundwater Sand | QEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA* |
| Ga0105058_11779542 | 3300009837 | Groundwater Sand | MATVKAVEPVEAIKIQAEDFRSFLLEHPSVALSMLKALVDRLREVEQRLDAWMAS* |
| Ga0126314_106509682 | 3300010042 | Serpentine Soil | EAIRIDADSFQSFLLAHPAVAVSMMKQLVVRLREVEQRIDAWMA* |
| Ga0126376_117535852 | 3300010359 | Tropical Forest Soil | VKVESDVEAIRINAEDFQQFLLAHPAVALSMMKQLVIRLREVEQRIDAWMA* |
| Ga0134121_129429162 | 3300010401 | Terrestrial Soil | ALLAPGPRMATVKAQSHVEAIKIGAEDFQAFLLGRPPVALSMMKQLVVRLREVEQRIDAWMA* |
| Ga0105246_118269953 | 3300011119 | Miscanthus Rhizosphere | GPVEALKIPADGFQTFLKAHPTVALSMLRAVVERLREVEQRIDAWMAS* |
| Ga0120114_11012051 | 3300011998 | Permafrost | ERPGRPPGGAPGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0137365_103421221 | 3300012201 | Vadose Zone Soil | PGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0150985_1017988044 | 3300012212 | Avena Fatua Rhizosphere | FQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0137370_103639032 | 3300012285 | Vadose Zone Soil | EVFGEMAILAPGKRMATVRSVSAVAALRVPADGFQAFRLQHPAVGISIMKQLVLRLREVEQRIEAWMA* |
| Ga0137385_113594171 | 3300012359 | Vadose Zone Soil | RVPADAFQAFLLQHPAVGISIMKQLVVRLREVEQRIDAWMA* |
| Ga0134057_11749061 | 3300012396 | Grasslands Soil | ESDVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0134041_13685162 | 3300012405 | Grasslands Soil | LLAPGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0134060_11791622 | 3300012410 | Grasslands Soil | AEAFQDFLIDHPRVGLSIMKQLVIRLREVEQRIDAWMA* |
| Ga0150984_1039663782 | 3300012469 | Avena Fatua Rhizosphere | LLAPGPRMATVKAESDVDAVMIRADAFQAFLLAHPAIAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0157286_103346141 | 3300012908 | Soil | LLAPGPRMATVKAEEDVEAIKIGADEFQAFLLSHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0157306_102265922 | 3300012912 | Soil | ATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA* |
| Ga0157298_103156901 | 3300012913 | Soil | EAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0162652_1000752881 | 3300012941 | Soil | MSGKAKCEMALISSRKRIATVRATEAVEALKIPADAFQSFLLAHPSVAVSMLKEIVDRLREVEQRIDAWMA* |
| Ga0164301_103998141 | 3300012960 | Soil | LAPGPRMATVKAESDVEAVMIHAEAFQSFLLEHPAVAVSMMKQLVIRLREVDQRIDAWMA |
| Ga0164308_102817203 | 3300012985 | Soil | RVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA* |
| Ga0164304_118615931 | 3300012986 | Soil | EAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0164306_111108882 | 3300012988 | Soil | MATVRTVSAVTALRVPADAFQAFLLQHPAVGISIMKQLVLRLREVEQRIEAWMA* |
| Ga0075305_10071443 | 3300014295 | Natural And Restored Wetlands | SALRIPSERFEALLLDHPSVSVALLKALVLRLREVEQRIDAWMA* |
| Ga0075340_11424261 | 3300014304 | Natural And Restored Wetlands | VSALRIPSERFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA* |
| Ga0075351_11546711 | 3300014318 | Natural And Restored Wetlands | VRAEEDVEALRISEESFRAFLAERPGVALSMMKVLVLRLREVEQRIDAWMG* |
| Ga0075352_12741011 | 3300014324 | Natural And Restored Wetlands | PRMATVKAETDVEAIRIEAESFQSFLLAHPAVSLSMMKQLVIRLREVEQRIDAWMA* |
| Ga0182001_102640971 | 3300014488 | Soil | IPADAFRTFLLDHPSVAVSTLEELVDRLREVEQRIDAWMAP* |
| Ga0120170_11093481 | 3300014823 | Permafrost | MALITSKKRLATVKATSHVEALRIPADAFRSFLMEHPSVSLSMMKAIVERLREVEQRIDAWMAS* |
| Ga0134085_104538343 | 3300015359 | Grasslands Soil | DAFQAFLGEHPSVAIAMLRALVDRLREVEERIEAWMGSG* |
| Ga0132258_104294696 | 3300015371 | Arabidopsis Rhizosphere | RMATVRTVSAVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRVEAWMA* |
| Ga0132258_138119681 | 3300015371 | Arabidopsis Rhizosphere | VEALRIPADGFQAFLMDHPAVALAMLQAVIERLGEVQARIDAWMGA* |
| Ga0132256_1018320883 | 3300015372 | Arabidopsis Rhizosphere | ATVKAVGPVEALKIPADGFQTFLKAHPTVALSMLRAVVERLREVEQRIDAWMAS* |
| Ga0132257_1040929162 | 3300015373 | Arabidopsis Rhizosphere | ESDVEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA* |
| Ga0187779_106700091 | 3300017959 | Tropical Peatland | TVKAVDAVEALRIPADGFNAFLLAHPPIAVAMLRAVVERLGEVQARIDAWMGNG |
| Ga0187776_116058382 | 3300017966 | Tropical Peatland | FQAFLMKHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0187788_100326564 | 3300018032 | Tropical Peatland | AFQAFLMEHPAVGLSMMKALVDRLREVEQRIDAWMAS |
| Ga0184617_11089362 | 3300018066 | Groundwater Sediment | VRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0184635_101051933 | 3300018072 | Groundwater Sediment | EMAVLAPGKRMATVRADGEVEALRISAEGFQEFLIQRPRVALSMMKALVLRLREVEQRIDAWMA |
| Ga0187774_110166851 | 3300018089 | Tropical Peatland | MATVTATEPVEALRIPADAFQAFLMEHPAVGLSMMKALVDRLREDEQRIDAWMAS |
| Ga0173481_103565492 | 3300019356 | Soil | VEAVMIHADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0173479_103488913 | 3300019362 | Soil | LRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN |
| Ga0193730_11098511 | 3300020002 | Soil | MATVRTVSAVTALRVPADAFQAFLLQHPAVGISIMKQLVLRLREVEQRIEAWMA |
| Ga0193719_102696641 | 3300021344 | Soil | APGKRMATVRTVSTVTALRVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0209640_110600281 | 3300025324 | Soil | KRMATVRAEGDVRALRISAEGFQGFLVQRPAVALSMMKALVLRLREVEQRIDAWMA |
| Ga0210061_10115781 | 3300025537 | Natural And Restored Wetlands | TVTAVQPVRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS |
| Ga0210132_10324772 | 3300025538 | Natural And Restored Wetlands | AESDVTAVKIGAEDFQAFLLAHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0207642_107782521 | 3300025899 | Miscanthus Rhizosphere | VTALRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA |
| Ga0207643_102321151 | 3300025908 | Miscanthus Rhizosphere | PADGFQTFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS |
| Ga0207646_111420211 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ADAFRSFLMEHPSVSLSMMKAIVERLREVEQRIDAWMAS |
| Ga0207689_104698231 | 3300025942 | Miscanthus Rhizosphere | EADVEAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0207668_120722321 | 3300025972 | Switchgrass Rhizosphere | RMATVRTVSTVTALRVPADAFQAFLLEHPAVGLSIMKQLVLRLREVEQRVEAWMA |
| Ga0208284_10183693 | 3300026003 | Rice Paddy Soil | RAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS |
| Ga0208776_10033134 | 3300026014 | Rice Paddy Soil | VRALKIPADAFRAFVLEHPAVALSMLQAVVERLREVEQRIDAWMAS |
| Ga0207648_100646573 | 3300026089 | Miscanthus Rhizosphere | KAESDVDAVMIRADAFQSFLLEHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0207683_112315861 | 3300026121 | Miscanthus Rhizosphere | LVSAGKRMATVKAVEPVEALKIPADGFQAFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS |
| Ga0209236_11060743 | 3300026298 | Grasslands Soil | AVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0209152_103783232 | 3300026325 | Soil | PADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0209266_12772922 | 3300026327 | Soil | LLAPGKRMATVEAGTALSALRIPAEAFQDFLLDHPRAALSIMKQLVVRLREVEQRIDAWM |
| Ga0209808_11276002 | 3300026523 | Soil | PGKRMATVRAVSTVAALRVPADAFQAFLLQHPGVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0209846_10244692 | 3300027277 | Groundwater Sand | LDSLLREHPEVGMFLLRTLVLRLREVEQRIDAWMAP |
| Ga0209874_10086333 | 3300027577 | Groundwater Sand | RADGDVQALRISAERFQEFLVQRPRVALSMMKALVLRLREVEQRIDAWMA |
| Ga0268264_108489312 | 3300028381 | Switchgrass Rhizosphere | AFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0307291_10498482 | 3300028707 | Soil | STVTALRVPADAFQAFVLRHPAVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0307313_102518852 | 3300028715 | Soil | ALITAGKRMATVKAVEHVEALKIPADEFQSFLLEHPGVALSMLKAIVERLREVEQRIDAWMAS |
| Ga0307301_100968512 | 3300028719 | Soil | LAPGKRMATVRADGEVQALRISAEGFQEFLIQRPRVALSMMKALVLRLREVEQRIDAWMA |
| Ga0307316_103565662 | 3300028755 | Soil | RIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN |
| Ga0307503_102001581 | 3300028802 | Soil | EMALVSAGKRMATVKATSPVEALKIPADAFQDFLVAHPRCAILMMRALVDRLREVEQRIDAWMAN |
| Ga0307305_105171371 | 3300028807 | Soil | IAPGRRMATVKAVEPVQALRVPADDFQSFLLRHPTVALAMLKAIVLRLREVEQRIDAWMA |
| Ga0247824_101866922 | 3300028809 | Soil | MALIAPGKRMATVKAVTDVSALRIPSERFEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA |
| Ga0307314_101608191 | 3300028872 | Soil | IPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN |
| Ga0307300_100216202 | 3300028880 | Soil | LAPGPRMATVKAEEDVEAIKIGADEFQAFLLSHPAVAVSMMKQLVIRLREVEQRIDAWMA |
| Ga0307277_100830041 | 3300028881 | Soil | AVEALRIPADAFQSFLLEHPSVAVSMLKEIVDRLREVEQRIDAWMAN |
| Ga0307277_101235383 | 3300028881 | Soil | ALVAPGRRMATVRAVERVRVLKIPAEGFHGFLLEHPRVALAMLKTLAVRLREVEQRIDAWMAY |
| Ga0307308_104232481 | 3300028884 | Soil | LITAGKRMATVKAVEHVEALKIPADEFQSFLLEHPGVALSMLKAIVERLREVEQRLDAWMAS |
| Ga0247826_101787083 | 3300030336 | Soil | FEAFLLDHPSVSVALLKALVLRLREVEQRIDAWMA |
| Ga0307499_101837163 | 3300031184 | Soil | AGKRMATVKAVGSVEALKIPADGFQTFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS |
| Ga0302321_1033941402 | 3300031726 | Fen | TVKAVDAVEALRIPADDFQSFLMEHPSLALSMLKAIVLRLREVEQRIDAWMA |
| Ga0315290_115802862 | 3300031834 | Sediment | IAPGKRMATVKAVTDVSALRIPAERFETFLLDHPSVSVALLRALVVRLREVEQRIDAWMA |
| Ga0307415_1024130682 | 3300032126 | Rhizosphere | ALRIPADAFQAFVLEHPNVALSMMRTLVVRLREVEQRIDAWMA |
| Ga0307471_1021429202 | 3300032180 | Hardwood Forest Soil | GKRMATVRTVSAVTALKVPADAFQAFLLQHPAVGLSIMKQLVLRLREVEQRIEAWMA |
| Ga0307472_1013424082 | 3300032205 | Hardwood Forest Soil | ADAFQSFLLEHPAVALSMMKQLVIRLREVEQRIDAWMA |
| Ga0315286_116634831 | 3300032342 | Sediment | LRIPADAFQSFLLDHPRVAVSMLKALVVRLREVEQRIDAWMGT |
| Ga0315287_112512542 | 3300032397 | Sediment | ERFETFLLDHPSVSVALLRALVVRLREVEQRIDAWMA |
| Ga0315275_115666191 | 3300032401 | Sediment | RIPADAFQSFLLDHPRVAVSMLKALVVRLREVEQRIDAWMGT |
| Ga0335081_107929424 | 3300032892 | Soil | RKRMATVRATATVEALRIPASEFQAFLLQHPGVALSMLKALVERLREVEERIDAWMA |
| Ga0314868_001126_2_160 | 3300033758 | Peatland | VRATEPVETLRIPADAFQAFLMEHPAVGLSMMKALVDRLREVEQRIDAWMAS |
| Ga0326723_0549286_389_532 | 3300034090 | Peat Soil | GDVEALRIPAEAFQRFLLDHPSVAVAMLKQLVLRLREVEQRIDAWMA |
| Ga0370545_130405_437_568 | 3300034643 | Soil | LKIPADGFQTFLQAHPAVALSMLRAVVERLREVEQRIDAWMAS |
| ⦗Top⦘ |