NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059931

Metagenome / Metatranscriptome Family F059931

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059931
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 46 residues
Representative Sequence MDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAK
Number of Associated Samples 118
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.44 %
% of genes near scaffold ends (potentially truncated) 99.25 %
% of genes from short scaffolds (< 2000 bps) 94.74 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.414 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.308 % of family members)
Environment Ontology (ENVO) Unclassified
(34.586 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.887 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 58.33%    β-sheet: 0.00%    Coil/Unstructured: 41.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF13578Methyltransf_24 20.30
PF00857Isochorismatase 9.02
PF02749QRPTase_N 2.26
PF00583Acetyltransf_1 2.26
PF07136DUF1385 0.75
PF07690MFS_1 0.75
PF00004AAA 0.75
PF05496RuvB_N 0.75
PF01729QRPTase_C 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 9.02
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 9.02
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 3.01
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 3.01
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.75
COG3872Uncharacterized conserved protein YqhQ, DUF1385 familyFunction unknown [S] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.41 %
UnclassifiedrootN/A34.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1230204Not Available580Open in IMG/M
3300000890|JGI11643J12802_10859585All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300000891|JGI10214J12806_11585500Not Available568Open in IMG/M
3300000956|JGI10216J12902_112473987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300001333|A21PFW6_1058784All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300001536|A1565W1_10130812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300002568|C688J35102_120629059All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300004081|Ga0063454_100218128All Organisms → cellular organisms → Bacteria → Terrabacteria group1105Open in IMG/M
3300004081|Ga0063454_101228729Not Available622Open in IMG/M
3300004156|Ga0062589_102337296All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300005175|Ga0066673_10744314All Organisms → cellular organisms → Bacteria → Terrabacteria group563Open in IMG/M
3300005176|Ga0066679_10663599All Organisms → cellular organisms → Bacteria → Terrabacteria group678Open in IMG/M
3300005294|Ga0065705_10023877All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300005294|Ga0065705_10066423Not Available758Open in IMG/M
3300005329|Ga0070683_100456194Not Available1220Open in IMG/M
3300005332|Ga0066388_104348957All Organisms → cellular organisms → Bacteria → Terrabacteria group722Open in IMG/M
3300005364|Ga0070673_100037777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3682Open in IMG/M
3300005364|Ga0070673_101056225Not Available758Open in IMG/M
3300005438|Ga0070701_10471544Not Available809Open in IMG/M
3300005439|Ga0070711_100991222All Organisms → cellular organisms → Bacteria → Terrabacteria group720Open in IMG/M
3300005440|Ga0070705_101916119All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005441|Ga0070700_100680106Not Available816Open in IMG/M
3300005467|Ga0070706_101737257Not Available568Open in IMG/M
3300005535|Ga0070684_101726223Not Available591Open in IMG/M
3300005540|Ga0066697_10163249All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300005549|Ga0070704_100173009All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300005552|Ga0066701_10705706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300005554|Ga0066661_10277319All Organisms → cellular organisms → Bacteria → Terrabacteria group1035Open in IMG/M
3300005576|Ga0066708_10629574All Organisms → cellular organisms → Bacteria → Terrabacteria group685Open in IMG/M
3300006028|Ga0070717_10024886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4756Open in IMG/M
3300006577|Ga0074050_12048028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300006791|Ga0066653_10601114All Organisms → cellular organisms → Bacteria → Terrabacteria group559Open in IMG/M
3300006794|Ga0066658_10804596All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006797|Ga0066659_10240836All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300006797|Ga0066659_11916999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300006804|Ga0079221_11751238Not Available508Open in IMG/M
3300006844|Ga0075428_100081472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3532Open in IMG/M
3300006854|Ga0075425_101441291Not Available779Open in IMG/M
3300006854|Ga0075425_101799170Not Available688Open in IMG/M
3300006903|Ga0075426_10031690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album3780Open in IMG/M
3300009101|Ga0105247_10311689All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300009148|Ga0105243_10153216All Organisms → cellular organisms → Bacteria1979Open in IMG/M
3300009156|Ga0111538_11549666Not Available835Open in IMG/M
3300009162|Ga0075423_12519141Not Available562Open in IMG/M
3300009174|Ga0105241_10811844Not Available862Open in IMG/M
3300010046|Ga0126384_12079436Not Available544Open in IMG/M
3300010320|Ga0134109_10470167All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010322|Ga0134084_10271225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300010333|Ga0134080_10346760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300010333|Ga0134080_10495788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300010362|Ga0126377_13020466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300010364|Ga0134066_10252415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium611Open in IMG/M
3300012198|Ga0137364_10967812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300012199|Ga0137383_11205040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300012208|Ga0137376_10204179All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300012208|Ga0137376_10616519All Organisms → cellular organisms → Bacteria → Terrabacteria group938Open in IMG/M
3300012285|Ga0137370_10552196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300012481|Ga0157320_1029101Not Available548Open in IMG/M
3300012582|Ga0137358_10576604All Organisms → cellular organisms → Bacteria → Terrabacteria group755Open in IMG/M
3300012957|Ga0164303_10195260Not Available1115Open in IMG/M
3300012984|Ga0164309_11110009Not Available658Open in IMG/M
3300012988|Ga0164306_10355442Not Available1087Open in IMG/M
3300012989|Ga0164305_11336499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300013096|Ga0157307_1186622Not Available506Open in IMG/M
3300013308|Ga0157375_10243665All Organisms → cellular organisms → Bacteria1957Open in IMG/M
3300013770|Ga0120123_1119542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300014166|Ga0134079_10360220All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300014488|Ga0182001_10281994Not Available661Open in IMG/M
3300014497|Ga0182008_10636804Not Available602Open in IMG/M
3300015077|Ga0173483_10043590All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300015077|Ga0173483_10917492Not Available517Open in IMG/M
3300015371|Ga0132258_13933730Not Available1009Open in IMG/M
3300015372|Ga0132256_101724840All Organisms → cellular organisms → Bacteria → Terrabacteria group735Open in IMG/M
3300017654|Ga0134069_1162782All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300017792|Ga0163161_12026436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300018028|Ga0184608_10124777All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300019362|Ga0173479_10767000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300020004|Ga0193755_1234501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300020012|Ga0193732_1036513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300020022|Ga0193733_1057264Not Available1098Open in IMG/M
3300021078|Ga0210381_10069493Not Available1095Open in IMG/M
3300021080|Ga0210382_10455638Not Available567Open in IMG/M
3300021445|Ga0182009_10086467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1406Open in IMG/M
3300022756|Ga0222622_10459893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300022756|Ga0222622_10863442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300024055|Ga0247794_10002003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4051Open in IMG/M
3300024245|Ga0247677_1009160All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300025919|Ga0207657_10990079Not Available645Open in IMG/M
3300025944|Ga0207661_10321919Not Available1390Open in IMG/M
3300025944|Ga0207661_10389555Not Available1262Open in IMG/M
3300026023|Ga0207677_11565415Not Available610Open in IMG/M
3300026067|Ga0207678_11813051All Organisms → cellular organisms → Bacteria → Terrabacteria group534Open in IMG/M
3300026078|Ga0207702_10684121Not Available1010Open in IMG/M
3300026325|Ga0209152_10404946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300026528|Ga0209378_1111894Not Available1188Open in IMG/M
3300026538|Ga0209056_10678693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300026542|Ga0209805_1342695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300026542|Ga0209805_1450163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300026547|Ga0209156_10444755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300026663|Ga0207532_100194Not Available794Open in IMG/M
3300027748|Ga0209689_1430650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300027765|Ga0209073_10310594All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300028380|Ga0268265_11977014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300028707|Ga0307291_1020632All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300028708|Ga0307295_10158787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300028713|Ga0307303_10118347All Organisms → cellular organisms → Bacteria → Terrabacteria group618Open in IMG/M
3300028718|Ga0307307_10107597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300028718|Ga0307307_10217319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300028720|Ga0307317_10056645All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300028721|Ga0307315_10109791Not Available817Open in IMG/M
3300028722|Ga0307319_10267318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300028755|Ga0307316_10226392Not Available677Open in IMG/M
3300028784|Ga0307282_10217425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300028791|Ga0307290_10069176All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300028791|Ga0307290_10089706Not Available1119Open in IMG/M
3300028793|Ga0307299_10089178Not Available1149Open in IMG/M
3300028799|Ga0307284_10088332All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300028811|Ga0307292_10370581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300028812|Ga0247825_10232919Not Available1278Open in IMG/M
3300028824|Ga0307310_10413837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300028828|Ga0307312_11087356All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300028875|Ga0307289_10082768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1302Open in IMG/M
3300028884|Ga0307308_10015249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3478Open in IMG/M
3300028884|Ga0307308_10647678All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300030511|Ga0268241_10094124Not Available689Open in IMG/M
3300031720|Ga0307469_11453755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300032003|Ga0310897_10443362Not Available621Open in IMG/M
3300032017|Ga0310899_10222880Not Available845Open in IMG/M
3300032174|Ga0307470_10260400Not Available1152Open in IMG/M
3300032174|Ga0307470_11229871All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300032205|Ga0307472_102430912Not Available532Open in IMG/M
3300032770|Ga0335085_10418570All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300034818|Ga0373950_0031147All Organisms → cellular organisms → Bacteria → Terrabacteria group988Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.26%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.01%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.01%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.01%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.01%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.26%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001333Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026663Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK07-B (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_015807002124908045SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTI
JGI11643J12802_1085958513300000890SoilMHWLITFRNGASDWLPLLFALLLILMVYVLWRTLEVMPRVTA
JGI10214J12806_1158550023300000891SoilMGNALVFIRDGIAAWLPLFFAVLLILMVYILWRTLQVMPRV
JGI10216J12902_11247398723300000956SoilMDWLVVLRDEVAAWLPLLFAILLVLMVYILWRTLQVMPRV
A21PFW6_105878413300001333PermafrostMDWLVFLRDGVANWLPLFFAILLVMMVYILWRTLQVMPRVTAAK
A1565W1_1013081213300001536PermafrostMDWLVFFRDGIAAWLPLFFAILLIFMVYILWRTLQVMPRVTAAKTTVAS
C688J35102_12062905913300002568SoilMGDWLVFFRDGIAAWLPLFFAVLLILMVYILWRTLQVMPR
Ga0063454_10021812813300004081SoilMHWLITLRDGASDWLPLLFAGLLVMMVYVLWRTLQVMPRVTAAKTVTSNSK
Ga0063454_10122872923300004081SoilMGWLIYLRDGIADWLPLFFAILLVLMVYILWRTLQVMPRV
Ga0062589_10233729623300004156SoilMDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVKAARTIVGT
Ga0066673_1074431413300005175SoilMGMGFHWLVTVRDASAAWLPLLFAVMLLAMLYVLWRTLEVMPRVTAAKTISTK
Ga0066679_1066359923300005176SoilMHWLITFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTAAKTISSKSR
Ga0065705_1002387743300005294Switchgrass RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSD
Ga0065705_1006642323300005294Switchgrass RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDSNVSW
Ga0070683_10045619413300005329Corn RhizosphereMGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRV
Ga0066388_10434895723300005332Tropical Forest SoilMHWLISLRDASAAWLPLLFAVMLLAMLYVLWRTLEVMPRVTAAKTVSTRTRVTWSDVAGLEE
Ga0070673_10003777713300005364Switchgrass RhizosphereMDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVT
Ga0070673_10105622513300005364Switchgrass RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAA
Ga0070701_1047154413300005438Corn, Switchgrass And Miscanthus RhizosphereMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDANVSWDDV
Ga0070711_10099122213300005439Corn, Switchgrass And Miscanthus RhizosphereMHWLITFRNGTSDWLPLLFAVLLIMMVYVLWRTLQVMPRV
Ga0070705_10191611913300005440Corn, Switchgrass And Miscanthus RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRV
Ga0070700_10068010613300005441Corn, Switchgrass And Miscanthus RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPR
Ga0070706_10173725713300005467Corn, Switchgrass And Miscanthus RhizosphereMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTI
Ga0070684_10172622323300005535Corn RhizosphereMGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAAKTI
Ga0066697_1016324933300005540SoilMDWLIVLRDEVANWLPLLFAILLIFMVYILWRTLQVMP
Ga0070704_10017300933300005549Corn, Switchgrass And Miscanthus RhizosphereMHWLITVRNGASDWLPLLFAFLLILMVYVLWRTLQVMPRVTAAKT
Ga0066701_1070570613300005552SoilMDWLVVFRDEFANWLPLVFTVVLILMVYILWRTLQVMPRVTAAKTVVGKSSVT
Ga0066661_1027731913300005554SoilMHWLITFRNGTSDWLPLLFAVLLVMMVYVLWRTLQVMPRVT
Ga0066708_1062957423300005576SoilMGWLVTLRDGTAAWLPLLFAVMLMAMLYVLWRTLEVMPR
Ga0070717_1002488613300006028Corn, Switchgrass And Miscanthus RhizosphereMGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTA
Ga0074050_1204802823300006577SoilMDWLVVLRDEIANWLPLLFAVMLFLMVYILWRTLQVMPRV
Ga0066653_1060111413300006791SoilMGMHSLITFRDGASDWLPLLLALLLIVMVYVLWRTLQVMPRVTAA
Ga0066658_1080459623300006794SoilMDWLVVFRDEFANWLPLLFAVLLIMMVYILWRTLQVMPRVTAAKTIT
Ga0066659_1024083633300006797SoilMDWLITFLNVAFDWLLLLFAFLLILMVHVLWPTLHVMPRVTAAQT
Ga0066659_1191699913300006797SoilMDWLVFFRDGVAAWLPLFFAILLVLMVYILWRTLQVM
Ga0079221_1175123813300006804Agricultural SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTIT
Ga0075428_10008147253300006844Populus RhizosphereMGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPR
Ga0075425_10144129123300006854Populus RhizosphereMGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPR
Ga0075425_10179917023300006854Populus RhizosphereMGDVLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQV
Ga0075426_1003169063300006903Populus RhizosphereMDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTAPKTVTSDS
Ga0105247_1031168923300009101Switchgrass RhizosphereMGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTASKTITSDARV
Ga0105243_1015321633300009148Miscanthus RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAK
Ga0111538_1154966623300009156Populus RhizosphereMGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDSNV
Ga0075423_1251914123300009162Populus RhizosphereMDWLVVFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPR
Ga0105241_1081184423300009174Corn RhizosphereMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAA
Ga0126384_1207943613300010046Tropical Forest SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDSRVSW
Ga0134109_1047016713300010320Grasslands SoilMGMGWLIAFRNGASDWLPLLFAALLIMMVYVLWRTLQVMPRVTGAKTVTSTTKVSW
Ga0134084_1027122513300010322Grasslands SoilMDWLVFFRDGVAAWLPLFFAILLVLMVYILWRTLQV
Ga0134080_1034676013300010333Grasslands SoilMDWLVVFRDEVAAWLPLLFAILLVLMVYILWRTLQVMPRVTA
Ga0134080_1049578823300010333Grasslands SoilMDWLVVLRDEVAAWLPLLFAILLVLMVYILWRTLQVMPRVT
Ga0126377_1302046613300010362Tropical Forest SoilMDWLVVLRDEVANWLPLLFAILLVFMVYILWRTLQVM
Ga0134066_1025241513300010364Grasslands SoilMDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQVMPRVTAAKTITASANV
Ga0137364_1096781223300012198Vadose Zone SoilMGMHWLITFRGGASDWLPLRLALLLIVMVYVLWRTL
Ga0137383_1120504023300012199Vadose Zone SoilMTWLVVLRDEVANWLPLLFAVLLVLMVYILWRTLQVMPRVT
Ga0137376_1020417943300012208Vadose Zone SoilMDWLVVFRDEFANWLPLLFAVLLIMMVYILWRTLQVMPRVTAAK
Ga0137376_1061651923300012208Vadose Zone SoilMHWLITFRNGTSDWLPLLFAVLLVMMVYVLWRTLQVMPRVTAAKTVTSNSRVTWSDV
Ga0137370_1055219623300012285Vadose Zone SoilMDWLVVLRDEVANWLPLLFAILLIFMVYILWRTLQVMPRVTAAKTIVA
Ga0157320_102910123300012481Arabidopsis RhizosphereMGDLLVFIRDGIAAWLPLFFAVLLVLMVYILWRTLQVMP
Ga0137358_1057660423300012582Vadose Zone SoilMHWLITFRNGTSDWLPLLFAVLLVMMVYVLWRTLQVMPRVTAAKTVTSNSRV
Ga0164303_1019526023300012957SoilMGTWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRV
Ga0164309_1111000923300012984SoilMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTA
Ga0164306_1035544223300012988SoilMGTWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAAKTITSDSKVSWD
Ga0164305_1133649923300012989SoilMGWLIVFRDEFANWLPLLFGILLTLMVYILWRTLQVMPKVTAAKTITAS
Ga0157307_118662223300013096SoilMGDWLVFLRDGIAAWLPLFFAVLLVLMVYILWRTL
Ga0157375_1024366533300013308Miscanthus RhizosphereMGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAA
Ga0120123_111954213300013770PermafrostMDWLVFLRDGVANWLPLFFAILLVMMVYILWRTLQVMPRVTSAADHITIG*
Ga0134079_1036022013300014166Grasslands SoilMGMHSLITFRDGASDWLPLLFAALLIMMVYVLWRTLQVMPR
Ga0182001_1028199413300014488SoilMHWLVTFRDAAAAWLPLLFAILLILMVYVLWRTLQVMPRVTAAKTVTSTSPVAWSDVA
Ga0182008_1063680413300014497RhizosphereMNWLVAFRDAAAAWLPLLFAILLILMVYVLWRTLQVMPRVTAAKTVTSTSPVSWSD
Ga0173483_1004359013300015077SoilMDWLVVFRDGIAAWLPLFFAVLLIMMVYILWRTLQVMPRVKAARTIVGT
Ga0173483_1091749223300015077SoilMGDWLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMP
Ga0132258_1393373013300015371Arabidopsis RhizosphereMGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTA
Ga0132256_10172484023300015372Arabidopsis RhizosphereMHWLITLRDGTAAWLPLLFAVMLMAMLYVLWRTLEVMPRVTAAKTISTKSKVTWTDVAGL
Ga0134069_116278213300017654Grasslands SoilMGWLVTLRDGTAAWLPLLFAVMLMAMLYVLWRTLEVRRRVTAAKTISTK
Ga0163161_1202643623300017792Switchgrass RhizosphereMDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVMPKVTAAKT
Ga0184608_1012477713300018028Groundwater SedimentMEWLVVLRDEIAAWLPLFFVVLLVLMTYILWRTLQVMP
Ga0173479_1076700013300019362SoilMDWLVVLRDEFANWLPLLFAVMLILMVYILWRTLQVMPKVTAAKT
Ga0193755_123450113300020004SoilMHWLITFRNGASDWLPLLFAVLLILMVYVLYRTLQVMPRVTAAKTVTSNSRVTWADVAGLQEAK
Ga0193732_103651313300020012SoilLITFRNGAADWLPLLFALLLILMVYVLWRTLQVMPRVTA
Ga0193733_105726423300020022SoilMHWLITFRNGTSDWLPLLFAVLLIMMVYVLWRTLQVMP
Ga0210381_1006949313300021078Groundwater SedimentMGMNWLITFRDGASDWLPLLFALLLILMVYVLWRT
Ga0210382_1045563813300021080Groundwater SedimentMDWLVFFRDGVANWLPLFFAVLLVLMVYILWRTLQVMPRVSA
Ga0182009_1008646713300021445SoilMDWLVVFRDEFANWLPLLFAVMLILMVYILWRTLQVMPKVTAAKTITS
Ga0222622_1045989313300022756Groundwater SedimentMDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVM
Ga0222622_1086344223300022756Groundwater SedimentMDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVMPKVTAAKTITASSK
Ga0247794_1000200363300024055SoilMGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDARVSWDD
Ga0247677_100916013300024245SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMP
Ga0207657_1099007913300025919Corn RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDARVSW
Ga0207661_1032191913300025944Corn RhizosphereMGDWLVFFRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRVTAAKTITSDARVSWDDVA
Ga0207661_1038955513300025944Corn RhizosphereMGDLLVFLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTASKTITS
Ga0207677_1156541513300026023Miscanthus RhizosphereMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAK
Ga0207678_1181305113300026067Corn RhizosphereMDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTASQTI
Ga0207702_1068412113300026078Corn RhizosphereMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDARV
Ga0209152_1040494613300026325SoilMDWLVVFRDEFANWLPLLFAALLIMMVYILWRTLQVMPRVTAAKTISSDSTVS
Ga0209378_111189423300026528SoilMHWLITFRDGASDWLPLLLALLLIVMVYVLWRTLQVMPRVTAAK
Ga0209056_1067869313300026538SoilMDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQVM
Ga0209805_134269523300026542SoilMAWLVVLRDEVAAWLPLLFALLLILMVYILWRTLQVMPRVTAAKT
Ga0209805_145016323300026542SoilMHWLIAFRNGTSDWLPLLFAVLLILMVYVLYRTLQVMPRVTAAKTVTSNTKVTWADVAGLEE
Ga0209156_1044475513300026547SoilMDWLIVLRDEVANWLPLLFAILLIFMVYILWRTLQVMPRVTAAKTIVADS
Ga0207532_10019423300026663SoilMGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQ
Ga0209689_143065023300027748SoilMTWLVVLRDEVANWLPLLFAVLLVLMVYILWRTLQVMPR
Ga0209073_1031059423300027765Agricultural SoilMDWLFWFRNGVADWLPVLLAALLVMMVYILWRTLQV
Ga0268265_1197701423300028380Switchgrass RhizosphereMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVSAAKTIVATSTVSWD
Ga0307291_102063233300028707SoilMGDVLVFIRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTGAK
Ga0307295_1015878713300028708SoilMDWLVVFRDEFANWLPLLFAVMLVLMVYILWRTLQVMPKVTAAKTITSS
Ga0307303_1011834723300028713SoilMGWLIAFRDGASDWLPILFALLLILMVYVLWRTLEVMPRVTAAKMVTGNSRVTWGD
Ga0307307_1010759713300028718SoilMHWLITFRNGASDWLPLLFAVLLILMVYVLYRTLQVMPRGTAAKT
Ga0307307_1021731913300028718SoilMGWLIAFRDGASDWLPILFALLLILMVYVLWRTLEVMPRVT
Ga0307317_1005664533300028720SoilMDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQVMPKVTAAKTISPKSTDRKS
Ga0307315_1010979123300028721SoilMDWLVFFRDGVANWLPLFFAVLLVLMVYILWRTLQVMPRVSAAKTITA
Ga0307319_1026731813300028722SoilLITFRNGAADWLPLLFALLLILMVYVLWRTLQVMPRVTAA
Ga0307316_1022639223300028755SoilMGDALVFIRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVKAARTLTSDSNVSW
Ga0307282_1021742513300028784SoilMGWLIAFRDGASDWLPILFALLLILMVYVLWRTLEVMPRVTAAKT
Ga0307290_1006917613300028791SoilMEWLVVLRDEIAAWLPLFFVILLVLMTYILWRTLQVM
Ga0307290_1008970613300028791SoilMGMHWLITFRDGASDWLPLLFALLLILMVYVLWRTLQVMPRVTAAKTVTSNTKVTWA
Ga0307299_1008917823300028793SoilMGMHWLITFRDGASDWLPLLFALLLILMVYVLWRTLQVMPRVTAAKTV
Ga0307284_1008833213300028799SoilMHWLITFRNGASDWLPLLFAVLLILMVYVLYRTLQVMPRVTAAKTVTSNSRVTWADVAGLQEAKEEL
Ga0307292_1037058113300028811SoilMDWLVVARDEVAAWLPLVFAVLLVLMVYVLWRTLQVMPRVTAAKTIVA
Ga0247825_1023291923300028812SoilMGDLLVYLRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTIT
Ga0307310_1041383713300028824SoilMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVKAARTLTS
Ga0307312_1108735623300028828SoilMDWLVFLRDGIAAWLPLFFAILLVLMVYILWRTLQVMPRITAAKTIT
Ga0307289_1008276843300028875SoilMEWLVVLRDEIAAWLPLFFVILLVLMTYILWRTLQVMPRVTSAKTITANST
Ga0307308_1001524913300028884SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVT
Ga0307308_1064767813300028884SoilMDWLVFFRDGVANWLPLFFAVLLVLMVYILWRTLQVMPRVSAAKTITAASTVS
Ga0268241_1009412413300030511SoilMGDFLVYLRDSIADWLPLFFAVLLVLMVYILWRTLQV
Ga0307469_1145375513300031720Hardwood Forest SoilMDWLGVFRDEVANWLPLLFAILLVFMVYILWRTLQV
Ga0310897_1044336213300032003SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTASKT
Ga0310899_1022288023300032017SoilMGDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVM
Ga0307470_1026040013300032174Hardwood Forest SoilMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVT
Ga0307470_1122987123300032174Hardwood Forest SoilMDWLFWFRNGVADWLPVLLAALLIMRVYILWRTLQVMPRVTAPKTVTSDSRATWDDV
Ga0307472_10243091213300032205Hardwood Forest SoilMDWLVFFRDGIAAWLPLFFAVLLVLMVYILWRTLQVMPRVTAAKTITSDANVSWD
Ga0335085_1041857013300032770SoilMDWLVVFRDEFANWLPLLFGVLLILMVYILWRTLQ
Ga0373950_0031147_851_9883300034818Rhizosphere SoilMGMDWLFWFRNGVADWLPVLLAALLIMMVYILWRTLQVMPRVTAPK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.