| Basic Information | |
|---|---|
| Family ID | F059784 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAPQRKSFPRIFLARAEPFRLVGERVFLRSPERGDYEDWASLR |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.12 % |
| % of genes near scaffold ends (potentially truncated) | 96.24 % |
| % of genes from short scaffolds (< 2000 bps) | 94.74 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.677 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.579 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.331 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.120 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.04% β-sheet: 11.27% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF05193 | Peptidase_M16_C | 86.47 |
| PF13302 | Acetyltransf_3 | 1.50 |
| PF00291 | PALP | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.68 % |
| All Organisms | root | All Organisms | 29.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10169011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 885 | Open in IMG/M |
| 3300005093|Ga0062594_101102122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 776 | Open in IMG/M |
| 3300005171|Ga0066677_10257722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 992 | Open in IMG/M |
| 3300005172|Ga0066683_10376964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 879 | Open in IMG/M |
| 3300005184|Ga0066671_10870278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 572 | Open in IMG/M |
| 3300005471|Ga0070698_101581047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 607 | Open in IMG/M |
| 3300005538|Ga0070731_10229389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1233 | Open in IMG/M |
| 3300005602|Ga0070762_10676001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 691 | Open in IMG/M |
| 3300005764|Ga0066903_106242061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 623 | Open in IMG/M |
| 3300005843|Ga0068860_102775878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 508 | Open in IMG/M |
| 3300005947|Ga0066794_10259687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 521 | Open in IMG/M |
| 3300006031|Ga0066651_10443028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 690 | Open in IMG/M |
| 3300006800|Ga0066660_11070579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 642 | Open in IMG/M |
| 3300006893|Ga0073928_10232006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1423 | Open in IMG/M |
| 3300009094|Ga0111539_10544364 | Not Available | 1352 | Open in IMG/M |
| 3300009174|Ga0105241_12592014 | Not Available | 509 | Open in IMG/M |
| 3300010046|Ga0126384_10353221 | Not Available | 1226 | Open in IMG/M |
| 3300010046|Ga0126384_12492758 | Not Available | 502 | Open in IMG/M |
| 3300010048|Ga0126373_12771490 | Not Available | 547 | Open in IMG/M |
| 3300010358|Ga0126370_10892237 | Not Available | 802 | Open in IMG/M |
| 3300010361|Ga0126378_13187608 | Not Available | 522 | Open in IMG/M |
| 3300010366|Ga0126379_10662543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1135 | Open in IMG/M |
| 3300010375|Ga0105239_11095576 | Not Available | 917 | Open in IMG/M |
| 3300010376|Ga0126381_101866225 | Not Available | 867 | Open in IMG/M |
| 3300010396|Ga0134126_10177648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2562 | Open in IMG/M |
| 3300010397|Ga0134124_11678433 | Not Available | 667 | Open in IMG/M |
| 3300010399|Ga0134127_12501080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 596 | Open in IMG/M |
| 3300011120|Ga0150983_13147235 | Not Available | 909 | Open in IMG/M |
| 3300011120|Ga0150983_14021658 | Not Available | 1179 | Open in IMG/M |
| 3300011269|Ga0137392_11178049 | Not Available | 624 | Open in IMG/M |
| 3300011271|Ga0137393_10362546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1239 | Open in IMG/M |
| 3300012078|Ga0153999_1062260 | Not Available | 702 | Open in IMG/M |
| 3300012180|Ga0153974_1039772 | Not Available | 1025 | Open in IMG/M |
| 3300012181|Ga0153922_1082467 | Not Available | 724 | Open in IMG/M |
| 3300012200|Ga0137382_11135600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 557 | Open in IMG/M |
| 3300012203|Ga0137399_11390517 | Not Available | 588 | Open in IMG/M |
| 3300012212|Ga0150985_122727402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300012469|Ga0150984_103218045 | Not Available | 1245 | Open in IMG/M |
| 3300012917|Ga0137395_10546844 | Not Available | 835 | Open in IMG/M |
| 3300012917|Ga0137395_10641280 | Not Available | 768 | Open in IMG/M |
| 3300012923|Ga0137359_10340319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1334 | Open in IMG/M |
| 3300012971|Ga0126369_11314765 | Not Available | 813 | Open in IMG/M |
| 3300014162|Ga0181538_10141923 | Not Available | 1384 | Open in IMG/M |
| 3300014165|Ga0181523_10316441 | Not Available | 879 | Open in IMG/M |
| 3300016294|Ga0182041_10930508 | Not Available | 783 | Open in IMG/M |
| 3300016294|Ga0182041_12244558 | Not Available | 510 | Open in IMG/M |
| 3300016319|Ga0182033_11706432 | Not Available | 571 | Open in IMG/M |
| 3300016341|Ga0182035_11976449 | Not Available | 530 | Open in IMG/M |
| 3300016371|Ga0182034_10979072 | Not Available | 730 | Open in IMG/M |
| 3300016387|Ga0182040_10912398 | Not Available | 729 | Open in IMG/M |
| 3300016404|Ga0182037_10314885 | Not Available | 1263 | Open in IMG/M |
| 3300016404|Ga0182037_11163905 | Not Available | 676 | Open in IMG/M |
| 3300018012|Ga0187810_10155074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 920 | Open in IMG/M |
| 3300018062|Ga0187784_10157850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1853 | Open in IMG/M |
| 3300018090|Ga0187770_11334710 | Not Available | 582 | Open in IMG/M |
| 3300020199|Ga0179592_10524845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 505 | Open in IMG/M |
| 3300020580|Ga0210403_10990528 | Not Available | 658 | Open in IMG/M |
| 3300020583|Ga0210401_10252632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1622 | Open in IMG/M |
| 3300021178|Ga0210408_11068302 | Not Available | 622 | Open in IMG/M |
| 3300021181|Ga0210388_11152124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300021384|Ga0213876_10465957 | Not Available | 672 | Open in IMG/M |
| 3300021476|Ga0187846_10039929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2098 | Open in IMG/M |
| 3300021476|Ga0187846_10492183 | Not Available | 501 | Open in IMG/M |
| 3300021477|Ga0210398_10632073 | Not Available | 868 | Open in IMG/M |
| 3300021479|Ga0210410_10381607 | Not Available | 1263 | Open in IMG/M |
| 3300021953|Ga0213880_10147944 | Not Available | 640 | Open in IMG/M |
| 3300022528|Ga0242669_1019010 | Not Available | 979 | Open in IMG/M |
| 3300022709|Ga0222756_1006141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1260 | Open in IMG/M |
| 3300022726|Ga0242654_10071372 | Not Available | 1033 | Open in IMG/M |
| 3300024288|Ga0179589_10427955 | Not Available | 609 | Open in IMG/M |
| 3300024290|Ga0247667_1098631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 538 | Open in IMG/M |
| 3300025945|Ga0207679_11104371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 728 | Open in IMG/M |
| 3300026332|Ga0209803_1251163 | Not Available | 610 | Open in IMG/M |
| 3300026355|Ga0257149_1062919 | Not Available | 541 | Open in IMG/M |
| 3300026481|Ga0257155_1061388 | Not Available | 596 | Open in IMG/M |
| 3300026514|Ga0257168_1109210 | Not Available | 616 | Open in IMG/M |
| 3300026527|Ga0209059_1199895 | Not Available | 677 | Open in IMG/M |
| 3300027662|Ga0208565_1147684 | Not Available | 686 | Open in IMG/M |
| 3300027773|Ga0209810_1165158 | Not Available | 910 | Open in IMG/M |
| 3300027795|Ga0209139_10109963 | Not Available | 971 | Open in IMG/M |
| 3300027812|Ga0209656_10211278 | Not Available | 935 | Open in IMG/M |
| 3300027829|Ga0209773_10459210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 526 | Open in IMG/M |
| 3300027842|Ga0209580_10320752 | Not Available | 772 | Open in IMG/M |
| 3300028379|Ga0268266_12044315 | Not Available | 546 | Open in IMG/M |
| 3300028742|Ga0302220_10357192 | Not Available | 527 | Open in IMG/M |
| 3300030494|Ga0310037_10380820 | Not Available | 588 | Open in IMG/M |
| 3300030515|Ga0268254_10313040 | Not Available | 520 | Open in IMG/M |
| 3300031231|Ga0170824_120155082 | Not Available | 1457 | Open in IMG/M |
| 3300031469|Ga0170819_11592786 | Not Available | 614 | Open in IMG/M |
| 3300031525|Ga0302326_12478984 | Not Available | 652 | Open in IMG/M |
| 3300031545|Ga0318541_10597075 | Not Available | 617 | Open in IMG/M |
| 3300031564|Ga0318573_10604106 | Not Available | 590 | Open in IMG/M |
| 3300031572|Ga0318515_10540252 | Not Available | 621 | Open in IMG/M |
| 3300031573|Ga0310915_10699806 | Not Available | 715 | Open in IMG/M |
| 3300031668|Ga0318542_10442795 | Not Available | 673 | Open in IMG/M |
| 3300031668|Ga0318542_10716653 | Not Available | 523 | Open in IMG/M |
| 3300031680|Ga0318574_10085773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1724 | Open in IMG/M |
| 3300031708|Ga0310686_104426599 | Not Available | 574 | Open in IMG/M |
| 3300031719|Ga0306917_11224368 | Not Available | 582 | Open in IMG/M |
| 3300031724|Ga0318500_10122937 | Not Available | 1201 | Open in IMG/M |
| 3300031736|Ga0318501_10570402 | Not Available | 620 | Open in IMG/M |
| 3300031753|Ga0307477_10244578 | Not Available | 1243 | Open in IMG/M |
| 3300031753|Ga0307477_10757493 | Not Available | 647 | Open in IMG/M |
| 3300031765|Ga0318554_10493375 | Not Available | 693 | Open in IMG/M |
| 3300031768|Ga0318509_10590963 | Not Available | 618 | Open in IMG/M |
| 3300031779|Ga0318566_10492375 | Not Available | 601 | Open in IMG/M |
| 3300031792|Ga0318529_10115409 | Not Available | 1220 | Open in IMG/M |
| 3300031820|Ga0307473_10196890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1193 | Open in IMG/M |
| 3300031831|Ga0318564_10369011 | Not Available | 630 | Open in IMG/M |
| 3300031832|Ga0318499_10283108 | Not Available | 641 | Open in IMG/M |
| 3300031890|Ga0306925_10088610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3283 | Open in IMG/M |
| 3300031890|Ga0306925_10202683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2140 | Open in IMG/M |
| 3300031893|Ga0318536_10199225 | Not Available | 1019 | Open in IMG/M |
| 3300031897|Ga0318520_10311257 | Not Available | 950 | Open in IMG/M |
| 3300031897|Ga0318520_10824667 | Not Available | 582 | Open in IMG/M |
| 3300032035|Ga0310911_10438451 | Not Available | 756 | Open in IMG/M |
| 3300032041|Ga0318549_10072151 | Not Available | 1467 | Open in IMG/M |
| 3300032042|Ga0318545_10046241 | Not Available | 1465 | Open in IMG/M |
| 3300032042|Ga0318545_10068899 | Not Available | 1215 | Open in IMG/M |
| 3300032043|Ga0318556_10635277 | Not Available | 556 | Open in IMG/M |
| 3300032051|Ga0318532_10006493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3442 | Open in IMG/M |
| 3300032052|Ga0318506_10479461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 551 | Open in IMG/M |
| 3300032059|Ga0318533_10894047 | Not Available | 651 | Open in IMG/M |
| 3300032068|Ga0318553_10190939 | Not Available | 1067 | Open in IMG/M |
| 3300032076|Ga0306924_12410624 | Not Available | 530 | Open in IMG/M |
| 3300032091|Ga0318577_10150344 | Not Available | 1108 | Open in IMG/M |
| 3300032091|Ga0318577_10336707 | Not Available | 721 | Open in IMG/M |
| 3300032180|Ga0307471_102338898 | Not Available | 675 | Open in IMG/M |
| 3300032261|Ga0306920_100310163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2349 | Open in IMG/M |
| 3300032261|Ga0306920_104130706 | Not Available | 525 | Open in IMG/M |
| 3300032895|Ga0335074_10034424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 7081 | Open in IMG/M |
| 3300032954|Ga0335083_10382593 | Not Available | 1208 | Open in IMG/M |
| 3300033134|Ga0335073_11628917 | Not Available | 614 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.53% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.01% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.26% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 2.26% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.50% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012078 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC083 MetaG | Host-Associated | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030515 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_101690112 | 3300003505 | Forest Soil | MAPQRKTFPRLFLSRADPYRLSGDRVFLRPPERGDYEAWASLRAGSRD |
| Ga0062594_1011021222 | 3300005093 | Soil | MAPNFPRLFLGRSEPLRLVGERVFLRPPERGDYESWASLRARS |
| Ga0066677_102577221 | 3300005171 | Soil | MAPQRKTFPRLFLARSDPFRLVGDRVFLRPPERGDYDEWA |
| Ga0066683_103769641 | 3300005172 | Soil | MGDVDRAMAAQRKPFPRLFLTRPEPFRLVGEWVFLRPPERGDY |
| Ga0066671_108702782 | 3300005184 | Soil | MAAQRKTFPRLFLARSEPFRLVGDRVFLRPPERGDYEDWASLRARSRN |
| Ga0070698_1015810472 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPQRKTFPRLFLARSEPFRLAGDSVFLRPPERGDYDEWASLRARSR |
| Ga0070731_102293892 | 3300005538 | Surface Soil | MAAQRKTFPRLFPARPEPYRLSGERVFLRPPERGDYEEWANLRAR |
| Ga0070762_106760012 | 3300005602 | Soil | MAAQRNPFPRLFQARSDPFRLTGDRVFLRPPERGDYE |
| Ga0066903_1062420612 | 3300005764 | Tropical Forest Soil | MAPQRKSFPRIFLPRVEPFRLTGERVFLRSPERGDYEDWASLRARSRNF |
| Ga0068860_1027758781 | 3300005843 | Switchgrass Rhizosphere | MAAQRKTFPRLFLTRAEPLRLVGHRMFLRPPDRGDYEEWASLRARSRA |
| Ga0066794_102596872 | 3300005947 | Soil | MAPQRKTFPRLFLARSEPFRLVGERVFLRPPERGDYEEWASLRAAS |
| Ga0066651_104430282 | 3300006031 | Soil | MAPQRKAFPRLFLARAEPFRLAGDTVFLRPPERGDYDEWAS |
| Ga0066660_110705791 | 3300006800 | Soil | MAAQRNPFPRLFQARSDPFRLSGDRVFLRPPERGDYDEWASIRARSRN |
| Ga0073928_102320061 | 3300006893 | Iron-Sulfur Acid Spring | MAPQRKTFPRLFLSRADPYRLNGDRVSLRPPERGDYEAWASL |
| Ga0111539_105443642 | 3300009094 | Populus Rhizosphere | MAAQRKTAFPRLFLTRTEPFRLIGDQVFLRAPDRG |
| Ga0105241_125920142 | 3300009174 | Corn Rhizosphere | MAAQRKTAFPRLFLTRTEPFRLNGDRVFLRAPDRGDYE |
| Ga0126384_103532212 | 3300010046 | Tropical Forest Soil | MATQRKTFPRLFLARSEPFRLVGDRVFLRPPERGDYDEWASLRARSRR* |
| Ga0126384_124927581 | 3300010046 | Tropical Forest Soil | LIWTAMAPQRKSFPRIFLSRVEPFRLIGERVFLRSPE |
| Ga0126373_127714901 | 3300010048 | Tropical Forest Soil | MAPQRKAFPRLFLSRADPYRLTGDRLFLRPPERGDYE |
| Ga0126370_108922371 | 3300010358 | Tropical Forest Soil | MAPQRKSFPRLFLARTDPHRLIGDRVFLRPPERGDYEAWAGLRANSRD |
| Ga0126378_131876082 | 3300010361 | Tropical Forest Soil | MAPQRKSFPRLFPPRAEPFRLAGERVYLRSPERGDYEDWA |
| Ga0126379_106625432 | 3300010366 | Tropical Forest Soil | MATQRKTFPRLFLARSEPFRLVGDRIFLRPPERGDYDEW |
| Ga0105239_110955761 | 3300010375 | Corn Rhizosphere | MAAQRKTAFPRLFLTRSEPFRLVGDRVSLRSPDRGDYEEWAG |
| Ga0126381_1018662251 | 3300010376 | Tropical Forest Soil | MAAQRKTFPRLFLARPEPFRLSGERVRLRPPERGDYEDWASLR |
| Ga0134126_101776483 | 3300010396 | Terrestrial Soil | MAPQRKTFPRLFLARPEPFRLMGDKVHLRPAERGDFDDWAS |
| Ga0134124_116784331 | 3300010397 | Terrestrial Soil | MAPQRKTFPRLFLARSEPYRLVGERVYLRPPERGDYE |
| Ga0134127_125010802 | 3300010399 | Terrestrial Soil | MAAQRKTAFPRLFLTRSEPFRLVGDRVSLRSPDRGDYE* |
| Ga0150983_131472352 | 3300011120 | Forest Soil | MAPQRKSFPRLFLARAEPFRLAGERGLLRSPERGDYEAWATLR |
| Ga0150983_140216581 | 3300011120 | Forest Soil | MAPQRKSFPRLFLARAEPFRLAGERVFLRSPERGDYE |
| Ga0137392_111780492 | 3300011269 | Vadose Zone Soil | MAAQRKPFPRLFLARSDPFRLAGDRVFLRPPERGDY |
| Ga0137393_103625462 | 3300011271 | Vadose Zone Soil | MAAQRKPFPRLSLARSDPFRLAGDRVFLRSPERGDYEEWASI |
| Ga0153999_10622601 | 3300012078 | Attine Ant Fungus Gardens | MAPQRKTFPRLFASRADPLRLAGEKVFLRPPDRGDYDAWASLRARS |
| Ga0153974_10397722 | 3300012180 | Attine Ant Fungus Gardens | MAPQRKTFPRLFLARTDPLRLVGASVFLRPPGRGDY |
| Ga0153922_10824671 | 3300012181 | Attine Ant Fungus Gardens | MAPQRKTFPRLFVHARAEPFRLNGERVFLRPPERGDYED |
| Ga0137382_111356001 | 3300012200 | Vadose Zone Soil | MAPQRKSFPRLFLARAEPFRLAGQRVFLRSPERGDYQAWASLRARSRNFLAP |
| Ga0137399_113905171 | 3300012203 | Vadose Zone Soil | MAAQRKPFPRLFLARSDPFRLVGDRVFLRPPERGDYDEWASIRARS |
| Ga0150985_1227274021 | 3300012212 | Avena Fatua Rhizosphere | MPAQRKAFPRLFLARAEPFRLLGDGVFVPPPDRGDYDEWASLRARSRNFLSPW |
| Ga0150984_1032180452 | 3300012469 | Avena Fatua Rhizosphere | MAPQRKTFPRLFLSRADPYRLTGDRVFLRPPERGDYDVWAILSKT* |
| Ga0137395_105468441 | 3300012917 | Vadose Zone Soil | MAPQRKSFPRLFLARAEPFRLAGERVFLRSPERGDYEAWAGLRARSRN |
| Ga0137395_106412801 | 3300012917 | Vadose Zone Soil | MAPQRKTFPRLFLARADPLRLVGERVFLRSPERGDYEEWVSLR |
| Ga0137359_103403191 | 3300012923 | Vadose Zone Soil | MAAQRKPFPRLFLARSDPFRLVGDRVFLRPPERGDYDEWASIRAR |
| Ga0126369_113147651 | 3300012971 | Tropical Forest Soil | MAAQRKTFPRLFLSRADPYRLIGDHIYLRAAERGDYEAWASLRAASRDFL |
| Ga0181538_101419231 | 3300014162 | Bog | MAPQRKTFPRLFATRADPLRLVGGGVFLRPPERADYEDWAALRACSRN |
| Ga0181523_103164411 | 3300014165 | Bog | MAPQRKTFPRLFLARAEPFRLVGERVFLRSPERGDYEEW |
| Ga0182041_109305081 | 3300016294 | Soil | MAPQRKSFPRIFLARAEPFRLTGERVFLRSPERGDYEDWASLRSRSRRF |
| Ga0182041_122445581 | 3300016294 | Soil | MAPQRKSFPRIFLARVEPFRLSGERVFLRSPERGDYEDWASLRGRSRNF |
| Ga0182033_117064321 | 3300016319 | Soil | MAPQRKTFPRLFLSRADPYRLTGDRVFLRPPERGDYEAWASLRAGSRD |
| Ga0182035_119764491 | 3300016341 | Soil | MAPQRKTFPRLFLSRADPYRLTGDRVFLRPPERGDYEAWAS |
| Ga0182034_109790722 | 3300016371 | Soil | MAPQRKSFPRIFLARTEPFRLSGERVFLRSPERGDY |
| Ga0182040_109123981 | 3300016387 | Soil | MAPQRKSFPRIFLARAEPFRLTGERVFLRSPERGDYENWASLR |
| Ga0182037_103148852 | 3300016404 | Soil | MAPQRKSFPRIFLARAEPFRLTGERVFLRSPERGDYEDWASLRSRSRRFL |
| Ga0182037_111639051 | 3300016404 | Soil | MAPQRKSFPLLFLARPEPFRLSGERVFLRLPERGDYEAW |
| Ga0187810_101550741 | 3300018012 | Freshwater Sediment | MAPQRKSFPRLFLARADPFRLTGKRVYLRAPERGDWEAWASLRARSRD |
| Ga0187784_101578503 | 3300018062 | Tropical Peatland | MTPQRKTFPRLFATRADPLRLAGDGVFLRPPERADYEAWAALRAQEHAIAG |
| Ga0187770_113347102 | 3300018090 | Tropical Peatland | MAAQRKTFPRLFLARPAPFRLTGERVRLRPPERGDFEDWANL |
| Ga0179592_105248452 | 3300020199 | Vadose Zone Soil | MAPQRKSFPRLFLARAEPFRLAGGRVFLRSPERGDYEAWAGLRARSR |
| Ga0210403_109905281 | 3300020580 | Soil | MAPQRKSFPRIFLPRVEPFRLTGERVFLRSPERGDYEDWASLRACSRNFLAP |
| Ga0210401_102526323 | 3300020583 | Soil | MAPQRKTFPRLFLSRADPYRLTGDRVFLRPPERGD |
| Ga0210408_110683022 | 3300021178 | Soil | MAPQRKSFPRIFLARTEPFRLTGERVFLRSPERGDYE |
| Ga0210388_111521242 | 3300021181 | Soil | MAPQRKAFPRLFATRADPLRLIGDEVFLRPPERGDYDSWASLRARSR |
| Ga0213876_104659572 | 3300021384 | Plant Roots | MAPQRKTFPRLFTARADPLRLVGDRVFLRPPERNDYEAW |
| Ga0187846_100399291 | 3300021476 | Biofilm | MAPQRKSFPRIFLARAEPLRLAGERVFLRLPERGDYEDWASLRG |
| Ga0187846_104921832 | 3300021476 | Biofilm | MAMAPQRKSFPRIFLARAEPFRLAGERVFLRSPERSDYEDWAS |
| Ga0210398_106320732 | 3300021477 | Soil | MAPQRKTFPRLFATRAEPLRLAGDAVFLRPPERGDYETWANLRARSRN |
| Ga0210410_103816072 | 3300021479 | Soil | MAPQRKTFPRLFATRADPLRLVGEKVFLRPADRGDYDAWANLRARSRNF |
| Ga0213880_101479441 | 3300021953 | Exposed Rock | MAPQRKTFPRLFLTRSEPFRLVGERCYLRPAERADYDDWA |
| Ga0242669_10190101 | 3300022528 | Soil | MAPQRKTFPRLFLSRADPYRLTGDRVFLRPPERGDYE |
| Ga0222756_10061411 | 3300022709 | Soil | MAPQRKSFPRLFLARSDPFRLIGERVYLRAPERGDWEAW |
| Ga0242654_100713721 | 3300022726 | Soil | MAPQRKTFPRLFLSRADPYRLSGDRVFLRPPERGDYEAWA |
| Ga0179589_104279552 | 3300024288 | Vadose Zone Soil | MAPQRRSFPRLFPARADPFRATGDRVFLRAPERGDYDAWASLRASSR |
| Ga0247667_10986312 | 3300024290 | Soil | LNGNGAEIMATQRKTFPRLFLARSEPFRLVSDRVFLRPPERGD |
| Ga0207679_111043711 | 3300025945 | Corn Rhizosphere | MAPNFPRLFLGRSEPLRLVGERVFLRPPERGDYESWASLRARSHGFL |
| Ga0209803_12511632 | 3300026332 | Soil | MAAQRKPFPRLFLARSDPFRLAGDRVFLRPPERGDYEEWASIRARSR |
| Ga0257149_10629192 | 3300026355 | Soil | MAPQRKSFPRLFLARAEPFRLAGERVFLRSPERGDYEAWAALRARSR |
| Ga0257155_10613882 | 3300026481 | Soil | MAPQRRSFPRLFPARADPFRATGDRVFLRAPERGDYDAWASL |
| Ga0257168_11092102 | 3300026514 | Soil | MAPQRRSFPRLFPARADPFRATGDRVFLRAPERGDYDAWASLR |
| Ga0209059_11998951 | 3300026527 | Soil | MAPQRKTFPRLFLSRADPYRLTGDRVLLRPPERGDYEAWASLR |
| Ga0208565_11476842 | 3300027662 | Peatlands Soil | MAPQRKTFPRLFATRTEPLRLIGDKVFVRPPERGDYDEWATL |
| Ga0209810_11651582 | 3300027773 | Surface Soil | MAPQRKTFPRLFLTRSEPFRLHGERVFLRPPERGDYDEWAT |
| Ga0209139_101099632 | 3300027795 | Bog Forest Soil | LLHDAAIAMAPQRKSFPRLFLSRSDPFRLNGERVFLRAPERGDYEAWAN |
| Ga0209656_102112782 | 3300027812 | Bog Forest Soil | MAPQRKSFPRLFLARADPFRLVGERVYLRAPERIDWDAWASLRGRS |
| Ga0209773_104592102 | 3300027829 | Bog Forest Soil | MAPQRKTFPRLFATRADPLRLSGEHVFLRPPERGDYEAWANLRARSR |
| Ga0209580_103207521 | 3300027842 | Surface Soil | VAPQRKTFPRLFATRAEPLRLVGAKVFLRPPERSDYDEWA |
| Ga0268266_120443152 | 3300028379 | Switchgrass Rhizosphere | MAPQRKTFPRLFLARSEPYRLVGERVYLRPPERGDYEEWASLRA |
| Ga0302220_103571922 | 3300028742 | Palsa | MAPQRKTFPRLFATRADPLRLSGEHVFLRPPERGDYEAWADLRARS |
| Ga0310037_103808202 | 3300030494 | Peatlands Soil | MAPQRKSFPRLFLSRSDPFRLTGDRVFLRAPERGDWEAWASLRARSR |
| Ga0268254_103130402 | 3300030515 | Agave | MAPQRKTFPRLFLPRSEPFRLVGDRVFLRPPERGDYDEWASLRARSRNFL |
| Ga0170824_1201550821 | 3300031231 | Forest Soil | MAPQRKSFPRLFLARAEPFRLAGERGFLRSPERGDYEAW |
| Ga0170819_115927862 | 3300031469 | Forest Soil | MAPQRKSFPRLFLARAEPFRLSGERIFLRSPERGDYNTKKKRIK |
| Ga0302326_124789841 | 3300031525 | Palsa | MAPQRKTFPRLFAARADPLRLVGDQLFLRPPERGDYEAW |
| Ga0318541_105970752 | 3300031545 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRLPERGDYED |
| Ga0318573_106041061 | 3300031564 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRLPERGDY |
| Ga0318515_105402521 | 3300031572 | Soil | MAPQRKSFPRIFLARAEPFRLTGERVFLRSPERGDYEN |
| Ga0310915_106998061 | 3300031573 | Soil | MAPQRKSFPRIFLARPEPFRLAGERVFLRLPERGDYED |
| Ga0318542_104427952 | 3300031668 | Soil | MAPQRKPFPRLFLARADPYRLTGDRVFLRPPERGDYE |
| Ga0318542_107166531 | 3300031668 | Soil | MAPQRKSFPRIFLARAEPFRLIGERVFLRSPERGDYE |
| Ga0318574_100857733 | 3300031680 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRSPERGDYEDWA |
| Ga0310686_1044265991 | 3300031708 | Soil | MAPQRKSFPRLFLTRSDPFRLAGERVFLRAPERGDWE |
| Ga0306917_112243681 | 3300031719 | Soil | MAPQRKSFPLLFLARPEPFRLSGERVFLRLPERGDYEAWASLR |
| Ga0318500_101229371 | 3300031724 | Soil | MAMAPQRKSFPRIFLARVEPFRLTGERVFLRSPERGDYEDWASLRGRSRK |
| Ga0318501_105704022 | 3300031736 | Soil | MAPQRKSFPRLFLPRSEPFRLTGERVSLRAPERGDYEAWASLR |
| Ga0307477_102445782 | 3300031753 | Hardwood Forest Soil | MAPQRKTFPRLFLSRADPYRLSGDRVFLRPPERSDYEAWASL |
| Ga0307477_107574932 | 3300031753 | Hardwood Forest Soil | MAPQRKSFPRIFLARAEPFRLVGERVFLRSPERGDYEDWASLR |
| Ga0318554_104933751 | 3300031765 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRLPERGDYEDWAS |
| Ga0318509_105909631 | 3300031768 | Soil | MAPQRKSFPRIFLARAEPFRLIGERVFLRSPERGDYESWASLRSRSRRFLV |
| Ga0318566_104923752 | 3300031779 | Soil | MAPQRKSFPRIFLARAEPFRLTGDRVFLRSPERGDYEDWASLRSRSRRFL |
| Ga0318529_101154092 | 3300031792 | Soil | MAMAPQRKSFPRIFLARVEPFRLTGERVFLRSPERGDYED |
| Ga0307473_101968902 | 3300031820 | Hardwood Forest Soil | MAPQRKSFPRLFLARADPLRLVGERVLLRSPERGDYEAWATL |
| Ga0318564_103690111 | 3300031831 | Soil | MAPQRKSFPRLFLPRSEPFRLTGERVSLRAPERGDYEAWAS |
| Ga0318499_102831082 | 3300031832 | Soil | MAPQRKSFPRIFLARAEPPRLAGERIFLRSPERGDYEGWAS |
| Ga0306925_100886103 | 3300031890 | Soil | MAPQRKSFPRLFLARTDPFRLTGQRVFLRPPERGDY |
| Ga0306925_102026831 | 3300031890 | Soil | MAPQRKSFPRLFLPRSEPFRLTGERVSLRAPERGDYEAWASLRTRSRRFLEP |
| Ga0318536_101992251 | 3300031893 | Soil | MAPQRKPFPRLFLARTDPHRLIGDRVFLRPPERGDYEAWAGLRANS |
| Ga0318520_103112572 | 3300031897 | Soil | MLAIAMAPQRKSFPRIFLARAEPFRLIGERVFLRS |
| Ga0318520_108246671 | 3300031897 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRLPERGDYE |
| Ga0310911_104384512 | 3300032035 | Soil | MAPQRKSFPRIFLARAEPFRLADERVFLRLPERGDYEDWASLRG |
| Ga0318549_100721512 | 3300032041 | Soil | MAPQRKSFPRIFLARAEPFRLTGERVFLRSPERGDYENWASLRS |
| Ga0318545_100462412 | 3300032042 | Soil | MAPQRKSFPRLFVARADPFRLAGDRVFLRPPERGDYE |
| Ga0318545_100688991 | 3300032042 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRSPERGDYQ |
| Ga0318556_106352772 | 3300032043 | Soil | MAPQRKPFPRLFLARTDPHRLIGDRVFLRPPERGDYEAW |
| Ga0318532_100064934 | 3300032051 | Soil | MAPQRKSFPRLFPARTDPHRLIGDRVFLRAPERAD |
| Ga0318506_104794611 | 3300032052 | Soil | MAPQRKSFPRIFLARAEPFRLTGERVFLRSPERGDYENW |
| Ga0318533_108940472 | 3300032059 | Soil | MAPQRKSFPRIFLARAEPFRLAGERVFLRLPERGDYEDWASLR |
| Ga0318553_101909391 | 3300032068 | Soil | MAPQRKSFPRLFLPRSEPFRLTGERVSLRAPERGDYEAWASLRTRSRRFL |
| Ga0306924_124106242 | 3300032076 | Soil | MAAQRKTFPRLFLARPEPFRLTGERVRLRPPERGDYED |
| Ga0318577_101503441 | 3300032091 | Soil | MAPQRKPFPRLFLARADPYRLTGDRVFLRPPERGDYEAWASLRAG |
| Ga0318577_103367071 | 3300032091 | Soil | MAPQRKSFPLLFLARPEPFRLSGEHVFLRLPERGDYEAWASLRTRSRNFL |
| Ga0307471_1023388981 | 3300032180 | Hardwood Forest Soil | MAPQRKHFPRLFLARAEPFRLVGERVFLRPPERGDYEEWATLRASS |
| Ga0306920_1003101631 | 3300032261 | Soil | MAPQRKSFPRIFLPRVEPFRLTGERVFLRSPERGDYEDWASLRARSRNFL |
| Ga0306920_1041307061 | 3300032261 | Soil | MAAQRKTFPRLFLTRPEPFRLVGQRVVVRPPERGDYEAWAS |
| Ga0335074_100344249 | 3300032895 | Soil | MAPQRKTFPRLFATRADPLRLIGDKVLIRPPERGDYDSW |
| Ga0335083_103825932 | 3300032954 | Soil | MAPQRKTFPRLFATRADPLRLVGDTVFLRPPERGDYDDWA |
| Ga0335073_116289172 | 3300033134 | Soil | MAPQRKTFPRLFATRADPLRLTGETVFLRPPERGDYDAWASLRAR |
| ⦗Top⦘ |