| Basic Information | |
|---|---|
| Family ID | F059931 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAK |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.44 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 94.74 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.414 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.887 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13578 | Methyltransf_24 | 20.30 |
| PF00857 | Isochorismatase | 9.02 |
| PF02749 | QRPTase_N | 2.26 |
| PF00583 | Acetyltransf_1 | 2.26 |
| PF07136 | DUF1385 | 0.75 |
| PF07690 | MFS_1 | 0.75 |
| PF00004 | AAA | 0.75 |
| PF05496 | RuvB_N | 0.75 |
| PF01729 | QRPTase_C | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 9.02 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 9.02 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 3.01 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 3.01 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.75 |
| COG3872 | Uncharacterized conserved protein YqhQ, DUF1385 family | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.41 % |
| Unclassified | root | N/A | 34.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1230204 | Not Available | 580 | Open in IMG/M |
| 3300000890|JGI11643J12802_10859585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300000891|JGI10214J12806_11585500 | Not Available | 568 | Open in IMG/M |
| 3300000956|JGI10216J12902_112473987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300001333|A21PFW6_1058784 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300001536|A1565W1_10130812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300002568|C688J35102_120629059 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300004081|Ga0063454_100218128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1105 | Open in IMG/M |
| 3300004081|Ga0063454_101228729 | Not Available | 622 | Open in IMG/M |
| 3300004156|Ga0062589_102337296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300005175|Ga0066673_10744314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300005176|Ga0066679_10663599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
| 3300005294|Ga0065705_10023877 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| 3300005294|Ga0065705_10066423 | Not Available | 758 | Open in IMG/M |
| 3300005329|Ga0070683_100456194 | Not Available | 1220 | Open in IMG/M |
| 3300005332|Ga0066388_104348957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300005364|Ga0070673_100037777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3682 | Open in IMG/M |
| 3300005364|Ga0070673_101056225 | Not Available | 758 | Open in IMG/M |
| 3300005438|Ga0070701_10471544 | Not Available | 809 | Open in IMG/M |
| 3300005439|Ga0070711_100991222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
| 3300005440|Ga0070705_101916119 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005441|Ga0070700_100680106 | Not Available | 816 | Open in IMG/M |
| 3300005467|Ga0070706_101737257 | Not Available | 568 | Open in IMG/M |
| 3300005535|Ga0070684_101726223 | Not Available | 591 | Open in IMG/M |
| 3300005540|Ga0066697_10163249 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300005549|Ga0070704_100173009 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300005552|Ga0066701_10705706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300005554|Ga0066661_10277319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1035 | Open in IMG/M |
| 3300005576|Ga0066708_10629574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
| 3300006028|Ga0070717_10024886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4756 | Open in IMG/M |
| 3300006577|Ga0074050_12048028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300006791|Ga0066653_10601114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
| 3300006794|Ga0066658_10804596 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006797|Ga0066659_10240836 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300006797|Ga0066659_11916999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300006804|Ga0079221_11751238 | Not Available | 508 | Open in IMG/M |
| 3300006844|Ga0075428_100081472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3532 | Open in IMG/M |
| 3300006854|Ga0075425_101441291 | Not Available | 779 | Open in IMG/M |
| 3300006854|Ga0075425_101799170 | Not Available | 688 | Open in IMG/M |
| 3300006903|Ga0075426_10031690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 3780 | Open in IMG/M |
| 3300009101|Ga0105247_10311689 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300009148|Ga0105243_10153216 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300009156|Ga0111538_11549666 | Not Available | 835 | Open in IMG/M |
| 3300009162|Ga0075423_12519141 | Not Available | 562 | Open in IMG/M |
| 3300009174|Ga0105241_10811844 | Not Available | 862 | Open in IMG/M |
| 3300010046|Ga0126384_12079436 | Not Available | 544 | Open in IMG/M |
| 3300010320|Ga0134109_10470167 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010322|Ga0134084_10271225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300010333|Ga0134080_10346760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300010333|Ga0134080_10495788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300010362|Ga0126377_13020466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300010364|Ga0134066_10252415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300012198|Ga0137364_10967812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300012199|Ga0137383_11205040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300012208|Ga0137376_10204179 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300012208|Ga0137376_10616519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 938 | Open in IMG/M |
| 3300012285|Ga0137370_10552196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300012481|Ga0157320_1029101 | Not Available | 548 | Open in IMG/M |
| 3300012582|Ga0137358_10576604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 755 | Open in IMG/M |
| 3300012957|Ga0164303_10195260 | Not Available | 1115 | Open in IMG/M |
| 3300012984|Ga0164309_11110009 | Not Available | 658 | Open in IMG/M |
| 3300012988|Ga0164306_10355442 | Not Available | 1087 | Open in IMG/M |
| 3300012989|Ga0164305_11336499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300013096|Ga0157307_1186622 | Not Available | 506 | Open in IMG/M |
| 3300013308|Ga0157375_10243665 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300013770|Ga0120123_1119542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300014166|Ga0134079_10360220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
| 3300014488|Ga0182001_10281994 | Not Available | 661 | Open in IMG/M |
| 3300014497|Ga0182008_10636804 | Not Available | 602 | Open in IMG/M |
| 3300015077|Ga0173483_10043590 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300015077|Ga0173483_10917492 | Not Available | 517 | Open in IMG/M |
| 3300015371|Ga0132258_13933730 | Not Available | 1009 | Open in IMG/M |
| 3300015372|Ga0132256_101724840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
| 3300017654|Ga0134069_1162782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
| 3300017792|Ga0163161_12026436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300018028|Ga0184608_10124777 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300019362|Ga0173479_10767000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300020004|Ga0193755_1234501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300020012|Ga0193732_1036513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300020022|Ga0193733_1057264 | Not Available | 1098 | Open in IMG/M |
| 3300021078|Ga0210381_10069493 | Not Available | 1095 | Open in IMG/M |
| 3300021080|Ga0210382_10455638 | Not Available | 567 | Open in IMG/M |
| 3300021445|Ga0182009_10086467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
| 3300022756|Ga0222622_10459893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300022756|Ga0222622_10863442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
| 3300024055|Ga0247794_10002003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4051 | Open in IMG/M |
| 3300024245|Ga0247677_1009160 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300025919|Ga0207657_10990079 | Not Available | 645 | Open in IMG/M |
| 3300025944|Ga0207661_10321919 | Not Available | 1390 | Open in IMG/M |
| 3300025944|Ga0207661_10389555 | Not Available | 1262 | Open in IMG/M |
| 3300026023|Ga0207677_11565415 | Not Available | 610 | Open in IMG/M |
| 3300026067|Ga0207678_11813051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300026078|Ga0207702_10684121 | Not Available | 1010 | Open in IMG/M |
| 3300026325|Ga0209152_10404946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300026528|Ga0209378_1111894 | Not Available | 1188 | Open in IMG/M |
| 3300026538|Ga0209056_10678693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300026542|Ga0209805_1342695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300026542|Ga0209805_1450163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300026547|Ga0209156_10444755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300026663|Ga0207532_100194 | Not Available | 794 | Open in IMG/M |
| 3300027748|Ga0209689_1430650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300027765|Ga0209073_10310594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
| 3300028380|Ga0268265_11977014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300028707|Ga0307291_1020632 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300028708|Ga0307295_10158787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300028713|Ga0307303_10118347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 618 | Open in IMG/M |
| 3300028718|Ga0307307_10107597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300028718|Ga0307307_10217319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300028720|Ga0307317_10056645 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300028721|Ga0307315_10109791 | Not Available | 817 | Open in IMG/M |
| 3300028722|Ga0307319_10267318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300028755|Ga0307316_10226392 | Not Available | 677 | Open in IMG/M |
| 3300028784|Ga0307282_10217425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300028791|Ga0307290_10069176 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300028791|Ga0307290_10089706 | Not Available | 1119 | Open in IMG/M |
| 3300028793|Ga0307299_10089178 | Not Available | 1149 | Open in IMG/M |
| 3300028799|Ga0307284_10088332 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300028811|Ga0307292_10370581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300028812|Ga0247825_10232919 | Not Available | 1278 | Open in IMG/M |
| 3300028824|Ga0307310_10413837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300028828|Ga0307312_11087356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300028875|Ga0307289_10082768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
| 3300028884|Ga0307308_10015249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3478 | Open in IMG/M |
| 3300028884|Ga0307308_10647678 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300030511|Ga0268241_10094124 | Not Available | 689 | Open in IMG/M |
| 3300031720|Ga0307469_11453755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300032003|Ga0310897_10443362 | Not Available | 621 | Open in IMG/M |
| 3300032017|Ga0310899_10222880 | Not Available | 845 | Open in IMG/M |
| 3300032174|Ga0307470_10260400 | Not Available | 1152 | Open in IMG/M |
| 3300032174|Ga0307470_11229871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
| 3300032205|Ga0307472_102430912 | Not Available | 532 | Open in IMG/M |
| 3300032770|Ga0335085_10418570 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300034818|Ga0373950_0031147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 988 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.01% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.01% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.01% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026663 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_01580700 | 2124908045 | Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTI |
| JGI11643J12802_108595851 | 3300000890 | Soil | MHWLITFRNGASDWLPLLFALLLILMVYVLWRTLEVMPRVTA |
| JGI10214J12806_115855002 | 3300000891 | Soil | MGNALVFIRDGIAAWLPLFFAVLLILMVYILWRTLQVMPRV |
| JGI10216J12902_1124739872 | 3300000956 | Soil | MDWLVVLRDEVAAWLPLLFAILLVLMVYILWRTLQVMPRV |
| A21PFW6_10587841 | 3300001333 | Permafrost | MDWLVFLRDGVANWLPLFFAILLVMMVYILWRTLQVMPRVTAAK |
| A1565W1_101308121 | 3300001536 | Permafrost | MDWLVFFRDGIAAWLPLFFAILLIFMVYILWRTLQVMPRVTAAKTTVAS |
| C688J35102_1206290591 | 3300002568 | Soil | MGDWLVFFRDGIAAWLPLFFAVLLILMVYILWRTLQVMPR |
| Ga0063454_1002181281 | 3300004081 | Soil | MHWLITLRDGASDWLPLLFAGLLVMMVYVLWRTLQVMPRVTAAKTVTSNSK |
| Ga0063454_1012287292 | 3300004081 | Soil | MGWLIYLRDGIADWLPLFFAILLVLMVYILWRTLQVMPRV |
| Ga0062589_1023372962 | 3300004156 | Soil | MDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVKAARTIVGT |
| Ga0066673_107443141 | 3300005175 | Soil | MGMGFHWLVTVRDASAAWLPLLFAVMLLAMLYVLWRTLEVMPRVTAAKTISTK |
| Ga0066679_106635992 | 3300005176 | Soil | MHWLITFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTAAKTISSKSR |
| Ga0065705_100238774 | 3300005294 | Switchgrass Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSD |
| Ga0065705_100664232 | 3300005294 | Switchgrass Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDSNVSW |
| Ga0070683_1004561941 | 3300005329 | Corn Rhizosphere | MGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRV |
| Ga0066388_1043489572 | 3300005332 | Tropical Forest Soil | MHWLISLRDASAAWLPLLFAVMLLAMLYVLWRTLEVMPRVTAAKTVSTRTRVTWSDVAGLEE |
| Ga0070673_1000377771 | 3300005364 | Switchgrass Rhizosphere | MDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVT |
| Ga0070673_1010562251 | 3300005364 | Switchgrass Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAA |
| Ga0070701_104715441 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDANVSWDDV |
| Ga0070711_1009912221 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MHWLITFRNGTSDWLPLLFAVLLIMMVYVLWRTLQVMPRV |
| Ga0070705_1019161191 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRV |
| Ga0070700_1006801061 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPR |
| Ga0070706_1017372571 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTI |
| Ga0070684_1017262232 | 3300005535 | Corn Rhizosphere | MGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAAKTI |
| Ga0066697_101632493 | 3300005540 | Soil | MDWLIVLRDEVANWLPLLFAILLIFMVYILWRTLQVMP |
| Ga0070704_1001730093 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MHWLITVRNGASDWLPLLFAFLLILMVYVLWRTLQVMPRVTAAKT |
| Ga0066701_107057061 | 3300005552 | Soil | MDWLVVFRDEFANWLPLVFTVVLILMVYILWRTLQVMPRVTAAKTVVGKSSVT |
| Ga0066661_102773191 | 3300005554 | Soil | MHWLITFRNGTSDWLPLLFAVLLVMMVYVLWRTLQVMPRVT |
| Ga0066708_106295742 | 3300005576 | Soil | MGWLVTLRDGTAAWLPLLFAVMLMAMLYVLWRTLEVMPR |
| Ga0070717_100248861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTA |
| Ga0074050_120480282 | 3300006577 | Soil | MDWLVVLRDEIANWLPLLFAVMLFLMVYILWRTLQVMPRV |
| Ga0066653_106011141 | 3300006791 | Soil | MGMHSLITFRDGASDWLPLLLALLLIVMVYVLWRTLQVMPRVTAA |
| Ga0066658_108045962 | 3300006794 | Soil | MDWLVVFRDEFANWLPLLFAVLLIMMVYILWRTLQVMPRVTAAKTIT |
| Ga0066659_102408363 | 3300006797 | Soil | MDWLITFLNVAFDWLLLLFAFLLILMVHVLWPTLHVMPRVTAAQT |
| Ga0066659_119169991 | 3300006797 | Soil | MDWLVFFRDGVAAWLPLFFAILLVLMVYILWRTLQVM |
| Ga0079221_117512381 | 3300006804 | Agricultural Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTIT |
| Ga0075428_1000814725 | 3300006844 | Populus Rhizosphere | MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPR |
| Ga0075425_1014412912 | 3300006854 | Populus Rhizosphere | MGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPR |
| Ga0075425_1017991702 | 3300006854 | Populus Rhizosphere | MGDVLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQV |
| Ga0075426_100316906 | 3300006903 | Populus Rhizosphere | MDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTAPKTVTSDS |
| Ga0105247_103116892 | 3300009101 | Switchgrass Rhizosphere | MGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTASKTITSDARV |
| Ga0105243_101532163 | 3300009148 | Miscanthus Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAK |
| Ga0111538_115496662 | 3300009156 | Populus Rhizosphere | MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDSNV |
| Ga0075423_125191412 | 3300009162 | Populus Rhizosphere | MDWLVVFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPR |
| Ga0105241_108118442 | 3300009174 | Corn Rhizosphere | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAA |
| Ga0126384_120794361 | 3300010046 | Tropical Forest Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDSRVSW |
| Ga0134109_104701671 | 3300010320 | Grasslands Soil | MGMGWLIAFRNGASDWLPLLFAALLIMMVYVLWRTLQVMPRVTGAKTVTSTTKVSW |
| Ga0134084_102712251 | 3300010322 | Grasslands Soil | MDWLVFFRDGVAAWLPLFFAILLVLMVYILWRTLQV |
| Ga0134080_103467601 | 3300010333 | Grasslands Soil | MDWLVVFRDEVAAWLPLLFAILLVLMVYILWRTLQVMPRVTA |
| Ga0134080_104957882 | 3300010333 | Grasslands Soil | MDWLVVLRDEVAAWLPLLFAILLVLMVYILWRTLQVMPRVT |
| Ga0126377_130204661 | 3300010362 | Tropical Forest Soil | MDWLVVLRDEVANWLPLLFAILLVFMVYILWRTLQVM |
| Ga0134066_102524151 | 3300010364 | Grasslands Soil | MDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQVMPRVTAAKTITASANV |
| Ga0137364_109678122 | 3300012198 | Vadose Zone Soil | MGMHWLITFRGGASDWLPLRLALLLIVMVYVLWRTL |
| Ga0137383_112050402 | 3300012199 | Vadose Zone Soil | MTWLVVLRDEVANWLPLLFAVLLVLMVYILWRTLQVMPRVT |
| Ga0137376_102041794 | 3300012208 | Vadose Zone Soil | MDWLVVFRDEFANWLPLLFAVLLIMMVYILWRTLQVMPRVTAAK |
| Ga0137376_106165192 | 3300012208 | Vadose Zone Soil | MHWLITFRNGTSDWLPLLFAVLLVMMVYVLWRTLQVMPRVTAAKTVTSNSRVTWSDV |
| Ga0137370_105521962 | 3300012285 | Vadose Zone Soil | MDWLVVLRDEVANWLPLLFAILLIFMVYILWRTLQVMPRVTAAKTIVA |
| Ga0157320_10291012 | 3300012481 | Arabidopsis Rhizosphere | MGDLLVFIRDGIAAWLPLFFAVLLVLMVYILWRTLQVMP |
| Ga0137358_105766042 | 3300012582 | Vadose Zone Soil | MHWLITFRNGTSDWLPLLFAVLLVMMVYVLWRTLQVMPRVTAAKTVTSNSRV |
| Ga0164303_101952602 | 3300012957 | Soil | MGTWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRV |
| Ga0164309_111100092 | 3300012984 | Soil | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTA |
| Ga0164306_103554422 | 3300012988 | Soil | MGTWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAAKTITSDSKVSWD |
| Ga0164305_113364992 | 3300012989 | Soil | MGWLIVFRDEFANWLPLLFGILLTLMVYILWRTLQVMPKVTAAKTITAS |
| Ga0157307_11866222 | 3300013096 | Soil | MGDWLVFLRDGIAAWLPLFFAVLLVLMVYILWRTL |
| Ga0157375_102436653 | 3300013308 | Miscanthus Rhizosphere | MGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAA |
| Ga0120123_11195421 | 3300013770 | Permafrost | MDWLVFLRDGVANWLPLFFAILLVMMVYILWRTLQVMPRVTSAADHITIG* |
| Ga0134079_103602201 | 3300014166 | Grasslands Soil | MGMHSLITFRDGASDWLPLLFAALLIMMVYVLWRTLQVMPR |
| Ga0182001_102819941 | 3300014488 | Soil | MHWLVTFRDAAAAWLPLLFAILLILMVYVLWRTLQVMPRVTAAKTVTSTSPVAWSDVA |
| Ga0182008_106368041 | 3300014497 | Rhizosphere | MNWLVAFRDAAAAWLPLLFAILLILMVYVLWRTLQVMPRVTAAKTVTSTSPVSWSD |
| Ga0173483_100435901 | 3300015077 | Soil | MDWLVVFRDGIAAWLPLFFAVLLIMMVYILWRTLQVMPRVKAARTIVGT |
| Ga0173483_109174922 | 3300015077 | Soil | MGDWLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMP |
| Ga0132258_139337301 | 3300015371 | Arabidopsis Rhizosphere | MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTA |
| Ga0132256_1017248402 | 3300015372 | Arabidopsis Rhizosphere | MHWLITLRDGTAAWLPLLFAVMLMAMLYVLWRTLEVMPRVTAAKTISTKSKVTWTDVAGL |
| Ga0134069_11627821 | 3300017654 | Grasslands Soil | MGWLVTLRDGTAAWLPLLFAVMLMAMLYVLWRTLEVRRRVTAAKTISTK |
| Ga0163161_120264362 | 3300017792 | Switchgrass Rhizosphere | MDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVMPKVTAAKT |
| Ga0184608_101247771 | 3300018028 | Groundwater Sediment | MEWLVVLRDEIAAWLPLFFVVLLVLMTYILWRTLQVMP |
| Ga0173479_107670001 | 3300019362 | Soil | MDWLVVLRDEFANWLPLLFAVMLILMVYILWRTLQVMPKVTAAKT |
| Ga0193755_12345011 | 3300020004 | Soil | MHWLITFRNGASDWLPLLFAVLLILMVYVLYRTLQVMPRVTAAKTVTSNSRVTWADVAGLQEAK |
| Ga0193732_10365131 | 3300020012 | Soil | LITFRNGAADWLPLLFALLLILMVYVLWRTLQVMPRVTA |
| Ga0193733_10572642 | 3300020022 | Soil | MHWLITFRNGTSDWLPLLFAVLLIMMVYVLWRTLQVMP |
| Ga0210381_100694931 | 3300021078 | Groundwater Sediment | MGMNWLITFRDGASDWLPLLFALLLILMVYVLWRT |
| Ga0210382_104556381 | 3300021080 | Groundwater Sediment | MDWLVFFRDGVANWLPLFFAVLLVLMVYILWRTLQVMPRVSA |
| Ga0182009_100864671 | 3300021445 | Soil | MDWLVVFRDEFANWLPLLFAVMLILMVYILWRTLQVMPKVTAAKTITS |
| Ga0222622_104598931 | 3300022756 | Groundwater Sediment | MDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVM |
| Ga0222622_108634422 | 3300022756 | Groundwater Sediment | MDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVMPKVTAAKTITASSK |
| Ga0247794_100020036 | 3300024055 | Soil | MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDARVSWDD |
| Ga0247677_10091601 | 3300024245 | Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMP |
| Ga0207657_109900791 | 3300025919 | Corn Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDARVSW |
| Ga0207661_103219191 | 3300025944 | Corn Rhizosphere | MGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAAKTITSDARVSWDDVA |
| Ga0207661_103895551 | 3300025944 | Corn Rhizosphere | MGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTASKTITS |
| Ga0207677_115654151 | 3300026023 | Miscanthus Rhizosphere | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAK |
| Ga0207678_118130511 | 3300026067 | Corn Rhizosphere | MDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTASQTI |
| Ga0207702_106841211 | 3300026078 | Corn Rhizosphere | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDARV |
| Ga0209152_104049461 | 3300026325 | Soil | MDWLVVFRDEFANWLPLLFAALLIMMVYILWRTLQVMPRVTAAKTISSDSTVS |
| Ga0209378_11118942 | 3300026528 | Soil | MHWLITFRDGASDWLPLLLALLLIVMVYVLWRTLQVMPRVTAAK |
| Ga0209056_106786931 | 3300026538 | Soil | MDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQVM |
| Ga0209805_13426952 | 3300026542 | Soil | MAWLVVLRDEVAAWLPLLFALLLILMVYILWRTLQVMPRVTAAKT |
| Ga0209805_14501632 | 3300026542 | Soil | MHWLIAFRNGTSDWLPLLFAVLLILMVYVLYRTLQVMPRVTAAKTVTSNTKVTWADVAGLEE |
| Ga0209156_104447551 | 3300026547 | Soil | MDWLIVLRDEVANWLPLLFAILLIFMVYILWRTLQVMPRVTAAKTIVADS |
| Ga0207532_1001942 | 3300026663 | Soil | MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQ |
| Ga0209689_14306502 | 3300027748 | Soil | MTWLVVLRDEVANWLPLLFAVLLVLMVYILWRTLQVMPR |
| Ga0209073_103105942 | 3300027765 | Agricultural Soil | MDWLFWFRNGVADWLPVLLAALLVMMVYILWRTLQV |
| Ga0268265_119770142 | 3300028380 | Switchgrass Rhizosphere | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVSAAKTIVATSTVSWD |
| Ga0307291_10206323 | 3300028707 | Soil | MGDVLVFIRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTGAK |
| Ga0307295_101587871 | 3300028708 | Soil | MDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVMPKVTAAKTITSS |
| Ga0307303_101183472 | 3300028713 | Soil | MGWLIAFRDGASDWLPILFALLLILMVYVLWRTLEVMPRVTAAKMVTGNSRVTWGD |
| Ga0307307_101075971 | 3300028718 | Soil | MHWLITFRNGASDWLPLLFAVLLILMVYVLYRTLQVMPRGTAAKT |
| Ga0307307_102173191 | 3300028718 | Soil | MGWLIAFRDGASDWLPILFALLLILMVYVLWRTLEVMPRVT |
| Ga0307317_100566453 | 3300028720 | Soil | MDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQVMPKVTAAKTISPKSTDRKS |
| Ga0307315_101097912 | 3300028721 | Soil | MDWLVFFRDGVANWLPLFFAVLLVLMVYILWRTLQVMPRVSAAKTITA |
| Ga0307319_102673181 | 3300028722 | Soil | LITFRNGAADWLPLLFALLLILMVYVLWRTLQVMPRVTAA |
| Ga0307316_102263922 | 3300028755 | Soil | MGDALVFIRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVKAARTLTSDSNVSW |
| Ga0307282_102174251 | 3300028784 | Soil | MGWLIAFRDGASDWLPILFALLLILMVYVLWRTLEVMPRVTAAKT |
| Ga0307290_100691761 | 3300028791 | Soil | MEWLVVLRDEIAAWLPLFFVILLVLMTYILWRTLQVM |
| Ga0307290_100897061 | 3300028791 | Soil | MGMHWLITFRDGASDWLPLLFALLLILMVYVLWRTLQVMPRVTAAKTVTSNTKVTWA |
| Ga0307299_100891782 | 3300028793 | Soil | MGMHWLITFRDGASDWLPLLFALLLILMVYVLWRTLQVMPRVTAAKTV |
| Ga0307284_100883321 | 3300028799 | Soil | MHWLITFRNGASDWLPLLFAVLLILMVYVLYRTLQVMPRVTAAKTVTSNSRVTWADVAGLQEAKEEL |
| Ga0307292_103705811 | 3300028811 | Soil | MDWLVVARDEVAAWLPLVFAVLLVLMVYVLWRTLQVMPRVTAAKTIVA |
| Ga0247825_102329192 | 3300028812 | Soil | MGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTIT |
| Ga0307310_104138371 | 3300028824 | Soil | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVKAARTLTS |
| Ga0307312_110873562 | 3300028828 | Soil | MDWLVFLRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRITAAKTIT |
| Ga0307289_100827684 | 3300028875 | Soil | MEWLVVLRDEIAAWLPLFFVILLVLMTYILWRTLQVMPRVTSAKTITANST |
| Ga0307308_100152491 | 3300028884 | Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVT |
| Ga0307308_106476781 | 3300028884 | Soil | MDWLVFFRDGVANWLPLFFAVLLVLMVYILWRTLQVMPRVSAAKTITAASTVS |
| Ga0268241_100941241 | 3300030511 | Soil | MGDFLVYLRDSIADWLPLFFAVLLVLMVYILWRTLQV |
| Ga0307469_114537551 | 3300031720 | Hardwood Forest Soil | MDWLGVFRDEVANWLPLLFAILLVFMVYILWRTLQV |
| Ga0310897_104433621 | 3300032003 | Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTASKT |
| Ga0310899_102228802 | 3300032017 | Soil | MGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVM |
| Ga0307470_102604001 | 3300032174 | Hardwood Forest Soil | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVT |
| Ga0307470_112298712 | 3300032174 | Hardwood Forest Soil | MDWLFWFRNGVADWLPVLLAALLIMRVYILWRTLQVMPRVTAPKTVTSDSRATWDDV |
| Ga0307472_1024309121 | 3300032205 | Hardwood Forest Soil | MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDANVSWD |
| Ga0335085_104185701 | 3300032770 | Soil | MDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQ |
| Ga0373950_0031147_851_988 | 3300034818 | Rhizosphere Soil | MGMDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTAPK |
| ⦗Top⦘ |