| Basic Information | |
|---|---|
| Family ID | F059893 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LNDKSEIEVLVHEIIRGKAAAHKREVELRRAINPTLNTDTRGD |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.98 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (44.361 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.053 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.669 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.940 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF14090 | HTH_39 | 1.50 |
| PF10902 | WYL_2 | 0.75 |
| PF10263 | SprT-like | 0.75 |
| PF07486 | Hydrolase_2 | 0.75 |
| PF07750 | GcrA | 0.75 |
| PF00542 | Ribosomal_L12 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0222 | Ribosomal protein L7/L12 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.75 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.68 % |
| Unclassified | root | N/A | 29.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000553|TBL_comb47_HYPODRAFT_10029245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3959 | Open in IMG/M |
| 3300000756|JGI12421J11937_10121861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300002161|JGI24766J26685_10057397 | Not Available | 864 | Open in IMG/M |
| 3300003388|JGI25910J50241_10033568 | All Organisms → Viruses → Predicted Viral | 1715 | Open in IMG/M |
| 3300003429|JGI25914J50564_10030973 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
| 3300003490|JGI25926J51410_1057640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300003490|JGI25926J51410_1065166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300003491|JGI25924J51412_1043193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300004096|Ga0066177_10185898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300005517|Ga0070374_10110404 | All Organisms → Viruses → Predicted Viral | 1432 | Open in IMG/M |
| 3300005517|Ga0070374_10198763 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300005580|Ga0049083_10169063 | Not Available | 747 | Open in IMG/M |
| 3300005581|Ga0049081_10207316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300005662|Ga0078894_10425813 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300005662|Ga0078894_11491688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300005758|Ga0078117_1079235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300005805|Ga0079957_1279230 | Not Available | 761 | Open in IMG/M |
| 3300006114|Ga0007815_1037224 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300006116|Ga0007807_1096610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300006641|Ga0075471_10314918 | Not Available | 794 | Open in IMG/M |
| 3300007074|Ga0075110_1059158 | Not Available | 880 | Open in IMG/M |
| 3300007622|Ga0102863_1227335 | Not Available | 548 | Open in IMG/M |
| 3300007624|Ga0102878_1168181 | Not Available | 633 | Open in IMG/M |
| 3300007722|Ga0105051_10260582 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300008117|Ga0114351_1030113 | All Organisms → Viruses → Predicted Viral | 3556 | Open in IMG/M |
| 3300008267|Ga0114364_1056156 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300009026|Ga0102829_1237166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300009154|Ga0114963_10622612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300009161|Ga0114966_10570415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300009161|Ga0114966_10589685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300009164|Ga0114975_10050850 | All Organisms → Viruses → Predicted Viral | 2443 | Open in IMG/M |
| 3300009164|Ga0114975_10076727 | All Organisms → Viruses → Predicted Viral | 1946 | Open in IMG/M |
| 3300009164|Ga0114975_10260188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
| 3300009164|Ga0114975_10336482 | Not Available | 831 | Open in IMG/M |
| 3300009164|Ga0114975_10736812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300009165|Ga0105102_10353714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300009180|Ga0114979_10267504 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300009182|Ga0114959_10165367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300009419|Ga0114982_1011341 | All Organisms → Viruses → Predicted Viral | 3135 | Open in IMG/M |
| 3300009419|Ga0114982_1060499 | Not Available | 1186 | Open in IMG/M |
| 3300010158|Ga0114960_10566562 | Not Available | 540 | Open in IMG/M |
| 3300010334|Ga0136644_10341622 | Not Available | 859 | Open in IMG/M |
| 3300010334|Ga0136644_10364188 | Not Available | 826 | Open in IMG/M |
| 3300010334|Ga0136644_10776025 | Not Available | 517 | Open in IMG/M |
| 3300010354|Ga0129333_11026594 | Not Available | 692 | Open in IMG/M |
| 3300012663|Ga0157203_1000611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10366 | Open in IMG/M |
| 3300012663|Ga0157203_1002140 | All Organisms → Viruses → Predicted Viral | 4523 | Open in IMG/M |
| 3300012780|Ga0138271_1171833 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300012780|Ga0138271_1459788 | Not Available | 553 | Open in IMG/M |
| 3300013004|Ga0164293_10127979 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300013004|Ga0164293_10260153 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300013005|Ga0164292_11046662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10541842 | Not Available | 733 | Open in IMG/M |
| 3300013295|Ga0170791_10628836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 919 | Open in IMG/M |
| 3300013295|Ga0170791_15632418 | All Organisms → Viruses → Predicted Viral | 1957 | Open in IMG/M |
| 3300013372|Ga0177922_10393930 | Not Available | 727 | Open in IMG/M |
| 3300013372|Ga0177922_11276663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300017723|Ga0181362_1067038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300017777|Ga0181357_1323659 | Not Available | 518 | Open in IMG/M |
| 3300017780|Ga0181346_1059458 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
| 3300019093|Ga0187843_10427893 | Not Available | 531 | Open in IMG/M |
| 3300019784|Ga0181359_1236391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300020048|Ga0207193_1221937 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300020048|Ga0207193_1366876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
| 3300020083|Ga0194111_10202845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
| 3300020151|Ga0211736_10076366 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300020159|Ga0211734_10735561 | Not Available | 566 | Open in IMG/M |
| 3300020159|Ga0211734_10899530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300020162|Ga0211735_10766231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300020172|Ga0211729_10004714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300020193|Ga0194131_10510051 | Not Available | 537 | Open in IMG/M |
| 3300020197|Ga0194128_10357293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300020514|Ga0208202_1010706 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| 3300021141|Ga0214163_1066603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300022748|Ga0228702_1112021 | Not Available | 629 | Open in IMG/M |
| 3300022865|Ga0222668_1040921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300024350|Ga0255167_1057767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300024573|Ga0256337_1003685 | All Organisms → Viruses → Predicted Viral | 3320 | Open in IMG/M |
| 3300024859|Ga0255278_1002579 | All Organisms → Viruses → Predicted Viral | 3256 | Open in IMG/M |
| 3300025411|Ga0208865_1049958 | Not Available | 657 | Open in IMG/M |
| 3300025783|Ga0208258_1049167 | Not Available | 591 | Open in IMG/M |
| 3300026569|Ga0255277_1044005 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300027290|Ga0255136_1039106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300027292|Ga0255134_1028822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300027293|Ga0255132_1118038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300027335|Ga0255130_1052922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300027563|Ga0209552_1154011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300027563|Ga0209552_1161964 | Not Available | 571 | Open in IMG/M |
| 3300027581|Ga0209651_1055337 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300027598|Ga0255121_1092212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300027621|Ga0208951_1023497 | Not Available | 1934 | Open in IMG/M |
| 3300027644|Ga0209356_1047993 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300027679|Ga0209769_1071482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
| 3300027707|Ga0209443_1304634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300027744|Ga0209355_1184519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300027747|Ga0209189_1025401 | Not Available | 3115 | Open in IMG/M |
| 3300027747|Ga0209189_1188326 | Not Available | 858 | Open in IMG/M |
| 3300027756|Ga0209444_10116931 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300027756|Ga0209444_10129734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300027769|Ga0209770_10120635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300027785|Ga0209246_10339237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300027797|Ga0209107_10360192 | Not Available | 671 | Open in IMG/M |
| 3300027798|Ga0209353_10248777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300027798|Ga0209353_10417752 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 547 | Open in IMG/M |
| 3300027805|Ga0209229_10132320 | Not Available | 1125 | Open in IMG/M |
| 3300027808|Ga0209354_10172574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300027836|Ga0209230_10487139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300027969|Ga0209191_1150698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300027969|Ga0209191_1334668 | Not Available | 551 | Open in IMG/M |
| 3300027976|Ga0209702_10002755 | Not Available | 29593 | Open in IMG/M |
| 3300028025|Ga0247723_1136501 | Not Available | 586 | Open in IMG/M |
| 3300028394|Ga0304730_1252172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 635 | Open in IMG/M |
| 3300028530|Ga0255279_1008605 | Not Available | 1759 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1307683 | Not Available | 537 | Open in IMG/M |
| 3300031519|Ga0307488_10687906 | Not Available | 580 | Open in IMG/M |
| 3300031784|Ga0315899_10218289 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300031857|Ga0315909_10489916 | Not Available | 852 | Open in IMG/M |
| 3300032092|Ga0315905_11540198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300032562|Ga0316226_1298883 | Not Available | 620 | Open in IMG/M |
| 3300033992|Ga0334992_0044865 | All Organisms → Viruses → Predicted Viral | 2549 | Open in IMG/M |
| 3300033994|Ga0334996_0557220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300034013|Ga0334991_0131841 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300034018|Ga0334985_0635936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300034021|Ga0335004_0724113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300034066|Ga0335019_0290698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
| 3300034068|Ga0334990_0400991 | Not Available | 739 | Open in IMG/M |
| 3300034071|Ga0335028_0196602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
| 3300034071|Ga0335028_0521176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300034093|Ga0335012_0379832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300034095|Ga0335022_0434857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300034104|Ga0335031_0102011 | All Organisms → Viruses → Predicted Viral | 2022 | Open in IMG/M |
| 3300034283|Ga0335007_0717704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300034284|Ga0335013_0269980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.05% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.01% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.26% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.26% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.50% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.50% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.50% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.50% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.75% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.75% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.75% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.75% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022865 | Saline water microbial communities from Ace Lake, Antarctica - #728 | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027290 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027335 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027598 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb47_HYPODRAFT_1002924513 | 3300000553 | Freshwater | ALRQLDCKEAIEIYIHAVVRGKADAHRREVEIRRAVSPTLNTDVRGDG* |
| JGI12421J11937_101218612 | 3300000756 | Freshwater And Sediment | SLNDKREIEVLVHEVVRGKAAAHKREVELRRLLNPALNTDCRGD* |
| JGI24766J26685_100573971 | 3300002161 | Freshwater And Sediment | IALRELNDKNEIEILVHEIVRGKADAHKREVEIRREVKPTLNTDKRGD* |
| JGI25910J50241_100335681 | 3300003388 | Freshwater Lake | RTLSDKSEIEVLVHEVVRGKAEAHKREVELRRAINPTLNTDVRGD* |
| JGI25914J50564_100309736 | 3300003429 | Freshwater Lake | HALRSLSDKSEIEVYVHEVIRGKAAAHKREVELRRAIMPTLNTDTRGD* |
| JGI25926J51410_10576401 | 3300003490 | Freshwater Lake | YKSEIEVLIHEVVRGKAAAHKREVELRRAINPALNTDIRGD* |
| JGI25926J51410_10651663 | 3300003490 | Freshwater Lake | KSEIEVLVHETLRGKAVAHKREVELRRALKPVLNTDCRGD* |
| JGI25924J51412_10431933 | 3300003491 | Freshwater Lake | CHALRTLRDKSEIEVYVHEVIRGKAAAHKREVELRRAIMPTLNTDTRGD* |
| Ga0066177_101858981 | 3300004096 | Freshwater Lake | LCHALRTLSDKSEIEVYVHEVIRGKAQAHKREVELRRLINPTLNTDTRGD* |
| Ga0070374_101104045 | 3300005517 | Freshwater Lake | LVHEIIRGKAAAHKREVVLRRAINPTLNTDTRGD* |
| Ga0070374_101987635 | 3300005517 | Freshwater Lake | EVYVHEVIRGKAAAHKREVELRRAIMPTLNTDTRGD* |
| Ga0049083_101690631 | 3300005580 | Freshwater Lentic | RELSCKTEIEIRVHEIIRGKAAAHKREVEIRRLINPILNTDIRGDLTV* |
| Ga0049081_102073161 | 3300005581 | Freshwater Lentic | DKSEIEVLIHEVVRGKAAAHKREVELRRAIMPTLNTDTRGD* |
| Ga0078894_104258134 | 3300005662 | Freshwater Lake | VLVHEVVRGKAAAHKREVELRRVLKPTLNTDTRGD* |
| Ga0078894_114916881 | 3300005662 | Freshwater Lake | LVHETLRGKAAAHKREVELRRAINPTLNTDVRGD* |
| Ga0078117_10792354 | 3300005758 | Lake Water | EIEIVVHEIVRGKADAHKREVEIRRAVKPTLNTDKRGD* |
| Ga0079957_12792301 | 3300005805 | Lake | QALRALNSKDDIEIRVHEIVRGKALAHKREVEIRRTVRPALNTDVRGD* |
| Ga0007815_10372241 | 3300006114 | Freshwater | IEIRVHELVRGKAEAHRREVAIRRRINPALNTDIRGDELTA* |
| Ga0007807_10966103 | 3300006116 | Freshwater | KEEIGIKIHEIVRGKADAHKREVEIRRQVRPALNTDTRGD* |
| Ga0075471_103149183 | 3300006641 | Aqueous | IEIRVVELLRGKAIAHKREVEIRRELKPELNTDVRGD* |
| Ga0075110_10591581 | 3300007074 | Saline Lake | ALRTLADKSEIEVYVHEVVRGKAAAHQREVELRRMLKPTLNTDVRGD* |
| Ga0102863_12273351 | 3300007622 | Estuarine | QIEVLVHEVIRGKAEAHKREVELRRQINPTLNTDVRGD* |
| Ga0102878_11681811 | 3300007624 | Estuarine | KSEIAVFVHEVIRGKAEAHRREVEIRRAVKPVLNTDCRGD* |
| Ga0105051_102605821 | 3300007722 | Freshwater | SEIEVYVHEVIRGKAAAHLREVELRRLFKPTLNTDTRGD* |
| Ga0114351_10301138 | 3300008117 | Freshwater, Plankton | LADKSMIEIIVHEIVRGKAEAHRREVEIRRTVRPTLNTDTRGD* |
| Ga0114364_10561565 | 3300008267 | Freshwater, Plankton | DKSEIQVLVHETLRGKAVAHKREVELRRALKPVLNTDCRGD* |
| Ga0102829_12371661 | 3300009026 | Estuarine | SEIEVYVHEIIRGKSAAHKREVELRRMLKPMLNTDTRGD* |
| Ga0114963_106226123 | 3300009154 | Freshwater Lake | ELIEIRVHELVRGKAEAHKREVEIRRAINPALNTDIRGDLTV* |
| Ga0114966_105704153 | 3300009161 | Freshwater Lake | LCHALRTLSDKSEIEVYVHEVIRGKAAAHKREVELRRLINPTLNTDTRGD* |
| Ga0114966_105896851 | 3300009161 | Freshwater Lake | RIHEIVRGKAAAHKREVEIRRAINPTLNTDIRGDLTAG* |
| Ga0114975_100508501 | 3300009164 | Freshwater Lake | LRELSDKSEIEIRIHEIIRGKAAAHKREVELRRLLQPALNTDTRGD* |
| Ga0114975_100767277 | 3300009164 | Freshwater Lake | ELSDKSEIEIRIHEIIRGKAAAHKREVELRRLLQPALNTDTRGD* |
| Ga0114975_102601881 | 3300009164 | Freshwater Lake | KSEIEVLVHETLRGKAMAHKREVELRRQLRPTLNTDTRGD* |
| Ga0114975_103364821 | 3300009164 | Freshwater Lake | LNSKDEIEILIHAVIRGKAEAHKTEVAIRRAVKPVLNTDVRGD* |
| Ga0114975_107368121 | 3300009164 | Freshwater Lake | LNDKSEIEVLVHEVIRGKAAAHKREVELRRALKPVLNTDCRGD* |
| Ga0105102_103537144 | 3300009165 | Freshwater Sediment | EVLVHETLRGKAVAHKREVELRRALKPVLNTDTRGD* |
| Ga0114979_102675044 | 3300009180 | Freshwater Lake | KLNSKDEIEIVIHEIVRGKAPAHKREVEIRRMVKPVLNTDTRGDLHAD* |
| Ga0114959_101653674 | 3300009182 | Freshwater Lake | ELRKLNDKSEIEVYVHEVIRGKAAAHKREVEIRRIVKPVLNTDIRGD* |
| Ga0114982_10113418 | 3300009419 | Deep Subsurface | RTLNDKSEIEVLVHEVVRGKAAAHKREVELRRELCPTLNTDVRGD* |
| Ga0114982_10604991 | 3300009419 | Deep Subsurface | RGLERKEDIEIRVHEIVRGKAEAHRREVEIRRAVQPVLNTDVRGD* |
| Ga0114960_105665622 | 3300010158 | Freshwater Lake | ALRELTSKDEIEILVHEIVRGKGEAHKREVQLRRMINPTLNTDIRGDALTA* |
| Ga0136644_103416221 | 3300010334 | Freshwater Lake | ELRKLNDKSEIEVYVHEVIRGKAEAHKREVEIRRMVKPVLNTDVRGDLTAG* |
| Ga0136644_103641884 | 3300010334 | Freshwater Lake | RELNDKSEIEIRVHEIIRGKAAAHRREVELRRLINPALNTDIRGDLT* |
| Ga0136644_107760252 | 3300010334 | Freshwater Lake | LVNENARGKGEAHKREVQLRRMINPTLNTDIRGDALTA* |
| Ga0129333_110265941 | 3300010354 | Freshwater To Marine Saline Gradient | EEIEIRVVELLRGKAVAHRREVEIRRELRPELNTDVRGD* |
| Ga0157203_10006111 | 3300012663 | Freshwater | KNEIEVYVHEVIRGKAEAHRREVELRRMIKPVLNTDVRGD* |
| Ga0157203_100214011 | 3300012663 | Freshwater | KNEIEVYVHEVIRGKAEAHKREVELRRIIKPALNTDVRGD* |
| Ga0138271_11718333 | 3300012780 | Freshwater Lake | RKLNDKSEIEVYVHEVIRGKAAAHRREVEIRRMVKPVLNTDVRGD* |
| Ga0138271_14597881 | 3300012780 | Freshwater Lake | IEIRIHEIIRGKAAAHRREVEIRRMINPALNTDIRGDLTAG* |
| Ga0164293_101279796 | 3300013004 | Freshwater | RALRGLNDKSEIEVLVHETLRGKAAAHKREVELRRAINPTLNTDVRGD* |
| Ga0164293_102601535 | 3300013004 | Freshwater | RGLNDKSEIEVLVHETLRGKAAAHKREVELRRQLRPTLNTDTRGD* |
| Ga0164292_110466621 | 3300013005 | Freshwater | IEVYVHEVIRGKGAAHKREVELRRMIKPALNTDVRGD* |
| (restricted) Ga0172364_105418421 | 3300013129 | Sediment | DKSEIEIRIHEIVRGKRDAHRREVEIRRLVQPTLNTDTRGD* |
| Ga0170791_106288364 | 3300013295 | Freshwater | VALRALTDKSEIEIRIHEIIRGKAAAHRREVEIRRMINPALNTDIRGDLTAG* |
| Ga0170791_156324186 | 3300013295 | Freshwater | RQLNDKSEIEVLVHEVIRGKAAAHKREVELRRQLQPVLNTDVRGD* |
| Ga0177922_103939303 | 3300013372 | Freshwater | LRGLDSKEDIEVLVHEVIRGKAAAHKREVELRRVMQPALNTDCRGD* |
| Ga0177922_112766631 | 3300013372 | Freshwater | VLVHETLRGKAAAHKREVELRRAINPTLNTDVRGD* |
| Ga0181362_10670383 | 3300017723 | Freshwater Lake | CKALRGLNDKSEIEVLVHETLRGKAAAHKREVELRRAINPTLNTDVRGD |
| Ga0181357_13236591 | 3300017777 | Freshwater Lake | LCEALRGLDSKEDIEVLVHEVIRGKAAAHKREVELRRVMQPALNTDCRGD |
| Ga0181346_10594586 | 3300017780 | Freshwater Lake | EVLIHEVVRGKAEAHKREVLLRRQINPTLNTDVRGD |
| Ga0187843_104278931 | 3300019093 | Freshwater | LNDKSEIEVLVHEVIRGKAAAHKREVELRRQLSPTLNTDTRGD |
| Ga0181359_12363911 | 3300019784 | Freshwater Lake | CQELRKLTDKSEIEVLVHEVIRGKAEAHKREVELRRQINPTLNTDVRGD |
| Ga0207193_12219371 | 3300020048 | Freshwater Lake Sediment | ELRKLNDKSEIEVYVHEVIRGKAEAHKREVEIRRMVKPVLNTDVRGD |
| Ga0207193_13668761 | 3300020048 | Freshwater Lake Sediment | SDKSEIECYIHEVIRGKAAAHVREVEIRRMVKPVLNTDTRGD |
| Ga0194111_102028451 | 3300020083 | Freshwater Lake | LCEALRALSDKSEIEIRIHEIVRGKADAHRREVEIRRLVQPTLNTDTRGD |
| Ga0211736_100763661 | 3300020151 | Freshwater | DKSEIEVLIHEVVRGKAAAHKREVELRRAIMPTLNTDTRGD |
| Ga0211734_107355611 | 3300020159 | Freshwater | DKSEIEVLVHETLRGKAAAHKREVELRRTLRPKLNTDTRGD |
| Ga0211734_108995303 | 3300020159 | Freshwater | NDKSEIEVLVHETLRGKAAAHKREVELRRALKPVLNTDTRGD |
| Ga0211735_107662311 | 3300020162 | Freshwater | KSEIEVLVHEVIRGKAAAHKREVELRRELQPILNTDTRGD |
| Ga0211729_100047143 | 3300020172 | Freshwater | EVLVHETLRGKAAAHKREVELRRALKPVLNTDTRGD |
| Ga0194131_105100511 | 3300020193 | Freshwater Lake | KSEIEIRIHEIVRGKADAHRREVEIRRAVMPTLNTDTRGD |
| Ga0194128_103572933 | 3300020197 | Freshwater Lake | ALRALADKSEIEIRIHEIVRGKADAHRREVEIRRLVQPTLNTDTRGD |
| Ga0208202_10107065 | 3300020514 | Freshwater | QLNDKNEIEIVVHEIVRGKAEAHRREVEIRRAVKPTLNTDKRGD |
| Ga0214163_10666031 | 3300021141 | Freshwater | KSEIEVLVHETLRGKAAAHKREVELRRTLRPELNTDCRGD |
| Ga0228702_11120211 | 3300022748 | Freshwater | LRKLSDKNEIEILVHEVVRGKAEAHRREVEIRRAVRPALNTDVRGD |
| Ga0222668_10409212 | 3300022865 | Saline Water | WETLRGKAAAHRREVELRRELKPTLNTDVRNDHLYR |
| Ga0255167_10577671 | 3300024350 | Freshwater | DITIIVHEIIRGKAAAHRREVELRRELRPSLNTDCRGD |
| Ga0256337_10036851 | 3300024573 | Freshwater | EIIVHEIIRGKAAAHRREVELRRELRPNLNTDTRGD |
| Ga0255278_10025798 | 3300024859 | Freshwater | LCSALRKLNSKEEIEIIVHEIVRGKALAHKREVEIRRLVGPTLNTDTRGD |
| Ga0208865_10499583 | 3300025411 | Freshwater | TSKDEIEILVHEIVRGKAEAHKREVQLRRQINPTLNTDVRGDALTA |
| Ga0208258_10491671 | 3300025783 | Freshwater | ALRELSSKDEIEILVHEIVRGKAEAHKREVQLRRQINPTLNTDVRGDSLTA |
| Ga0255277_10440055 | 3300026569 | Freshwater | LCHALRELASKDEIEIVVHEIIRGKAAAHKREVELRRLIQPTLNTDTRGD |
| Ga0255136_10391064 | 3300027290 | Freshwater | VLVHETLRGKAAAHKREVALRRAINPTLNTDVRGD |
| Ga0255134_10288221 | 3300027292 | Freshwater | LRSLSDKSEIEVYVHEVIRGKAAAHKREVELRRAIMPTLNTDTRGD |
| Ga0255132_11180383 | 3300027293 | Freshwater | LSDKSEIEVYVHEVIRGKAAAHKREVELRRAIMPTLNTDTRGD |
| Ga0255130_10529223 | 3300027335 | Freshwater | SLNDKSEIEVLVHETLRGKAVAHKREVELRRALKPVLNTDCRGD |
| Ga0209552_11540113 | 3300027563 | Freshwater Lake | LRSLNDKSEIEVLVHETLRGKAAAHKREVELRRAINPTLNTDVRGD |
| Ga0209552_11619641 | 3300027563 | Freshwater Lake | LNDKSEIEVLVHEIIRGKAAAHKREVELRRAINPTLNTDTRGD |
| Ga0209651_10553371 | 3300027581 | Freshwater Lake | YKSEIEVLIHEVVRGKAAAHKREVELRRAINPALNTDIRGD |
| Ga0255121_10922121 | 3300027598 | Freshwater | CRALRTLNDKSEIEVLVHETLRGKAAAHKREVALRRAINPTLNTDVRGD |
| Ga0208951_10234978 | 3300027621 | Freshwater Lentic | KTEIEIRVHEIIRGKAAAHKREVEIRRLINPILNTDIRGDLTV |
| Ga0209356_10479931 | 3300027644 | Freshwater Lake | NDKSEIEVLVHEIIRGKAAAHKREVELRRAINPTLNTDTRGD |
| Ga0209769_10714821 | 3300027679 | Freshwater Lake | KSEIEVLVHEVIRGKAEAHKREVALRRAINPTLNTDVRGD |
| Ga0209443_13046342 | 3300027707 | Freshwater Lake | LCQELRKLTDKGEIEVLIHEVVRGKAAAHKREVELRRAINPALNTDIRGD |
| Ga0209355_11845191 | 3300027744 | Freshwater Lake | SLNDKSEIQVLVHETLRGKSAAHKREVELRRAINPTLNTDVRGD |
| Ga0209189_102540110 | 3300027747 | Freshwater Lake | ASKEQIEIRVHEIVRGKAAAHRREVELRRALRPALNTDVRGD |
| Ga0209189_11883264 | 3300027747 | Freshwater Lake | ELRKLNDKSEIEVYVHEVIRGKAEAHKREVEIRRMVKPVLNTDVRGDLTAG |
| Ga0209444_101169311 | 3300027756 | Freshwater Lake | EVLIHEVVRGKAEAHKREVELRRQINPTLNTDVRGD |
| Ga0209444_101297341 | 3300027756 | Freshwater Lake | VLVHEIIRGKAAAHKREVELRRAINPTLNTDTRGD |
| Ga0209770_101206351 | 3300027769 | Freshwater Lake | ADKSEIEVLVHEVIRGKAAAHKREVELRRQLKPTLNTDVRGD |
| Ga0209246_103392371 | 3300027785 | Freshwater Lake | RKLTDKSEIEVLVHEVIRGKAEAHKREVELRRQINPTLNTDVRGD |
| Ga0209107_103601923 | 3300027797 | Freshwater And Sediment | EVYVHEVIRGKAAAHKREVELRRQINPTLNTDVRGD |
| Ga0209353_102487773 | 3300027798 | Freshwater Lake | SEIEVLVHEIIRGKAAAHKREVELRRAINPTLNTDTRGD |
| Ga0209353_104177521 | 3300027798 | Freshwater Lake | NDKSEIQVLVHETLRGKAVAHKREVELRRALKPVLNTDCRGD |
| Ga0209229_101323202 | 3300027805 | Freshwater And Sediment | IALRELNDKNEIEILVHEIVRGKADAHKREVEIRREVKPTLNTDKRNDHLYA |
| Ga0209354_101725744 | 3300027808 | Freshwater Lake | VLVHEVIRGKAAAHKREVELRRAINPTLNTDVRGD |
| Ga0209230_104871391 | 3300027836 | Freshwater And Sediment | LSDKSEIEVLVHEIVRGKAEAHKREVELRRAINPTLNTDVRGD |
| Ga0209191_11506981 | 3300027969 | Freshwater Lake | RELSDKSEIEIRIHEIIRGKAAAHKREVELRRLLQPALNTDTRGD |
| Ga0209191_13346683 | 3300027969 | Freshwater Lake | IEIRIHEIVRGKAAAHKREVEIRRAINPTLNTDIRGDLTAG |
| Ga0209702_100027551 | 3300027976 | Freshwater | SEIEVYVHEVIRGKAAAHLREVELRRLFKPTLNTDTRGD |
| Ga0247723_11365013 | 3300028025 | Deep Subsurface Sediment | IECYIHEVVRGKAEAHKREVEIRRAVKPVLNTDVRGD |
| Ga0304730_12521723 | 3300028394 | Freshwater Lake | HEIIRGKAAAHRREVEIRRAINPALNTDIRGDLTAG |
| Ga0255279_10086055 | 3300028530 | Freshwater | IIVHAVIRGKAAAHKEEVRIRREIKPTLNTDVRGD |
| (restricted) Ga0247844_13076832 | 3300028571 | Freshwater | LRKLNDKSEIEVYVHEVIRGKSAAHKREVEIRRMVKPVLNTDTRGD |
| Ga0307488_106879062 | 3300031519 | Sackhole Brine | ALRTLSDKSEIEVLVHGIVRGKAEAHRREVELRRSINPTLNTDVRGD |
| Ga0315899_102182891 | 3300031784 | Freshwater | LRDKSEIEVLVHEVVRGKAAAHKREVELRRLLNPALNTDCRGD |
| Ga0315909_104899162 | 3300031857 | Freshwater | CQALRALNSKDDIEIKVHEIVRGKALAHKREVEIRRTVRPALNTDVRGD |
| Ga0315905_115401983 | 3300032092 | Freshwater | NALRTLSDKSEIEVYVHEVVRGKAAAHKREVELRRAIMPTLNTDTRGD |
| Ga0316226_12988831 | 3300032562 | Freshwater | TSKDEIEILVHEIVRGKAEAHKREVQLRRQINPTLNTDVRGDSLTA |
| Ga0334992_0044865_2416_2547 | 3300033992 | Freshwater | LSDKSEIEVLVHEVVRGKAAAHKREVELRRAINPTLNTDVRGD |
| Ga0334996_0557220_1_117 | 3300033994 | Freshwater | EIEVLVHETLRGKAAAHKREVELRRIINPVLNTDRRGD |
| Ga0334991_0131841_1_117 | 3300034013 | Freshwater | EIEVLVHETLRGKAAAHKREVELRRTLRPELNTDCRGD |
| Ga0334985_0635936_435_587 | 3300034018 | Freshwater | LCAELRTLADKSEIEVYVHEVIRGKAAAHKREVEIRRMVKPALNTDVRGD |
| Ga0335004_0724113_378_509 | 3300034021 | Freshwater | LADKSEIEVLVHEVIRGKAAAHKREVELRRQLQPALNTDCRGD |
| Ga0335019_0290698_3_146 | 3300034066 | Freshwater | ELRKLADKSEIEVLVHEVVRGKAAAHKREVELRRLINPALNTDIRGD |
| Ga0334990_0400991_607_738 | 3300034068 | Freshwater | LADKSEIEVYVHEVIRGKAAAHVREVEIRRAVKPVLNTDTRGD |
| Ga0335028_0196602_3_110 | 3300034071 | Freshwater | IRIHEIIRGKAEAHKREVEIRRMIRPALNTDTRGD |
| Ga0335028_0521176_3_140 | 3300034071 | Freshwater | RGLNDKSEIEVLVHETLRGKAIAHKREVELRRILKPTLNTDTRGD |
| Ga0335012_0379832_582_695 | 3300034093 | Freshwater | IEVLVHETLRGKAAAHKREVELRRIINPVLNTDRRGD |
| Ga0335022_0434857_2_139 | 3300034095 | Freshwater | RKLADKSEIEVYVHEVIRGKGAAHKREVELRRMIKPALNTDVRGD |
| Ga0335031_0102011_1_111 | 3300034104 | Freshwater | EVYVHEVIRGKAAAHKREVELRRAINPALNTDIRGD |
| Ga0335007_0717704_3_110 | 3300034283 | Freshwater | VYVHEIVRGKAAAHRREVELRRQLKPALNTDTRGD |
| Ga0335013_0269980_962_1093 | 3300034284 | Freshwater | LADKSEIEVYVHEVIRGKGAAHKREVELRRMIKPALNTDVRGD |
| ⦗Top⦘ |