| Basic Information | |
|---|---|
| Family ID | F059853 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 47 residues |
| Representative Sequence | SVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRGVIRGEP |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.74 % |
| % of genes from short scaffolds (< 2000 bps) | 92.48 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.985 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.060 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.105 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 15.28% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 77.44 |
| PF07228 | SpoIIE | 15.04 |
| PF00989 | PAS | 1.50 |
| PF00756 | Esterase | 0.75 |
| PF08448 | PAS_4 | 0.75 |
| PF08450 | SGL | 0.75 |
| PF01740 | STAS | 0.75 |
| PF13492 | GAF_3 | 0.75 |
| PF00814 | TsaD | 0.75 |
| PF13185 | GAF_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.75 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.98 % |
| Unclassified | root | N/A | 6.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100966493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300005172|Ga0066683_10475974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300005175|Ga0066673_10420377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300005344|Ga0070661_100614133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 880 | Open in IMG/M |
| 3300005347|Ga0070668_100759891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 859 | Open in IMG/M |
| 3300005355|Ga0070671_101566180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 584 | Open in IMG/M |
| 3300005434|Ga0070709_10237281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria | 1308 | Open in IMG/M |
| 3300005435|Ga0070714_101227402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300005435|Ga0070714_101725440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300005439|Ga0070711_100393366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1123 | Open in IMG/M |
| 3300005455|Ga0070663_100021432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4299 | Open in IMG/M |
| 3300005764|Ga0066903_108161963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 536 | Open in IMG/M |
| 3300005843|Ga0068860_100028370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5387 | Open in IMG/M |
| 3300006162|Ga0075030_100525204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 941 | Open in IMG/M |
| 3300006755|Ga0079222_11800922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300006755|Ga0079222_12135540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300006881|Ga0068865_100088046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria | 2246 | Open in IMG/M |
| 3300006954|Ga0079219_10299701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 995 | Open in IMG/M |
| 3300007255|Ga0099791_10560566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300009011|Ga0105251_10009229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5847 | Open in IMG/M |
| 3300009038|Ga0099829_10856074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 755 | Open in IMG/M |
| 3300009522|Ga0116218_1129410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1148 | Open in IMG/M |
| 3300010159|Ga0099796_10581986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300010358|Ga0126370_11132778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300010373|Ga0134128_12789154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium phraense | 538 | Open in IMG/M |
| 3300010376|Ga0126381_102021576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 830 | Open in IMG/M |
| 3300010397|Ga0134124_11548659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300010398|Ga0126383_11415409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300011120|Ga0150983_16282432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300012199|Ga0137383_10078520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2384 | Open in IMG/M |
| 3300012359|Ga0137385_10191331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1789 | Open in IMG/M |
| 3300012491|Ga0157329_1022738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300012683|Ga0137398_10460092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
| 3300012930|Ga0137407_10551528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1079 | Open in IMG/M |
| 3300012958|Ga0164299_11067570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300012989|Ga0164305_12037908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300013100|Ga0157373_10374866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1017 | Open in IMG/M |
| 3300013100|Ga0157373_11460361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300014169|Ga0181531_10154694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1387 | Open in IMG/M |
| 3300014969|Ga0157376_11840120 | Not Available | 642 | Open in IMG/M |
| 3300015356|Ga0134073_10364894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300016270|Ga0182036_10428575 | Not Available | 1036 | Open in IMG/M |
| 3300017970|Ga0187783_11365700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 510 | Open in IMG/M |
| 3300018044|Ga0187890_10233683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1037 | Open in IMG/M |
| 3300018057|Ga0187858_10411897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 838 | Open in IMG/M |
| 3300018482|Ga0066669_10183418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1582 | Open in IMG/M |
| 3300019888|Ga0193751_1222373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300020069|Ga0197907_10668765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 926 | Open in IMG/M |
| 3300020580|Ga0210403_10884148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300020581|Ga0210399_10521959 | Not Available | 986 | Open in IMG/M |
| 3300020581|Ga0210399_11377078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300021170|Ga0210400_11493638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300021181|Ga0210388_11366974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
| 3300021374|Ga0213881_10469300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300021405|Ga0210387_10772585 | Not Available | 849 | Open in IMG/M |
| 3300021432|Ga0210384_10911136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300021479|Ga0210410_10587122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 990 | Open in IMG/M |
| 3300021559|Ga0210409_10282191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1499 | Open in IMG/M |
| 3300021560|Ga0126371_10985127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 985 | Open in IMG/M |
| 3300024232|Ga0247664_1043982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1035 | Open in IMG/M |
| 3300024323|Ga0247666_1044255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 909 | Open in IMG/M |
| 3300025320|Ga0209171_10310957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 837 | Open in IMG/M |
| 3300025916|Ga0207663_10661295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300025929|Ga0207664_11233435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300025929|Ga0207664_11323536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Cryptosporangiales → Cryptosporangiaceae → Cryptosporangium → Cryptosporangium phraense | 640 | Open in IMG/M |
| 3300025929|Ga0207664_12002082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300026498|Ga0257156_1108782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300026552|Ga0209577_10474194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
| 3300027030|Ga0208240_1020952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300027047|Ga0208730_1018319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300027307|Ga0209327_1047276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300027370|Ga0209010_1098202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300027504|Ga0209114_1006248 | Not Available | 1728 | Open in IMG/M |
| 3300027775|Ga0209177_10002990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura atramentaria | 3248 | Open in IMG/M |
| 3300027787|Ga0209074_10120905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 910 | Open in IMG/M |
| 3300027787|Ga0209074_10191939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300027829|Ga0209773_10380235 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027853|Ga0209274_10048563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2009 | Open in IMG/M |
| 3300027895|Ga0209624_10889432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300028906|Ga0308309_10382455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1204 | Open in IMG/M |
| 3300028906|Ga0308309_10406839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1168 | Open in IMG/M |
| 3300028906|Ga0308309_11791628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300029636|Ga0222749_10703817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300029943|Ga0311340_10238081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1789 | Open in IMG/M |
| 3300030618|Ga0311354_10293425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1685 | Open in IMG/M |
| 3300031231|Ga0170824_100090464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 915 | Open in IMG/M |
| 3300031231|Ga0170824_105911206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300031231|Ga0170824_128007305 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031236|Ga0302324_100634723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1523 | Open in IMG/M |
| 3300031543|Ga0318516_10155843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1313 | Open in IMG/M |
| 3300031549|Ga0318571_10034557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1428 | Open in IMG/M |
| 3300031572|Ga0318515_10163349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1189 | Open in IMG/M |
| 3300031573|Ga0310915_10891734 | Not Available | 623 | Open in IMG/M |
| 3300031713|Ga0318496_10098451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1567 | Open in IMG/M |
| 3300031718|Ga0307474_10357542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1132 | Open in IMG/M |
| 3300031719|Ga0306917_11214881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300031720|Ga0307469_10678340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
| 3300031723|Ga0318493_10049526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1982 | Open in IMG/M |
| 3300031723|Ga0318493_10405009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300031723|Ga0318493_10821260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300031736|Ga0318501_10180144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1099 | Open in IMG/M |
| 3300031754|Ga0307475_10673485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300031754|Ga0307475_11454431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300031770|Ga0318521_10043221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2289 | Open in IMG/M |
| 3300031770|Ga0318521_10162092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1275 | Open in IMG/M |
| 3300031879|Ga0306919_10915594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300031910|Ga0306923_11344373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
| 3300031912|Ga0306921_12562273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300031938|Ga0308175_101393671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300031938|Ga0308175_101472630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300031938|Ga0308175_102065340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300032009|Ga0318563_10429532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300032160|Ga0311301_10727340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1386 | Open in IMG/M |
| 3300032174|Ga0307470_10192212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1295 | Open in IMG/M |
| 3300032180|Ga0307471_101044986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 983 | Open in IMG/M |
| 3300032205|Ga0307472_101912680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300032770|Ga0335085_10578155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1268 | Open in IMG/M |
| 3300032782|Ga0335082_10549736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1016 | Open in IMG/M |
| 3300032828|Ga0335080_11427243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
| 3300032829|Ga0335070_10309703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1528 | Open in IMG/M |
| 3300032895|Ga0335074_10492223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1277 | Open in IMG/M |
| 3300032896|Ga0335075_11330549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300032897|Ga0335071_11001091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300032898|Ga0335072_11045639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300033158|Ga0335077_10967281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 852 | Open in IMG/M |
| 3300033158|Ga0335077_11515306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300033412|Ga0310810_11414952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300033829|Ga0334854_091994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300034124|Ga0370483_0268950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300034163|Ga0370515_0143320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1025 | Open in IMG/M |
| 3300034818|Ga0373950_0039036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 903 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.50% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1009664932 | 3300004152 | Bog Forest Soil | LLARLPASVPAIIITGADVPSPPRAAALLRKDELTRERLEFTIRGIIRGAP* |
| Ga0066683_104759742 | 3300005172 | Soil | GMDGSALLARLPASVPAIIVTGADVPPSPRAAAVLRKDELTRERLEFTLRGVIRERS* |
| Ga0066673_104203772 | 3300005175 | Soil | MDGSALLARLPASMPVIIVTGADVLPPPRAAALLRKDELTRERLEFTLRGIIRSPS* |
| Ga0070661_1006141331 | 3300005344 | Corn Rhizosphere | PAIVITSADLRPPPRAAALLRKDELTAERLEFTIRAVIGGPS* |
| Ga0070668_1007598911 | 3300005347 | Switchgrass Rhizosphere | PAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP* |
| Ga0070671_1015661801 | 3300005355 | Switchgrass Rhizosphere | GLDGGALLARLPAEVPAIVITSADLRPPPRAAALLRKDELTAERLEFTIRAVIGGPS* |
| Ga0070709_102372811 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DGGALLARLPAAIPAIVITSADLRPPARAAALLRKDELTRERLEFTLRAVIREAP* |
| Ga0070714_1012274021 | 3300005435 | Agricultural Soil | RLPASVPAIIVTGADVLPPPRAAAMLRKDELTRERLEFTLRGIIRGPS* |
| Ga0070714_1017254401 | 3300005435 | Agricultural Soil | ATVPAIIVTGADVTPPPRAAAMLRKDELTRDRLEFTLRVIGGGP* |
| Ga0070711_1003933662 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLARLPAEVPAIVITSADLRPPPRAAALLRKDELTAERLEFTIRAVIGGPS* |
| Ga0070663_1000214321 | 3300005455 | Corn Rhizosphere | PAIIVTGADVTPPPRAAAMLRKDELTRDRLEFTLRVIRGEP* |
| Ga0066903_1081619631 | 3300005764 | Tropical Forest Soil | PGLDGAALLARLPAAVPAIIITGADVPPPPRAAALLRKDEITRERLEFTIRGVIGGAP* |
| Ga0068860_1000283701 | 3300005843 | Switchgrass Rhizosphere | TVPAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP* |
| Ga0075030_1005252041 | 3300006162 | Watersheds | LDRLPASVPAIIITGADVPPPPRAAALLRKDELTRERLEFTIRGVIRGTP* |
| Ga0079222_118009222 | 3300006755 | Agricultural Soil | TGADVAPPPRAAAMLRKDELTRERLEFTLRVIRGEP* |
| Ga0079222_121355402 | 3300006755 | Agricultural Soil | AIVITSADLRPPPRAAALLRKDELTAERLEFTIRAVIGGPS* |
| Ga0068865_1000880461 | 3300006881 | Miscanthus Rhizosphere | VPAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP* |
| Ga0079219_102997011 | 3300006954 | Agricultural Soil | IVTGADVTPPPRAAAVLRKDELTRDRLEFTLRVIWGKP* |
| Ga0099791_105605662 | 3300007255 | Vadose Zone Soil | PASVPAIVVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIFRGPS* |
| Ga0105251_100092295 | 3300009011 | Switchgrass Rhizosphere | PASVPAIIVTGAEVAPPPRAAAMLRKDELTRDRLEFTLRGIIRSPS* |
| Ga0099829_108560742 | 3300009038 | Vadose Zone Soil | LARLPGSVPAIIITGADVPPPPRAAALLRKDELTRERLEFTIRGIIRGAP* |
| Ga0116218_11294101 | 3300009522 | Peatlands Soil | DGGTLLARLPAALPAIIITGADLPPPPRAAALLRKDELTRERLEFTIRGVIRGTP* |
| Ga0099796_105819862 | 3300010159 | Vadose Zone Soil | MPGMDGSALLARLPASVPAIIVTGADVPAPTRAAAVLRKDELTRERLEFTLRGIIRSPS* |
| Ga0126370_111327781 | 3300010358 | Tropical Forest Soil | GTALLARLPARVPVIVVTGADVPPPPRAAGVLRKDELTRERLEFTLRGVLGRTS* |
| Ga0134128_127891542 | 3300010373 | Terrestrial Soil | LPAAVPAIVITSADLRPPPRAAALLRKDELTAERLEFTILAVIGGPS* |
| Ga0126381_1020215762 | 3300010376 | Tropical Forest Soil | DVPPPPRAAAVLRKDELTRERLEFTLRAVIRDPS* |
| Ga0134124_115486591 | 3300010397 | Terrestrial Soil | RLPATVPAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP* |
| Ga0126383_114154091 | 3300010398 | Tropical Forest Soil | MPGVDGTALLARLPASVPAIIVTGADVPPSPRAAAVLRKDELTRERLEFTLRGVIRGEP* |
| Ga0150983_162824322 | 3300011120 | Forest Soil | VPAILVTGADVPLPARASAMLRKDELTRERLEFTIRGVIRSPR* |
| Ga0137383_100785201 | 3300012199 | Vadose Zone Soil | ALLARLPASVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRGVMRGPS* |
| Ga0137385_101913312 | 3300012359 | Vadose Zone Soil | LPASVPAIIITGADVPPPPRAAALLRKDELTRERLEFTVRGVIRGAP* |
| Ga0157329_10227382 | 3300012491 | Arabidopsis Rhizosphere | PAIIVTGADVTPPPRAAAVLRKDELTRDRLEFTLRVIWGKP* |
| Ga0137398_104600922 | 3300012683 | Vadose Zone Soil | LLARLPVSVPAVVVTGADVPAPPRAAAVLRKDELTRGRLEFTLRGVIRGPS* |
| Ga0137407_105515281 | 3300012930 | Vadose Zone Soil | MDGSALLARLPASVPAIIVTGADVLPPTRAAAMLRKDELTRERLEFTLRGIIRSPS* |
| Ga0164299_110675702 | 3300012958 | Soil | MDGSALLARLPASVPAIIVTGADVLPPPRAAAMLRKDELTRERLEFTLRGIIRSPS* |
| Ga0164305_120379082 | 3300012989 | Soil | PGMDGRALLARLPASVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIIRSPS* |
| Ga0157373_103748662 | 3300013100 | Corn Rhizosphere | ADVTPPPRAAAMLRKDELTRDRLEFTLRVIRGEP* |
| Ga0157373_114603612 | 3300013100 | Corn Rhizosphere | RALLARLPASVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIIRSPS* |
| Ga0181531_101546941 | 3300014169 | Bog | PAIVITGADAPAPPGAAALLRKDELTRERLEFAIRGVLGGAR* |
| Ga0157376_118401201 | 3300014969 | Miscanthus Rhizosphere | TVPAIIVTGADVTPPPRAAAMLRKDELTRDRLEFTLRGMIRSPS* |
| Ga0134073_103648942 | 3300015356 | Grasslands Soil | VPAIIVTGADVPSPPRAAAMLRKDELTRERLEFTLRGVLGRTP* |
| Ga0182036_104285751 | 3300016270 | Soil | LLARLPAPVPAIVVTGADGPPPPRAAAVLRKDELTRERLEFTLRVVIRGES |
| Ga0187783_113657001 | 3300017970 | Tropical Peatland | IIITGADVATPPRAAALLRKDELTRERLEFTIRTVLREIP |
| Ga0187890_102336831 | 3300018044 | Peatland | ASVPAIIVTSADGPAPPRAAALLCKDELTRERLEFTIRGVIRSTP |
| Ga0187858_104118972 | 3300018057 | Peatland | ARLPASVPAIIITGADVPAPPRTAALLRKDELTPDRLEFTIRGVLREVRGAAR |
| Ga0066669_101834182 | 3300018482 | Grasslands Soil | SALLARLPATVPAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP |
| Ga0193751_12223732 | 3300019888 | Soil | ITGADVPPPPRAAALLRKDELTAERLEFTIRGVIRSAP |
| Ga0197907_106687651 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GMDGSALLARLPATVPAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP |
| Ga0210403_108841482 | 3300020580 | Soil | MDGAALLARLPVSVPAIVVTGADVPAPPRAAAVLRKDELTRERLEFTLRGIIRGPS |
| Ga0210399_105219592 | 3300020581 | Soil | AIIITGADTPPPPRAAALLKKDELTRERLEFTIRGIIRSSP |
| Ga0210399_113770781 | 3300020581 | Soil | SVPAIIVTGADVPPPPRAAAMLRKDELTRERLEFTLRGIIRSPS |
| Ga0210400_114936381 | 3300021170 | Soil | SRLPASIPAILVTGADVPLPARASAMLRKDELTRERLEFTIRGVIRSPS |
| Ga0210388_113669742 | 3300021181 | Soil | VITGADAPPPPGAAAMLRKDELTRERLEFTIRGVLGGAR |
| Ga0213881_104693001 | 3300021374 | Exposed Rock | TVIITGADVPTPPRAGALLRKDELTRERLEFAIRGILREAA |
| Ga0210385_107685722 | 3300021402 | Soil | PAIVITGHDEPPPPRAAALLRKDELTRERLAFTIRRVIRGTR |
| Ga0210387_107725851 | 3300021405 | Soil | VPAIIITGADTPPPPRAAALLKKDELTRERLEFTIRGIIRSSS |
| Ga0210384_109111362 | 3300021432 | Soil | RLPVSVPAIVVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIIRGPS |
| Ga0210410_105871221 | 3300021479 | Soil | LARLPVSVPAIVVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIIRGPS |
| Ga0210409_102821911 | 3300021559 | Soil | PGMDGTALLARLPVLVPAIVVTGADVPAPPRAAAVLRKDELTRERLEFTLRGIIRGPS |
| Ga0126371_109851272 | 3300021560 | Tropical Forest Soil | LARLPAPVSAIVVTAADAPPPPRAAAVLRKDELTRERLEFTLRAVIRSEP |
| Ga0247664_10439822 | 3300024232 | Soil | PATVPAIIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP |
| Ga0247666_10442552 | 3300024323 | Soil | GADVTPLPRAAAMLRKDELTRERLEFTLRVIRGEP |
| Ga0209171_103109572 | 3300025320 | Iron-Sulfur Acid Spring | VPAILVTSADVPAPARAAAMLRKDELTRERLEFTIRGVFRSPS |
| Ga0207663_106612952 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GGALLARLPAEVPAIVITSADLRPPPRAAALLRKDELTAERLEFTIRAVIGRPS |
| Ga0207664_112334352 | 3300025929 | Agricultural Soil | PAAVPAIIITSADLRPPPRAAALLRKDELTAERLEFTIRAVIGRPS |
| Ga0207664_113235362 | 3300025929 | Agricultural Soil | TSADLRPPPRAAALLRKDELTAERLEFTIRAVIGGPS |
| Ga0207664_120020821 | 3300025929 | Agricultural Soil | IVTGADVPAPTRAAAVLRKDELTRERLEFTLRGIIRSPS |
| Ga0257156_11087822 | 3300026498 | Soil | MDGGALLARLPAAVPAIVVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIFRGPS |
| Ga0209577_104741941 | 3300026552 | Soil | MPGMDGSALLARLPATVPAIIVTGADVLPPPRAAAMLRKDELTRERLEFTLRGIIRSPS |
| Ga0208240_10209522 | 3300027030 | Forest Soil | ASVPAIIITGADVPPPPRAAALLRKDELTRERLEFTIRGVIRGAP |
| Ga0208730_10183192 | 3300027047 | Forest Soil | LPASIPAILVTGADVPLPARASAMLRKDELTRERLEFTIRGVIRSPS |
| Ga0209327_10472762 | 3300027307 | Forest Soil | SVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRGVIRGEP |
| Ga0209010_10982021 | 3300027370 | Forest Soil | ARLPVAIPAIIITGADAPAPPGAAALLRKDELTRERLEFTIRGVLGGAR |
| Ga0209114_10062482 | 3300027504 | Forest Soil | IITGTDMAAPPRAAALLRKDQLTSERLEFTLRGIFGRTQ |
| Ga0209177_100029901 | 3300027775 | Agricultural Soil | GGALLARLPASVPAIIVTGADVAPPPRAAAMLRKDELTRERLEFTLRVIRGEP |
| Ga0209074_101209051 | 3300027787 | Agricultural Soil | TVPAIIVTGADVTPPPRAAAMLRKDELTRDRLEFTLRVIRGEP |
| Ga0209074_101919391 | 3300027787 | Agricultural Soil | LPAIIVTGADVPLPPRAAAVLRKDELTRNRLEFTLRGVVREAS |
| Ga0209773_103802351 | 3300027829 | Bog Forest Soil | AELPRPPRAAALLRKDELTAERLEFTIRGVIRGVSRGAP |
| Ga0209274_100485633 | 3300027853 | Soil | PAAIPAIVITGADAPPPPGAAALLRKDELTRERLEFTIRGVLGGAR |
| Ga0209624_108894321 | 3300027895 | Forest Soil | GGTLLSRLPAALPAILVTGADVPLPARAAALLRKDELTRERLEFTIRAVISSSGRPR |
| Ga0308309_103824551 | 3300028906 | Soil | LPASVPAILVTSADVPAPARAAAMLRKDELTRERLEFTIRGVIRSPS |
| Ga0308309_104068391 | 3300028906 | Soil | ADVPPPARAAAMLRKDELTRERLEFTLRGIIRSPS |
| Ga0308309_117916282 | 3300028906 | Soil | IITGADVLPPPRAAALLRKDELTRERLEFTIRGIIRGAS |
| Ga0222749_107038171 | 3300029636 | Soil | AIVVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIIRGPS |
| Ga0311340_102380812 | 3300029943 | Palsa | ASIPAILVTGADVAPPARASAMLRKDELTRDRLEFTIRGVIRSP |
| Ga0311354_102934252 | 3300030618 | Palsa | SADVALPARAAAMLRKDELTRERLEFTIRGVIRSS |
| Ga0170824_1000904642 | 3300031231 | Forest Soil | SVPAIVVTGADVPAPPRAAAVLRKDELTRERLEFTLRRVIRGPS |
| Ga0170824_1059112061 | 3300031231 | Forest Soil | AIVITGHDEPTPPRAAALLRKDELTRERLAFTIRRVIRGTR |
| Ga0170824_1280073052 | 3300031231 | Forest Soil | LARLPASVPAIIVTGADVPPPPRAAAMLRKDELTRERLEFTLRGIIRSPS |
| Ga0302324_1006347231 | 3300031236 | Palsa | LPASVPAIIITGADAPRPPRAAALLHKDELTRERLEFTIRAVLRRAR |
| Ga0318516_101558431 | 3300031543 | Soil | IVVTGADGPPPPRAAAVLRKDELTRERLEFTLRAVIREER |
| Ga0318571_100345572 | 3300031549 | Soil | LLARLPASVPAIVVTGADEPAPPRAAAVLRKDELTRERLEFTLRVVIRGES |
| Ga0318515_101633492 | 3300031572 | Soil | MDGTALLARLPASVPAIIVTGADGPAPPRAAAVLRKDELTRERLEFTLRVVIRGES |
| Ga0310915_108917341 | 3300031573 | Soil | VVTGADVPPPSRASGVLRKDELTRERLEFALRGVIRGEP |
| Ga0318496_100984511 | 3300031713 | Soil | LLARLPAPVPAIVVTGADGPPLPRAAAVLRKDELTRERLEFTLRAVIREER |
| Ga0307474_103575421 | 3300031718 | Hardwood Forest Soil | PAIIVTGADVAPPPRAAAMLRKDELTRDRLEFTLRGIIRSPS |
| Ga0306917_112148812 | 3300031719 | Soil | LLARLPAQVPAIVVTGADVPPPSRASGVLRKDELTRERLEFALRGVIRGEP |
| Ga0307469_106783401 | 3300031720 | Hardwood Forest Soil | MRMPGMDGSALLARLPASVPVIIVTGADVLPPPRAAAMLRKDELTRERLEFTLRRIIRSP |
| Ga0318493_100495261 | 3300031723 | Soil | MDGTALLARLPAQVPAIVVTGADVPPPSRASGVLRKDELTRERLEFALRGVIRGEP |
| Ga0318493_104050091 | 3300031723 | Soil | LARLPASVPAIIVTGADEPAPPRAAAVLRKDELTRERLEFTLRVVIRGES |
| Ga0318493_108212602 | 3300031723 | Soil | LARLPATVPAIIITGADVPSPPRAAALLRKDELTRERLEFTIRGVIGGTA |
| Ga0318501_101801442 | 3300031736 | Soil | RLPAQVPAIVVTGADVPPPSRASGVLRKDELTRERLEFALRGVIRGEP |
| Ga0307475_106734852 | 3300031754 | Hardwood Forest Soil | LVTGADVPVPARAAAMLRKDELTRERLEFTIRGVIRSPR |
| Ga0307475_114544312 | 3300031754 | Hardwood Forest Soil | ALLARLPASVPAIIVTGADVSPPPRAAALIRKDELTRERLEFTLRRIIRSPS |
| Ga0318521_100432211 | 3300031770 | Soil | DGTALLARLPAQVPAIVVTGADVPPPSRASGVLRKDELTRERLEFALRGVIRGEP |
| Ga0318521_101620921 | 3300031770 | Soil | PCAARPPRAAAVLRKDELTRERLEFTLRAVIREEP |
| Ga0306919_109155942 | 3300031879 | Soil | TALLARLPASVPAIIVTGADEPAPPRAAAVLRKDELTRERLEFTLRVVIRGES |
| Ga0306923_113443732 | 3300031910 | Soil | LPAQVPAIVVTGADGPPPPRAAAVLRKDELTRERLEFTLRAVIREER |
| Ga0306921_125622732 | 3300031912 | Soil | LARLPAPVPAIVVTGADGPPPPRAAAELRKDELTRERLEFTLRAVIREKR |
| Ga0308175_1013936712 | 3300031938 | Soil | LPVALPAIIVTGADVPAPPRAAAVLRKDELTRDRLEFTLRGVIREAS |
| Ga0308175_1014726302 | 3300031938 | Soil | ITSADLRPPARAAALLRKDELTSERLEFTIRAVIGGPS |
| Ga0308175_1020653401 | 3300031938 | Soil | ALLARLPAAVPAIIVTGADVPPPARAAAVLRKDELTRDRLEFTLRVIRGER |
| Ga0307479_111633861 | 3300031962 | Hardwood Forest Soil | VPAIVITALDGQPPAPAAAQLRKDELTRERLAFTIRAIKEDG |
| Ga0318563_104295322 | 3300032009 | Soil | PCAARPPRAAAVLRKDELTRERLEFTLRAVIREER |
| Ga0311301_107273404 | 3300032160 | Peatlands Soil | MRMPGMDGDTLLARLPASVPAIIVTGADGPAPPRAAALLRKDELTRERLKFTIRGVIRGR |
| Ga0307470_101922122 | 3300032174 | Hardwood Forest Soil | LARLPATVPAIIVTGADVTPPPRAAAVLRKDELTRERLEFTLRGIIRSPS |
| Ga0307471_1010449862 | 3300032180 | Hardwood Forest Soil | GMDGRALLARLPASVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRGIIRSPS |
| Ga0307472_1019126801 | 3300032205 | Hardwood Forest Soil | VDGAALLARLPGPVPAIVVTGADVPPPPRAAAVLRKDELTRERLEFTLRGVIRGEP |
| Ga0335085_105781552 | 3300032770 | Soil | AIVVTGADVPPLPRAAAVLRKDELTRERLEFTLRCVIRGPS |
| Ga0335082_105497361 | 3300032782 | Soil | LPASVPAIIVTGADVPPPPRAAAVLRKDELTRERLEFTLRVALRGEP |
| Ga0335080_114272432 | 3300032828 | Soil | RLPGSLPAIVVTGADVPPPRAAAVLRKDELTRERLEFTIRAAVRDEK |
| Ga0335070_103097032 | 3300032829 | Soil | IVLTGADGPPLPRAAAVLRKDELTRERLEFTLRAVIREER |
| Ga0335074_104922232 | 3300032895 | Soil | GADAPPPPGAAALLRKDELTRERLEFTIRDVLGGGAG |
| Ga0335075_113305492 | 3300032896 | Soil | ARLPAALPAVIITSADVRPPARAAALLRKDELTRERLEFTLRGVLREAP |
| Ga0335071_110010911 | 3300032897 | Soil | SVPAIVVTGADVPPPPRAAAVLQKDELTRERLEFTLRGVIRDES |
| Ga0335072_110456392 | 3300032898 | Soil | TTRDRPQRADALLRKDELTRERLAFTIRRVLREGR |
| Ga0335077_109672811 | 3300033158 | Soil | RLPATIPAIIVTGADAPPPPGAAALLRKDELTRERLEFTIRNVLGGATR |
| Ga0335077_115153062 | 3300033158 | Soil | TGADVPAPARAAALLRKDELTRERLEFAIRAAIWGKA |
| Ga0310810_114149521 | 3300033412 | Soil | VPAIIVTGADVRPPPRAAAVLRKDELTRDRLEFTLRGIIRSPS |
| Ga0334854_091994_1_132 | 3300033829 | Soil | SIPAILVTGADVAPPARASAMLRKDELTRDRLEFTIRGVIRSS |
| Ga0370483_0268950_1_192 | 3300034124 | Untreated Peat Soil | MPGLDGNALLARLPASLPAIVITGADLPPPPRAAAVLRKDELTAERLEFTIRAVLRGDPRGAR |
| Ga0370515_0143320_872_1024 | 3300034163 | Untreated Peat Soil | LTQLPVSLPAIVITGADVPPLPRAGAVLRKDELTAERLEFTIRAVLRGTR |
| Ga0373950_0039036_784_903 | 3300034818 | Rhizosphere Soil | IIVTGADVTPPPRAAAMLRKDELTRERLEFTLRVIRGEP |
| ⦗Top⦘ |