| Basic Information | |
|---|---|
| Family ID | F059746 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQQGS |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.74 % |
| % of genes from short scaffolds (< 2000 bps) | 92.48 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.180 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.564 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.068 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF02909 | TetR_C_1 | 29.32 |
| PF00440 | TetR_N | 28.57 |
| PF00487 | FA_desaturase | 7.52 |
| PF00011 | HSP20 | 2.26 |
| PF13683 | rve_3 | 2.26 |
| PF11592 | AvrPto | 0.75 |
| PF00501 | AMP-binding | 0.75 |
| PF03174 | CHB_HEX_C | 0.75 |
| PF00665 | rve | 0.75 |
| PF00211 | Guanylate_cyc | 0.75 |
| PF01569 | PAP2 | 0.75 |
| PF13581 | HATPase_c_2 | 0.75 |
| PF08031 | BBE | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 29.32 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 7.52 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 7.52 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 2.26 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.75 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.75 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.75 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.75 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.75 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.18 % |
| Unclassified | root | N/A | 27.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301D6VE1 | Not Available | 503 | Open in IMG/M |
| 3300000956|JGI10216J12902_108293894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300005172|Ga0066683_10734886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300005446|Ga0066686_10671481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 702 | Open in IMG/M |
| 3300006844|Ga0075428_100832176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
| 3300006844|Ga0075428_101439750 | Not Available | 723 | Open in IMG/M |
| 3300006844|Ga0075428_102251277 | Not Available | 561 | Open in IMG/M |
| 3300009094|Ga0111539_10973170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
| 3300009156|Ga0111538_11048101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300009789|Ga0126307_11059839 | Not Available | 655 | Open in IMG/M |
| 3300009806|Ga0105081_1072384 | Not Available | 543 | Open in IMG/M |
| 3300009809|Ga0105089_1064290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300009810|Ga0105088_1013659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1227 | Open in IMG/M |
| 3300009810|Ga0105088_1032143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 851 | Open in IMG/M |
| 3300009810|Ga0105088_1109110 | Not Available | 518 | Open in IMG/M |
| 3300009816|Ga0105076_1035223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 888 | Open in IMG/M |
| 3300009816|Ga0105076_1072797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300009817|Ga0105062_1032376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
| 3300009818|Ga0105072_1095631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
| 3300009837|Ga0105058_1086956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300009840|Ga0126313_10123174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1932 | Open in IMG/M |
| 3300009840|Ga0126313_10416230 | Not Available | 1068 | Open in IMG/M |
| 3300009840|Ga0126313_10957065 | Not Available | 700 | Open in IMG/M |
| 3300009840|Ga0126313_11354947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300010029|Ga0105074_1043633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
| 3300010029|Ga0105074_1054047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300010036|Ga0126305_10155225 | Not Available | 1426 | Open in IMG/M |
| 3300010036|Ga0126305_10671253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300010036|Ga0126305_11124254 | Not Available | 541 | Open in IMG/M |
| 3300010038|Ga0126315_10372432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 893 | Open in IMG/M |
| 3300010038|Ga0126315_10480565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 790 | Open in IMG/M |
| 3300010040|Ga0126308_10475156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300010041|Ga0126312_10364766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
| 3300010041|Ga0126312_11228741 | Not Available | 553 | Open in IMG/M |
| 3300010044|Ga0126310_10571117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 838 | Open in IMG/M |
| 3300010045|Ga0126311_10405535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1050 | Open in IMG/M |
| 3300010166|Ga0126306_10541087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
| 3300010323|Ga0134086_10288439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300010333|Ga0134080_10383315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300011000|Ga0138513_100047026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300011003|Ga0138514_100095275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300012021|Ga0120192_10014314 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300012021|Ga0120192_10094613 | Not Available | 597 | Open in IMG/M |
| 3300012204|Ga0137374_10073263 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
| 3300012204|Ga0137374_10369624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300012204|Ga0137374_10671848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300012353|Ga0137367_11161961 | Not Available | 518 | Open in IMG/M |
| 3300012354|Ga0137366_10588401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300012355|Ga0137369_10594958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 770 | Open in IMG/M |
| 3300012358|Ga0137368_10915990 | Not Available | 533 | Open in IMG/M |
| 3300012532|Ga0137373_10120356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2259 | Open in IMG/M |
| 3300012938|Ga0162651_100021444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300012939|Ga0162650_100030038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300014487|Ga0182000_10011105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2198 | Open in IMG/M |
| 3300014497|Ga0182008_10438202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
| 3300017997|Ga0184610_1023263 | Not Available | 1687 | Open in IMG/M |
| 3300017997|Ga0184610_1141287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 786 | Open in IMG/M |
| 3300018053|Ga0184626_10375468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300018054|Ga0184621_10005673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3419 | Open in IMG/M |
| 3300018056|Ga0184623_10000269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22155 | Open in IMG/M |
| 3300018076|Ga0184609_10525706 | Not Available | 536 | Open in IMG/M |
| 3300018422|Ga0190265_11600912 | Not Available | 763 | Open in IMG/M |
| 3300018429|Ga0190272_10532278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1009 | Open in IMG/M |
| 3300018469|Ga0190270_10521856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1138 | Open in IMG/M |
| 3300018469|Ga0190270_10626960 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300018469|Ga0190270_12472231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum | 581 | Open in IMG/M |
| 3300019233|Ga0184645_1164141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 730 | Open in IMG/M |
| 3300019362|Ga0173479_10609303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300019377|Ga0190264_10812407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300021073|Ga0210378_10003738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7317 | Open in IMG/M |
| 3300021073|Ga0210378_10152261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300021073|Ga0210378_10392380 | Not Available | 515 | Open in IMG/M |
| 3300021078|Ga0210381_10089890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
| 3300021078|Ga0210381_10262638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
| 3300026790|Ga0208710_107080 | Not Available | 535 | Open in IMG/M |
| 3300026791|Ga0208072_102893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300027056|Ga0209879_1052255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300027277|Ga0209846_1029577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
| 3300027961|Ga0209853_1060541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
| 3300028587|Ga0247828_11214965 | Not Available | 505 | Open in IMG/M |
| 3300028711|Ga0307293_10164801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300028716|Ga0307311_10154816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300028717|Ga0307298_10015995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1915 | Open in IMG/M |
| 3300028744|Ga0307318_10088066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
| 3300028744|Ga0307318_10149001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
| 3300028744|Ga0307318_10332646 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028771|Ga0307320_10480829 | Not Available | 502 | Open in IMG/M |
| 3300028778|Ga0307288_10065350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1277 | Open in IMG/M |
| 3300028784|Ga0307282_10513210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300028793|Ga0307299_10286037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300028796|Ga0307287_10007801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3529 | Open in IMG/M |
| 3300028796|Ga0307287_10078134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1239 | Open in IMG/M |
| 3300028796|Ga0307287_10289486 | Not Available | 619 | Open in IMG/M |
| 3300028809|Ga0247824_11098163 | Not Available | 508 | Open in IMG/M |
| 3300028810|Ga0307294_10274084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300028814|Ga0307302_10526040 | Not Available | 587 | Open in IMG/M |
| 3300028814|Ga0307302_10642285 | Not Available | 527 | Open in IMG/M |
| 3300028819|Ga0307296_10077781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1766 | Open in IMG/M |
| 3300028824|Ga0307310_10385294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300028828|Ga0307312_10420456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300028875|Ga0307289_10118881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1082 | Open in IMG/M |
| 3300028875|Ga0307289_10172137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
| 3300028878|Ga0307278_10256699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300028881|Ga0307277_10389767 | Not Available | 622 | Open in IMG/M |
| 3300030514|Ga0268253_10085839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 891 | Open in IMG/M |
| 3300030987|Ga0308155_1020324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300030994|Ga0308153_101024 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300031091|Ga0308201_10041993 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300031092|Ga0308204_10016110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1467 | Open in IMG/M |
| 3300031731|Ga0307405_10010531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4799 | Open in IMG/M |
| 3300031731|Ga0307405_10592485 | Not Available | 903 | Open in IMG/M |
| 3300031731|Ga0307405_11553759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300031824|Ga0307413_11303322 | Not Available | 635 | Open in IMG/M |
| 3300031824|Ga0307413_11630583 | Not Available | 574 | Open in IMG/M |
| 3300031852|Ga0307410_10698523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
| 3300031901|Ga0307406_10193400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1491 | Open in IMG/M |
| 3300031901|Ga0307406_10513942 | Not Available | 973 | Open in IMG/M |
| 3300031901|Ga0307406_11731269 | Not Available | 554 | Open in IMG/M |
| 3300031903|Ga0307407_10832327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300031911|Ga0307412_10520752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 993 | Open in IMG/M |
| 3300031911|Ga0307412_11529155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300031995|Ga0307409_100605551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1083 | Open in IMG/M |
| 3300031995|Ga0307409_102281963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300032002|Ga0307416_101025631 | Not Available | 928 | Open in IMG/M |
| 3300032002|Ga0307416_101567203 | Not Available | 764 | Open in IMG/M |
| 3300032002|Ga0307416_102817940 | Not Available | 581 | Open in IMG/M |
| 3300032002|Ga0307416_102838846 | Not Available | 579 | Open in IMG/M |
| 3300032126|Ga0307415_100390787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1184 | Open in IMG/M |
| 3300032126|Ga0307415_101823805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300034131|Ga0334911_037136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria | 692 | Open in IMG/M |
| 3300034377|Ga0334931_122139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 15.04% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 12.03% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 12.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.77% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.01% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 3.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.50% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.50% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300026790 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607 (SPAdes) | Environmental | Open in IMG/M |
| 3300026791 | Grasslands soil microbial communities from Kansas, USA that are Nitrogen fertilized - NN591 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030994 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_142 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034131 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMS | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_00757050 | 2067725001 | Soil | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQPQGSD |
| JGI10216J12902_1082938942 | 3300000956 | Soil | MMVRTQWDPFEDLRGAQDELNQMSPALAHALGLHGQRQG |
| Ga0066683_107348861 | 3300005172 | Soil | MATTTRWDPFQDLRSAQDELAQMSPTLAHALGLHAQQGSGQATTAA |
| Ga0066686_106714812 | 3300005446 | Soil | MATTMRWDPFQDLRNAQDELAQMNPMLAHALGLHGQQQGSGRATTTAWAPALDIS |
| Ga0075428_1008321762 | 3300006844 | Populus Rhizosphere | MATMMRWDPFQDLRSAQEEMAQMGQMSPMLAHALGLYGQQQ |
| Ga0075428_1014397501 | 3300006844 | Populus Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQLSPMLAHALGLHTQQGNAGTTTTSWAPALDI |
| Ga0075428_1022512771 | 3300006844 | Populus Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHPQQGSATATAWAPAL |
| Ga0111539_109731701 | 3300009094 | Populus Rhizosphere | MKEGDQMATMMRWDPFQDLRSAQEEMAQMGQMSPMLAQALGLYGQQQGSGAATA |
| Ga0111538_110481013 | 3300009156 | Populus Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQLSPMLAHALGLHTQQ |
| Ga0126307_110598392 | 3300009789 | Serpentine Soil | MATMMRWDPFQDLRDAQEEMAQMAQMAQMAQMAQMSPRLAHALGLHGQP |
| Ga0105081_10723841 | 3300009806 | Groundwater Sand | MKEGGQMATMTRWDPFQDLRNAQEEMAQMDPMSPMLAHSLGLHGQQQG |
| Ga0105089_10642901 | 3300009809 | Groundwater Sand | MTRWDPFQDLRNAQDEMAQMTQMDPMSPMLAHALGLHAQQGSGRAATTAWA |
| Ga0105089_10839092 | 3300009809 | Groundwater Sand | MTTMMRWDPFQDLRNAQEELNPINHQMNSLFAQALGRRAKTDPID |
| Ga0105088_10136592 | 3300009810 | Groundwater Sand | MAIMTRWDPFQDLRGAQDEMAQMDPMSPMLAHALGLHAQQGSAAA |
| Ga0105088_10321432 | 3300009810 | Groundwater Sand | MATMMRWDPFQDLRSAQDEMAQMAQMTQMAQMSPMLA |
| Ga0105088_11091102 | 3300009810 | Groundwater Sand | MATMTRWDPFQDLRSAQDEMVQMTQMAQMSPRLAHALGLHGQ |
| Ga0105076_10352232 | 3300009816 | Groundwater Sand | MATMMRWDPFQDLRDAQDEMAQMTQMAQMSPRLAHALGLHGQPQGSGRA |
| Ga0105076_10727972 | 3300009816 | Groundwater Sand | MATMMRWDPFQDLRDAQDEMTQMAQMSPRLAHALGLHGQPQGSGRA |
| Ga0105062_10323761 | 3300009817 | Groundwater Sand | MKEGDQMTTMMRWDPFQDLRSAQDEMAQMNPMSPMSPMLAHALGLHAQQGSGRATTTTAWAP |
| Ga0105072_10956311 | 3300009818 | Groundwater Sand | MATMMRWDPFQDLRGAQEEMAQMDPMSPMLAHALGLHAQQ |
| Ga0105058_10869562 | 3300009837 | Groundwater Sand | MKEGGQMATMTRWDPFQDLRSAQDEMAQMDPMSPMLARALG |
| Ga0126313_101231741 | 3300009840 | Serpentine Soil | MEEGDRMATMTRWDPFQDLRSAQDEMAQMTPMLAHALGLHAQQGSGRAGTVA |
| Ga0126313_104162303 | 3300009840 | Serpentine Soil | MAHNKGDQMTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHARQQ |
| Ga0126313_109570651 | 3300009840 | Serpentine Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGN |
| Ga0126313_113549472 | 3300009840 | Serpentine Soil | MATMTRWDPFQDLRDAQDEMAQMAQMSPRLAHALGLHGQ |
| Ga0105074_10436332 | 3300010029 | Groundwater Sand | MATMMRWDPFQDLRSAQDEMAQMTQMSPMSPRLAHALGLHGQQQGSGR |
| Ga0105074_10540472 | 3300010029 | Groundwater Sand | MAIMTRWDPFQDLRGAQEEMARMDPMLAHALGLHGQQQGSATA |
| Ga0126305_101552252 | 3300010036 | Serpentine Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGNARAT |
| Ga0126305_106712532 | 3300010036 | Serpentine Soil | MKDGGQMATMMRWDPFQDLRSAQDEMAQMSPMLAHALGL |
| Ga0126305_111242541 | 3300010036 | Serpentine Soil | MKEGDQMATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHGQPQGSATATAWAPALDI |
| Ga0126315_103724322 | 3300010038 | Serpentine Soil | MTTMRWDPFQDLRSAQDEMAQMHPTLAHALGLHSQQGNARTTAWAPA |
| Ga0126315_104805651 | 3300010038 | Serpentine Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGNGRATTTAW |
| Ga0126308_104751562 | 3300010040 | Serpentine Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQASGRATTT |
| Ga0126312_103647661 | 3300010041 | Serpentine Soil | MATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQP |
| Ga0126312_112287411 | 3300010041 | Serpentine Soil | MATMTLWDPFQDLRSAQDEMAQMSPMLAQTLGLHGQPQGS |
| Ga0126310_105711172 | 3300010044 | Serpentine Soil | MKEGDQMATMTRWDPFQDLRSAQHEMAQMSPMLAHALGLHARQQGNDRAMTT |
| Ga0126311_104055351 | 3300010045 | Serpentine Soil | MQEGGQMATMTRWDPFQDLRSAQDEMAQMSPMLAR |
| Ga0126306_105410872 | 3300010166 | Serpentine Soil | MKEGDQMATMMRWDPFQDLRSAQDEMAQMSPMLAHALGL |
| Ga0134086_102884391 | 3300010323 | Grasslands Soil | MATMTRWEPFQDLRSAQDEMAQMSPMLAHALGLQGQPQGSDRATAWAPALDISE |
| Ga0134080_103833152 | 3300010333 | Grasslands Soil | MEKGDRMAIMTGWDPFQDLRSAQDEMAQMSPMLAHALGLYGQQGSSRATAWRRHWTSPSARTPTW* |
| Ga0138513_1000470262 | 3300011000 | Soil | MATMMRWDPFQDLRSAQEEMAQMSPMTQMSPMLAHALGLHGQQQGGATATAWA |
| Ga0138514_1000952752 | 3300011003 | Soil | MATMMRWDPFQDLRNAQEEMAQMNPMLAQALGLQAQQGSGRATTTTWAPALD |
| Ga0120192_100143143 | 3300012021 | Terrestrial | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGSGRAT |
| Ga0120192_100946132 | 3300012021 | Terrestrial | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQASGRAA |
| Ga0137374_100732631 | 3300012204 | Vadose Zone Soil | MIRRTQWDPFEDLLGAQDELNQMSPALAHALGLHGQRQ |
| Ga0137374_103696241 | 3300012204 | Vadose Zone Soil | MAITTRWDPFQDLRSAKDEMDQMNPMHAHELGLHSQQQG |
| Ga0137374_106718482 | 3300012204 | Vadose Zone Soil | MATMTRWDPFQDLRSAQDEMAQMDPMSPMLAHALGLHGQPQGSGR |
| Ga0137387_100553684 | 3300012349 | Vadose Zone Soil | MATMMRWDPFQDLRSAQDELNPMNHQMSSLLAQAFGQRQAAA |
| Ga0137367_111619611 | 3300012353 | Vadose Zone Soil | MNEGDRMATRTRWDPFEDLRSAQDEIAQMNGMLAQALGQGDRQQGGSGRATTMAWA |
| Ga0137366_105884011 | 3300012354 | Vadose Zone Soil | MATMMRWDPFQDLRNAQEQEEMAQMVQMSPMLAHALGLHGQQQGSGRATTTAWAPALDIS |
| Ga0137369_105949581 | 3300012355 | Vadose Zone Soil | MKEGGQMATMTRWDPFQDLRSAQDEMVQMDPMSPILAQALGL |
| Ga0137368_109159902 | 3300012358 | Vadose Zone Soil | MATMMRWDPFQDLRNAQEQEEMAQMVQMSPMLAHALGLHG |
| Ga0137373_101203561 | 3300012532 | Vadose Zone Soil | MATMTRWDPFQDLRSAQDEMAQMSPVLAHALGLHGQQQGS |
| Ga0162651_1000214441 | 3300012938 | Soil | MKEGDQMATRTRWDPFQDLRDAQDEMAQMTQMSQMLARALGLQGQQQGSGTATAWA |
| Ga0162650_1000300381 | 3300012939 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQ |
| Ga0182000_100111051 | 3300014487 | Soil | MSEGDQMATTTRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQVSGQAGTAAWAPALDIS |
| Ga0182008_104382022 | 3300014497 | Rhizosphere | MSEGDQMAIMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGSGRA |
| Ga0184610_10232633 | 3300017997 | Groundwater Sediment | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQQGNARATTTA |
| Ga0184610_11412872 | 3300017997 | Groundwater Sediment | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQPQGSDRATAWAPALDISEL |
| Ga0184626_103754682 | 3300018053 | Groundwater Sediment | MLLRTQWDPFEDLRNAQEQEEMAQMAQMAQMSPMLAQALGLHGQQQGSGRATTT |
| Ga0184621_100056735 | 3300018054 | Groundwater Sediment | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQGNERAMT |
| Ga0184623_100002691 | 3300018056 | Groundwater Sediment | MTTMMRWDPFQDLRNAQDEMAQMAQMNPMLAHALGLHAQQQGSSRATTTTT |
| Ga0184609_105257062 | 3300018076 | Groundwater Sediment | MATMMRWDPFQDLRSAQDEMAQMSPVLAHALGLHAQQGSGRA |
| Ga0190265_116009121 | 3300018422 | Soil | MAHNKGDQMTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGSDRAMTTAW |
| Ga0190272_105322782 | 3300018429 | Soil | MATMMRWDPFQDLRSAQDEMAQMRPMLAHALGLQGQPQGSDRATAWAPALDISERKD |
| Ga0190270_105218562 | 3300018469 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQPQGSATATAWAP |
| Ga0190270_106269601 | 3300018469 | Soil | MTTMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQ |
| Ga0190270_124722312 | 3300018469 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQANVRAS |
| Ga0184645_11641411 | 3300019233 | Groundwater Sediment | MANMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLH |
| Ga0173479_106093031 | 3300019362 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAQALGLHTQQASGRAATTAWAPALD |
| Ga0190264_108124072 | 3300019377 | Soil | MATMMRWDPFQDLRDAQEEMAQMSPMLAHALGLQGQPQGSDRATAWAPALD |
| Ga0210378_100037381 | 3300021073 | Groundwater Sediment | MTTMMRWDPFQDLRNAQDQMTQMTQMSPMLAQALGLHAQQ |
| Ga0210378_101522611 | 3300021073 | Groundwater Sediment | MATMMRWDPFQDLRSAQDEMAQMSPVLAHALGLHAQQGS |
| Ga0210378_103923802 | 3300021073 | Groundwater Sediment | MATMMRWDPFQDLRSAQDEMAQMRPMLAHALGLQG |
| Ga0210381_100898902 | 3300021078 | Groundwater Sediment | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLQGQPQGSDRATAWAPALDISERK |
| Ga0210381_102626382 | 3300021078 | Groundwater Sediment | MATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHGQQQGSGQTTATA |
| Ga0208710_1070801 | 3300026790 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQASGRAATTAWAPALDISERK |
| Ga0208072_1028933 | 3300026791 | Soil | ATRSASSPSRRAARPTNKGDQMTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQASGRTSAWAPALDIS |
| Ga0209879_10522551 | 3300027056 | Groundwater Sand | MATMMRWDPFQDLRDAQDEMAQMTQMAQMSPRLAHALGLHGQQQGSGRAATTAWAPALDI |
| Ga0209846_10295772 | 3300027277 | Groundwater Sand | MATMMRWDPFQDLRSAQDEMAQMTQMSPMSPMLAHAL |
| Ga0209853_10605411 | 3300027961 | Groundwater Sand | MTTMMRWDPFQDLRSAQDEMAQMSPVLAHALGLHGQQQGSAR |
| Ga0247828_112149651 | 3300028587 | Soil | MTTMMRWDPFQDLRNAQDEMSQMSPMLAHALGLHTQQGNERAMTSAWAPALDISER |
| Ga0307293_101648011 | 3300028711 | Soil | MATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQPQGSDRATAW |
| Ga0307311_101548162 | 3300028716 | Soil | MATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQPQGNGRA |
| Ga0307298_100159951 | 3300028717 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQGNERAMTSAWAPA |
| Ga0307318_100880661 | 3300028744 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQGNERPMTTAWAPALDISERKD |
| Ga0307318_101490011 | 3300028744 | Soil | MANMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHAQ |
| Ga0307318_103326461 | 3300028744 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHT |
| Ga0307320_104808292 | 3300028771 | Soil | MATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHA |
| Ga0307288_100653502 | 3300028778 | Soil | MRWDPFQDLRSAQEEMAQMSPMLAHALGLHAQPQGNDRATAW |
| Ga0307282_105132101 | 3300028784 | Soil | MTTMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHAH |
| Ga0307299_102860372 | 3300028793 | Soil | MATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQPQGSDRA |
| Ga0307287_100078014 | 3300028796 | Soil | MATMMRWDPFQDLRSAQEEMAQMSPMTQMSPMLAHALG |
| Ga0307287_100781343 | 3300028796 | Soil | MANMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAH |
| Ga0307287_102894862 | 3300028796 | Soil | MATMTRWDPFQDLRDAQDEMAQMTQMAQMSPRLAHALGLHAQQGSGRST |
| Ga0247824_110981632 | 3300028809 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQQGSATATAWALRR |
| Ga0307294_102740842 | 3300028810 | Soil | MATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLH |
| Ga0307302_105260402 | 3300028814 | Soil | MATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHGQPQGSDRA |
| Ga0307302_106422852 | 3300028814 | Soil | MTTMMRWDPFQDLRSPQDEMAQMRPMLAHALGLQGQPQGSDRATA |
| Ga0307296_100777811 | 3300028819 | Soil | MATMMRWDPFQDLRNAQDEMAQMSPMLAHALGLQGQPQGSDRATAWAPALDISERK |
| Ga0307310_103852941 | 3300028824 | Soil | MLRTQWDPFEDLRSAHDELDQMSPILAHALGLHGQRQGAAV |
| Ga0307312_104204562 | 3300028828 | Soil | MANMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHGQPQGSDRATAWA |
| Ga0307289_101188811 | 3300028875 | Soil | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLQDQPQGSDRATAWAPALD |
| Ga0307289_101721371 | 3300028875 | Soil | MATMMRWDPFQDLRNAQDEMAQMSPMLAHALGLQGQPQGSDRATAWAPALDISE |
| Ga0307278_102566992 | 3300028878 | Soil | MATMMRWDPFQDLRDAQEEMAQMSQMSQMSPMLAHALGLHG |
| Ga0307277_103897671 | 3300028881 | Soil | MTTMMRWDPFQDLRSAQDEMAPQMSPMLAHALGLHTQQGSATATAWAPALDIS |
| Ga0268253_100858391 | 3300030514 | Agave | MATMTRWDPFQDLRSAQDEMAQMSPLLAHALGLHAQQG |
| Ga0308155_10203242 | 3300030987 | Soil | MATMMRWDPFQDLRSTQDEMAQMTPMLAHALGLQGQPQGSDRATAWAPALDISERKD |
| Ga0308153_1010241 | 3300030994 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQGNERAMTSAWAPALD |
| Ga0308201_100419933 | 3300031091 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHA |
| Ga0308204_100161101 | 3300031092 | Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQGNDRAMTTAWAPALDISERK |
| Ga0307405_100105317 | 3300031731 | Rhizosphere | MATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQPQ |
| Ga0307405_105924851 | 3300031731 | Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGNGR |
| Ga0307405_115537592 | 3300031731 | Rhizosphere | MATRTRWDPFQDLRDAQEEIAQMTQMSQMLARALGLQGQQQGSGTATAWA |
| Ga0307413_113033221 | 3300031824 | Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQPQGSGRA |
| Ga0307413_116305831 | 3300031824 | Rhizosphere | MTTMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGN |
| Ga0307410_106985231 | 3300031852 | Rhizosphere | MATRTRWDPFQDLRDAQEEMAQMTQMSQMLARALG |
| Ga0307406_101934001 | 3300031901 | Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGNGRATTTAWAPA |
| Ga0307406_105139421 | 3300031901 | Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQMNPTLAHALGLHTQ |
| Ga0307406_117312692 | 3300031901 | Rhizosphere | MATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHGQPQGSGRAETTA |
| Ga0307407_108323271 | 3300031903 | Rhizosphere | MATMMRWDPFQDLRDAQEEMAQMAQMAQMSPRLAHALGLHGQPQGSGRAETTAWAPALDI |
| Ga0307412_105207521 | 3300031911 | Rhizosphere | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHSQPQ |
| Ga0307412_115291552 | 3300031911 | Rhizosphere | MATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHGQPQGGD |
| Ga0307409_1006055512 | 3300031995 | Rhizosphere | MATMMRWDPFQDLRDAQEEMAQMAQVSQMSPRLAHALGLHGQPQGSGTATAWAPALDISE |
| Ga0307409_1022819631 | 3300031995 | Rhizosphere | MATMMRWDPFQDLRDAQEEMAQMAQMAQMAQMSPRL |
| Ga0307416_1010256312 | 3300032002 | Rhizosphere | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQGNGRATTTAWA |
| Ga0307416_1015672031 | 3300032002 | Rhizosphere | MATMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHTQQQGS |
| Ga0307416_1028179401 | 3300032002 | Rhizosphere | MAIMTRWDPFQDLRSAQEEMAQMSPMLAHALGLHGQQGSSRATAW |
| Ga0307416_1028388462 | 3300032002 | Rhizosphere | MATMMRWDPFQDLRDAQEEMAQMAQVSQMSPRLAHALGLHGQPQGSGTATAWAPALD |
| Ga0307415_1003907872 | 3300032126 | Rhizosphere | MATMTRWDPFQDLRDAQDEMTQMTQMAQMSPRLAH |
| Ga0307415_1018238052 | 3300032126 | Rhizosphere | MAVMTWWDPFQDLRDAQDEMALMSPMLARALGLQGQPQGSGRAATTAWAPA |
| Ga0334911_037136_551_691 | 3300034131 | Sub-Biocrust Soil | MTTMMRWDPFQDLRSAQDEMAQMSPMLAHALGLHARQQGNDRAMTTA |
| Ga0334931_122139_486_617 | 3300034377 | Sub-Biocrust Soil | MKKGDQMATMTRWDPFQDLRSAQDEMAQMSPMLAHALGLHAQQQ |
| ⦗Top⦘ |