Metagenome / Metatranscriptome Family F059739

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F059739
Family Type	Metagenome / Metatranscriptome
Number of Sequences	133
Average Sequence Length	39 residues
Representative Sequence	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTSDCCNGRQ
Number of Associated Samples	84
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	87.12 %
% of genes near scaffold ends (potentially truncated)	15.04 %
% of genes from short scaffolds (< 2000 bps)	76.69 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (51.128 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (15.790 % of family members)
Environment Ontology (ENVO)	Unclassified (47.368 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (58.647 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.62% β-sheet: 0.00% Coil/Unstructured: 95.38%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF05147	LANC_like	4.72
PF00069	Pkinase	3.77
PF13545	HTH_Crp_2	2.83
PF13181	TPR_8	1.89
PF07726	AAA_3	0.94
PF08843	AbiEii	0.94
PF00196	GerE	0.94
PF11746	DUF3303	0.94
PF00296	Bac_luciferase	0.94
PF01433	Peptidase_M1	0.94
PF00400	WD40	0.94
PF00480	ROK	0.94
PF01471	PG_binding_1	0.94
PF04389	Peptidase_M28	0.94
PF07638	Sigma70_ECF	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	15.09
COG4403	Lantibiotic modifying enzyme	Defense mechanisms [V]	4.72
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	1.89
COG0308	Aminopeptidase N, contains DUF3458 domain	Amino acid transport and metabolism [E]	0.94
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.94
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.94
COG2253	Predicted nucleotidyltransferase component of viral defense system	Defense mechanisms [V]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	51.13 %
Unclassified	root	N/A	48.87 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	51.13 %
Unclassified	root	N/A	48.87 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	51.13 %
Unclassified	root	N/A	48.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	26.32 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	3.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.26 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.75 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4.51 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3.01 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	2.26 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.50 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.75 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4.51 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	2.26 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.50 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	1.50 %
Ignavibacteriae	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae	0.75 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	0.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	4.51 %
Thermales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales	1.50 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.50 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	0.75 %
Ignavibacteria	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria	0.75 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	4.51 %
Stenotrophomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas	1.50 %
Thermaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae	1.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.50 %
unclassified Ignavibacteria	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria	0.75 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	0.75 %
Oleiagrimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Oleiagrimonas	0.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	4.51 %
Stenotrophomonas maltophilia group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas → Stenotrophomonas maltophilia group	1.50 %
Thermus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus	1.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.50 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.75 %
Ignavibacteria bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium	0.75 %
Oleiagrimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Oleiagrimonas → Oleiagrimonas soli	0.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.87 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	4.51 %
Thermus albus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus albus	1.50 %
Stenotrophomonas maltophilia	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas → Stenotrophomonas maltophilia group → Stenotrophomonas maltophilia	1.50 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.50 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.75 %
Ignavibacteria bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium	0.75 %
Oleiagrimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Oleiagrimonas → Oleiagrimonas soli	0.75 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c1710329	Not Available	602	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c1710329	Not Available	602	Open in IMG/M
3300000953\|JGI11615J12901_10311579	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1172	Open in IMG/M
3300000953\|JGI11615J12901_10627109	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300003267\|soilL1_10020945	All Organisms → cellular organisms → Bacteria	5772	Open in IMG/M
3300004114\|Ga0062593_103198635	Not Available	525	Open in IMG/M
3300004156\|Ga0062589_100042626	All Organisms → cellular organisms → Bacteria → Proteobacteria	2458	Open in IMG/M
3300004157\|Ga0062590_100382179	Not Available	1144	Open in IMG/M
3300004463\|Ga0063356_100922676	All Organisms → cellular organisms → Bacteria → Proteobacteria	1236	Open in IMG/M
3300004480\|Ga0062592_100027599	All Organisms → cellular organisms → Bacteria → Proteobacteria	2735	Open in IMG/M
3300004643\|Ga0062591_100065934	All Organisms → cellular organisms → Bacteria → Proteobacteria	2161	Open in IMG/M
3300004800\|Ga0058861_10039061	Not Available	552	Open in IMG/M
3300005340\|Ga0070689_101298010	All Organisms → cellular organisms → Bacteria → Proteobacteria	655	Open in IMG/M
3300005366\|Ga0070659_100899823	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300005438\|Ga0070701_11126507	Not Available	553	Open in IMG/M
3300005549\|Ga0070704_102020762	Not Available	535	Open in IMG/M
3300005564\|Ga0070664_101061561	Not Available	762	Open in IMG/M
3300005577\|Ga0068857_100120335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas → Stenotrophomonas maltophilia group → Stenotrophomonas maltophilia	2363	Open in IMG/M
3300005577\|Ga0068857_102465121	Not Available	511	Open in IMG/M
3300005617\|Ga0068859_100086163	All Organisms → cellular organisms → Bacteria → Proteobacteria	3187	Open in IMG/M
3300005617\|Ga0068859_100086163	All Organisms → cellular organisms → Bacteria → Proteobacteria	3187	Open in IMG/M
3300005617\|Ga0068859_100254972	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1845	Open in IMG/M
3300005617\|Ga0068859_100257859	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1834	Open in IMG/M
3300005617\|Ga0068859_100615782	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	1178	Open in IMG/M
3300005618\|Ga0068864_100005194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	10665	Open in IMG/M
3300005618\|Ga0068864_100252902	All Organisms → cellular organisms → Bacteria	1636	Open in IMG/M
3300005618\|Ga0068864_100649466	Not Available	1027	Open in IMG/M
3300005618\|Ga0068864_101185757	Not Available	762	Open in IMG/M
3300005618\|Ga0068864_101185757	Not Available	762	Open in IMG/M
3300005841\|Ga0068863_100411678	All Organisms → cellular organisms → Bacteria	1323	Open in IMG/M
3300005841\|Ga0068863_101152218	All Organisms → cellular organisms → Bacteria → Proteobacteria	780	Open in IMG/M
3300005842\|Ga0068858_100032404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	4853	Open in IMG/M
3300005842\|Ga0068858_101229601	All Organisms → cellular organisms → Bacteria → Proteobacteria	736	Open in IMG/M
3300005844\|Ga0068862_101258299	Not Available	740	Open in IMG/M
3300005844\|Ga0068862_102327428	Not Available	547	Open in IMG/M
3300006844\|Ga0075428_102659140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas → Stenotrophomonas maltophilia group → Stenotrophomonas maltophilia	510	Open in IMG/M
3300006845\|Ga0075421_101575463	Not Available	715	Open in IMG/M
3300006847\|Ga0075431_100074659	All Organisms → cellular organisms → Bacteria → Proteobacteria	3498	Open in IMG/M
3300006847\|Ga0075431_101201429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Oleiagrimonas → Oleiagrimonas soli	721	Open in IMG/M
3300006876\|Ga0079217_10107938	All Organisms → cellular organisms → Bacteria → Proteobacteria	1266	Open in IMG/M
3300006876\|Ga0079217_10107938	All Organisms → cellular organisms → Bacteria → Proteobacteria	1266	Open in IMG/M
3300006876\|Ga0079217_10107938	All Organisms → cellular organisms → Bacteria → Proteobacteria	1266	Open in IMG/M
3300006931\|Ga0097620_103108109	Not Available	506	Open in IMG/M
3300007004\|Ga0079218_11621063	Not Available	711	Open in IMG/M
3300009101\|Ga0105247_10017237	All Organisms → cellular organisms → Bacteria	4335	Open in IMG/M
3300009112\|Ga0115923_10031011	All Organisms → cellular organisms → Bacteria	58940	Open in IMG/M
3300009112\|Ga0115923_10031011	All Organisms → cellular organisms → Bacteria	58940	Open in IMG/M
3300009148\|Ga0105243_10549062	All Organisms → cellular organisms → Bacteria	1104	Open in IMG/M
3300009156\|Ga0111538_10018406	All Organisms → cellular organisms → Bacteria	9148	Open in IMG/M
3300009177\|Ga0105248_10017946	All Organisms → cellular organisms → Bacteria	7810	Open in IMG/M
3300009177\|Ga0105248_10505142	Not Available	1363	Open in IMG/M
3300009177\|Ga0105248_10505142	Not Available	1363	Open in IMG/M
3300009789\|Ga0126307_10033309	All Organisms → cellular organisms → Bacteria → Acidobacteria	3975	Open in IMG/M
3300009789\|Ga0126307_10033309	All Organisms → cellular organisms → Bacteria → Acidobacteria	3975	Open in IMG/M
3300010038\|Ga0126315_10929118	Not Available	579	Open in IMG/M
3300010041\|Ga0126312_10523300	Not Available	850	Open in IMG/M
3300010044\|Ga0126310_10970446	Not Available	667	Open in IMG/M
3300010047\|Ga0126382_10632459	Not Available	886	Open in IMG/M
3300010047\|Ga0126382_12327961	Not Available	518	Open in IMG/M
3300010359\|Ga0126376_11088506	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium	806	Open in IMG/M
3300010359\|Ga0126376_11372408	Not Available	730	Open in IMG/M
3300010362\|Ga0126377_12611752	Not Available	580	Open in IMG/M
3300010362\|Ga0126377_12611752	Not Available	580	Open in IMG/M
3300010375\|Ga0105239_12756487	Not Available	574	Open in IMG/M
3300010400\|Ga0134122_10153905	All Organisms → cellular organisms → Bacteria	1872	Open in IMG/M
3300011332\|Ga0126317_10397870	Not Available	663	Open in IMG/M
3300011332\|Ga0126317_10597151	Not Available	696	Open in IMG/M
3300011333\|Ga0127502_10486167	Not Available	581	Open in IMG/M
3300011333\|Ga0127502_10486167	Not Available	581	Open in IMG/M
3300011333\|Ga0127502_10486167	Not Available	581	Open in IMG/M
3300012212\|Ga0150985_106414359	Not Available	733	Open in IMG/M
3300012212\|Ga0150985_106414359	Not Available	733	Open in IMG/M
3300012384\|Ga0134036_1062907	Not Available	1049	Open in IMG/M
3300012384\|Ga0134036_1062907	Not Available	1049	Open in IMG/M
3300012951\|Ga0164300_10321373	Not Available	818	Open in IMG/M
3300013100\|Ga0157373_10687181	Not Available	749	Open in IMG/M
3300013306\|Ga0163162_10801443	Not Available	1059	Open in IMG/M
3300013760\|Ga0120188_1041895	Not Available	564	Open in IMG/M
3300014968\|Ga0157379_10355872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	1341	Open in IMG/M
3300015374\|Ga0132255_100642875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	1572	Open in IMG/M
3300018422\|Ga0190265_10016128	All Organisms → cellular organisms → Bacteria → Proteobacteria	5814	Open in IMG/M
3300018422\|Ga0190265_10016128	All Organisms → cellular organisms → Bacteria → Proteobacteria	5814	Open in IMG/M
3300018422\|Ga0190265_10016128	All Organisms → cellular organisms → Bacteria → Proteobacteria	5814	Open in IMG/M
3300018422\|Ga0190265_13593228	Not Available	517	Open in IMG/M
3300020060\|Ga0193717_1045501	All Organisms → cellular organisms → Bacteria	1588	Open in IMG/M
3300020146\|Ga0196977_1000084	All Organisms → cellular organisms → Bacteria	64863	Open in IMG/M
3300020146\|Ga0196977_1000084	All Organisms → cellular organisms → Bacteria	64863	Open in IMG/M
3300022467\|Ga0224712_10525025	Not Available	574	Open in IMG/M
3300025315\|Ga0207697_10345446	Not Available	661	Open in IMG/M
3300025315\|Ga0207697_10345446	Not Available	661	Open in IMG/M
3300025900\|Ga0207710_10208433	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus albus	967	Open in IMG/M
3300025900\|Ga0207710_10208433	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus albus	967	Open in IMG/M
3300025904\|Ga0207647_10294506	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300025904\|Ga0207647_10527939	Not Available	656	Open in IMG/M
3300025918\|Ga0207662_10044697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	2616	Open in IMG/M
3300025918\|Ga0207662_10044697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	2616	Open in IMG/M
3300025925\|Ga0207650_11768978	Not Available	523	Open in IMG/M
3300025927\|Ga0207687_10717590	All Organisms → cellular organisms → Bacteria	849	Open in IMG/M
3300025929\|Ga0207664_11593194	Not Available	575	Open in IMG/M
3300025932\|Ga0207690_10830606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	764	Open in IMG/M
3300025935\|Ga0207709_10416225	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300025935\|Ga0207709_10655623	Not Available	836	Open in IMG/M
3300025936\|Ga0207670_10000365	All Organisms → cellular organisms → Bacteria	26237	Open in IMG/M
3300025941\|Ga0207711_10435086	Not Available	1221	Open in IMG/M
3300025941\|Ga0207711_10435086	Not Available	1221	Open in IMG/M
3300025942\|Ga0207689_10804354	Not Available	793	Open in IMG/M
3300025942\|Ga0207689_11228383	Not Available	630	Open in IMG/M
3300025942\|Ga0207689_11228383	Not Available	630	Open in IMG/M
3300025945\|Ga0207679_10461667	Not Available	1128	Open in IMG/M
3300026035\|Ga0207703_10675193	All Organisms → cellular organisms → Bacteria → Proteobacteria	981	Open in IMG/M
3300026089\|Ga0207648_11145684	Not Available	730	Open in IMG/M
3300026095\|Ga0207676_10295392	All Organisms → cellular organisms → Bacteria → Proteobacteria	1477	Open in IMG/M
3300026095\|Ga0207676_10564189	All Organisms → cellular organisms → Bacteria → Proteobacteria	1089	Open in IMG/M
3300026116\|Ga0207674_10026795	All Organisms → cellular organisms → Bacteria	6113	Open in IMG/M
3300027637\|Ga0209818_1200979	Not Available	582	Open in IMG/M
3300027637\|Ga0209818_1200979	Not Available	582	Open in IMG/M
3300027637\|Ga0209818_1200979	Not Available	582	Open in IMG/M
3300027886\|Ga0209486_10731967	Not Available	641	Open in IMG/M
3300027907\|Ga0207428_10005771	All Organisms → cellular organisms → Bacteria → Proteobacteria	11490	Open in IMG/M
3300027909\|Ga0209382_10588518	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213	Open in IMG/M
3300027909\|Ga0209382_10588518	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213	Open in IMG/M
3300028380\|Ga0268265_11898248	Not Available	602	Open in IMG/M
3300031095\|Ga0308184_1000661	All Organisms → cellular organisms → Bacteria → Proteobacteria	1989	Open in IMG/M
3300031095\|Ga0308184_1000661	All Organisms → cellular organisms → Bacteria → Proteobacteria	1989	Open in IMG/M
3300031095\|Ga0308184_1000661	All Organisms → cellular organisms → Bacteria → Proteobacteria	1989	Open in IMG/M
3300031548\|Ga0307408_101527138	Not Available	632	Open in IMG/M
3300031740\|Ga0307468_101193380	Not Available	685	Open in IMG/M
3300031901\|Ga0307406_10429469	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1055	Open in IMG/M
3300032157\|Ga0315912_10009188	All Organisms → cellular organisms → Bacteria	8504	Open in IMG/M
3300034135\|Ga0334929_001297	All Organisms → cellular organisms → Bacteria	7115	Open in IMG/M
3300034135\|Ga0334929_001297	All Organisms → cellular organisms → Bacteria	7115	Open in IMG/M
3300034671\|Ga0314796_153746	Not Available	540	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	51.13%
Environmental	Environmental	47.37%
Engineered	Engineered	1.50%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	50.38%
Terrestrial	Environmental → Terrestrial	43.61%
Aquatic	Environmental → Aquatic	3.76%
Built Environment	Engineered → Built Environment	1.50%
Human	Host-Associated → Human	0.75%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	43.61%
Rhizoplane	Host-Associated → Plants → Rhizoplane	27.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.56%
Freshwater	Environmental → Aquatic → Freshwater	3.76%
Unclassified	Engineered → Built Environment → Unclassified	1.50%
Digestive System	Host-Associated → Human → Digestive System	0.75%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	35.34%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	25.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	18.80%
Loam	Environmental → Terrestrial → Soil → Loam	5.26%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	3.76%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.26%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	1.50%
Sand	Environmental → Terrestrial → Soil → Sand	1.50%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	1.50%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.75%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	25.56%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	18.80%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	10.53%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.26%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	3.76%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.26%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	1.50%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	1.50%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	1.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.75%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.75%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.75%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	15.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.02%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.02%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	6.02%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.51%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	3.76%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.76%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.01%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.01%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.01%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.01%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.50%
Hypolithic Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust	1.50%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	1.50%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.50%
Swimming Pool Sandfilter Backwash	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash	1.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.75%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.75%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.75%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.75%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.75%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.75%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.75%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.75%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.75%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.75%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.75%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300003267	Sugarcane bulk soil Sample L1	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009112	Microbial communities from sand-filter backwash in Singapore swimming pools - KB-2	Engineered	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012384	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300020146	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031095	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300034135	Biocrust microbial communities from Mojave Desert, California, United States - 25HNC	Environmental	Open in IMG/M
3300034671	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_17103292	3300000033	Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSKNCCNDPQ*
ICChiseqgaiiDRAFT_17103293	3300000033	Soil	MALEIVLDLQKLEVPQEEDLFGSSTGSSDSGCCNGRPN*
ICChiseqgaiiDRAFT_20771441	3300000033	Soil	MRRKESKPMAMELVLELQKLEVPTEEDLFGNSCTSSTSGCCNDKQLEG*
JGI11615J12901_103115791	3300000953	Soil	MAMELVLDLQKLEVPTEEDLFGSSCTSSSTDCCNGRQL
JGI11615J12901_106271092	3300000953	Soil	MALEIILDLQKLEVPQEEDLFGSSTGSSSTNCCNGREA*
soilL1_100209455	3300003267	Sugarcane Root And Bulk Soil	MAMELVLELQKLEVPTEEDLFGNSCTSSTSGCCNDKQLDA*
Ga0062593_1031986352	3300004114	Soil	MAMEIILDLQKLEVPQEEDLFGSSSGSSTSGCCNGAADA*
Ga0062589_1000426263	3300004156	Soil	MAMEIILDLQKLEVPQEEDLFGSSTGSSSSGCCNGAQQN*
Ga0062590_1003821792	3300004157	Soil	MAMEIILDLQKLEVPQEEDLFGSSTGSSSSGCCNGAHQN*
Ga0063356_1009226762	3300004463	Arabidopsis Thaliana Rhizosphere	MRKEETTMAMEIVLDLQKLEVPAEEELFGNSSGSSAGFCCNDNQG*
Ga0062592_1000275992	3300004480	Soil	RRKRAMAMEIVLDLQKLEVPQEEDLFGSSTGSSSKNCCNDQN*
Ga0062591_1000659341	3300004643	Soil	RAMAMEIVLDLQKLEVPQEEDLFGSSTGSSSKNCCNDQN*
Ga0058861_100390612	3300004800	Host-Associated	MAMELVLDLQKLEVPTEEDLFGNSSGSSSTDCCNGKQLNG*
Ga0070689_1012980102	3300005340	Switchgrass Rhizosphere	RRKTAMALEIVLDLQKLEVPQEEDLFGSSTGSSDSGCCNGHQN*
Ga0070659_1008998231	3300005366	Corn Rhizosphere	MAMEIILDLQKLEVPQEEDLFGNSSGSSTSGCCNGSSLDGN*
Ga0070701_111265071	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MAMEIILDLQKLDVPTEEDLFGSSSGSSVSGCCNGKEVEV*
Ga0070704_1020207621	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MSMELVLDLQKLEVPTEEDLFGNSSGSSSTDCCNGKQLNG*
Ga0070664_1010615613	3300005564	Corn Rhizosphere	MAMEIILELQKLEVPQEEDLFGNSSGSSTSDCCNNVRDTLG*
Ga0068857_1001203352	3300005577	Corn Rhizosphere	RRKKLMAMEIILDLQKLEVPQEEDLFGNSSGSSTSGCCNGSSLDGN*
Ga0068857_1024651212	3300005577	Corn Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTDHCCNGQQN*
Ga0068859_1000861633	3300005617	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSQFKCCNGSEN*
Ga0068859_1000861634	3300005617	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQN*
Ga0068859_1002549723	3300005617	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTTSSTDRCCNGQQN*
Ga0068859_1002578592	3300005617	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSYKCCNGSEN*
Ga0068859_1006157821	3300005617	Switchgrass Rhizosphere	TRTMAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQQ*
Ga0068864_1000051945	3300005618	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPREEDLFGSSTTSSTDRCCNGQQN*
Ga0068864_1002529022	3300005618	Switchgrass Rhizosphere	MAMEIILDLQKLEVPQEEDLFGSSTGSSQFKCCNGSEN*
Ga0068864_1006494662	3300005618	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSKNCCNDQN*
Ga0068864_1011857571	3300005618	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPAEEELFGNSSGSSAGWCCNDNQG*
Ga0068864_1011857572	3300005618	Switchgrass Rhizosphere	MAMDIVLDLQKLEVPKEEELFGDSSGSSALACCNDNNG*
Ga0068863_1004116782	3300005841	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTSDCCNGRQQ*
Ga0068863_1011522181	3300005841	Switchgrass Rhizosphere	TRTMAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQN*
Ga0068858_1000324043	3300005842	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQQ*
Ga0068858_1012296012	3300005842	Switchgrass Rhizosphere	GTRTMAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQN*
Ga0068862_1012582992	3300005844	Switchgrass Rhizosphere	MAMELVLELQKLEVPTEEDLFGNSCTSSTSGCCNDKQLEG*
Ga0068862_1023274281	3300005844	Switchgrass Rhizosphere	MAMEIILDLQKLEVPTEEDLFGSSSGSSASGCCNGKELN*
Ga0075428_1026591402	3300006844	Populus Rhizosphere	MQAQMEIVLDLQKLEVPEEEMFFGNSCSSSDYNCCNNPK*
Ga0075421_1015754632	3300006845	Populus Rhizosphere	MQAQMEIVLDLQKLEVPEEEVFFGNSTTSSRAGCCNGQN*
Ga0075431_1000746594	3300006847	Populus Rhizosphere	MQAQMEIVLDLQKLEVPEEEVFFGSSATSSRAGCCNGQN*
Ga0075431_1012014291	3300006847	Populus Rhizosphere	MAMELVLDLQKLEVPTEEDLFGSSTGSSVSGCCNGKELEA*
Ga0079217_101079382	3300006876	Agricultural Soil	MAMEIVLDLQKLEVPNEEELFGDSSGSSAAFCCRDNQG*
Ga0079217_101079383	3300006876	Agricultural Soil	MAMEIVLDLQKLEVPTEEDLFGNSSGSSAAFCCNDNQG*
Ga0079217_101079384	3300006876	Agricultural Soil	MAMDIVLDLQKLELPKEEELFGDSSGSSALACCNDNNG*
Ga0097620_1031081091	3300006931	Switchgrass Rhizosphere	MALEIVLDLQKLEVPQEEDLFGSSTGSSDSGCCNGHQN*
Ga0079218_116210631	3300007004	Agricultural Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSSGCCNGQHQN
Ga0105247_100172373	3300009101	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSYRCCNGSEN*
Ga0115923_1003101120	3300009112	Swimming Pool Sandfilter Backwash	MAMEIVLDLQRLDTPVDEDFFGSSSGSSVSGCCNNHHRVDS*
Ga0115923_1003101121	3300009112	Swimming Pool Sandfilter Backwash	MAMEIVLDLQKLDTPVDEDFFGSSSGSSVSGCCNGSSHQLER*
Ga0105243_105490622	3300009148	Miscanthus Rhizosphere	MAMELVLDLQKLEVPTEEDLFGNSSGSSNSGCCNGKQLDA*
Ga0111538_100184067	3300009156	Populus Rhizosphere	MEIVLDLQKLELPEEEVFFGNSCSSSDYNCCNNPK*
Ga0105248_100179464	3300009177	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPAEEELFGNSSGSSAGFCCNDNQG*
Ga0105248_105051422	3300009177	Switchgrass Rhizosphere	MAMEIILDLQKLEVPQEEDLFGSSTGSSQTNCCNGQN*
Ga0105248_105051423	3300009177	Switchgrass Rhizosphere	MAMDIVLDLQKLEVPQEEDLFGSSTGSSQSGCCNNQN*
Ga0126307_100333092	3300009789	Serpentine Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSSGCCNGQQN*
Ga0126307_100333093	3300009789	Serpentine Soil	MAMEIILDLQKLEVPQQEDLFGSSTGSSTTNCCNGQQN*
Ga0126315_109291181	3300010038	Serpentine Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSQSGCCNNQN*
Ga0126312_105233002	3300010041	Serpentine Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSSGCCNNQQ*
Ga0126310_109704462	3300010044	Serpentine Soil	MAMELVLDLQKLEVPQEEDLFGNSTGSSQTNCCNGQQ*
Ga0126382_106324593	3300010047	Tropical Forest Soil	MAMEIILDLQKLEVPQEEELLGNSCTSSWSGCCKEN*
Ga0126382_123279612	3300010047	Tropical Forest Soil	MAMEIVLDLQKLEVPREEDLFGSSTGSSSKNCCNDPQ*
Ga0126376_110885062	3300010359	Tropical Forest Soil	MAMETILKLQKLEMPAAEDLFGNSSGSSQSDCCKGQN*
Ga0126376_113724082	3300010359	Tropical Forest Soil	MALEIVLDLQKLEVPREEDLFGSSTGSSDSGCCNNRPN*
Ga0126377_126117521	3300010362	Tropical Forest Soil	MAMEIILDLQKLEVPKEEDLFGNSTGSSSDHCCNGQQN*
Ga0126377_126117522	3300010362	Tropical Forest Soil	MAMDIVLDLQKLEVPTEEDLFGSSTGSSSSHCCNNQQ*
Ga0105239_127564872	3300010375	Corn Rhizosphere	SFQTSLKKGGTRTMAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQQ*
Ga0134122_101539053	3300010400	Terrestrial Soil	MAMEIVLDLQKLEVPREEDLFGSSTTSSTERCCNGQQN*
Ga0126317_103978701	3300011332	Soil	MAMDIVLDLQKLEVPETDDLWGSSCTSSTSGCCNGKELDGG*
Ga0126317_105971511	3300011332	Soil	MAMEIILELQRLEVPQEEDLFGNSSSSSVSDCCKGQNQTGF*
Ga0127502_104861671	3300011333	Soil	MAMEIVLDLQKLEVPTEEDLFGNSSGSSAAFCCDDNQG*
Ga0127502_104861672	3300011333	Soil	MAMEVVLDLQKLEVPTEEELFGDSSGSSAAFCCRDNQG*
Ga0127502_104861673	3300011333	Soil	MAMDIVLDLQKLELPKEEELFGDSSGSSALACCNDNQG*
Ga0150985_1064143592	3300012212	Avena Fatua Rhizosphere	MAMEIILDLQKLEVPREEDLFGNSCSSSTSGCCNGSADT*
Ga0150985_1064143593	3300012212	Avena Fatua Rhizosphere	MAMEIILELQKLEVPVEEDLFGNSCTSSTSGCCNDKEA*
Ga0134036_10629072	3300012384	Grasslands Soil	MAMDIVLDLQKLEVPDTDPQFGNSCTSSTSGCCNGSADESTGG*
Ga0134036_10629073	3300012384	Grasslands Soil	MAMDIVLDLQKLEVPDTDPQFGSSCTSSTSDCCNGKGTDAAS*
Ga0164300_103213731	3300012951	Soil	MAMEMILDLQKLEIPQEEELFGNSCTSSWSNCCKDQN*
Ga0157373_106871811	3300013100	Corn Rhizosphere	MRRKESKPMAMELVLDLQKLEVPTEEDLFGNSSGSSNSGCCNGKQLDA*
Ga0163162_108014432	3300013306	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSSDCCNGRQQ*
Ga0120188_10418951	3300013760	Terrestrial	RSKAMAMEIVLDLQKLEVPQEEDLFGSSTGSSSSGCCNGQQN*
Ga0157379_103558721	3300014968	Switchgrass Rhizosphere	EIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQQ*
Ga0132255_1006428753	3300015374	Arabidopsis Rhizosphere	KERRKRAMAMEIVLDLQKLEVPQEEDLFGSSTGSSSYKCCNGSEN*
Ga0190265_100161281	3300018422	Soil	MAMDIVLELQKLEVPQEEDLFGNSTGSSQSGCCNGKELEV
Ga0190265_100161283	3300018422	Soil	MAMEIVLELQKLEVPQEEDLFGNSTGSSQTNCCNGKELDV
Ga0190265_100161284	3300018422	Soil	MAMEIVLELQKLEVPQEEDLFGNSAGSSWADCCFPRDLDG
Ga0190265_135932281	3300018422	Soil	MAMEIILDLQKLEVPVEEDLFGNSTGSSQSGCCNGREV
Ga0193717_10455012	3300020060	Soil	MDIVLELQKLEVPEEDELFGNSTGSSVSGCCNGKELEV
Ga0196977_100008419	3300020146	Soil	MAMEIVLDLQKLEVPAEEELFGNSSGSSAGFCCNDNQG
Ga0196977_100008420	3300020146	Soil	MAMEIVLDLQKLEVPREEELFGDSSGSSALACCNDNNG
Ga0224712_105250251	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MQIVLELQKLEIPTEENIFGDSCTSSHDGCCNGVANT
Ga0207697_103454461	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MALEIVLDLQKLEVPQEEDLFGSSTGSSDSGCCNGRPN
Ga0207697_103454462	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSKNCCNDPQ
Ga0207710_102084331	3300025900	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSYKCCNGSEN
Ga0207710_102084332	3300025900	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQQ
Ga0207647_102945062	3300025904	Corn Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSQFKCCNGSEN
Ga0207647_105279391	3300025904	Corn Rhizosphere	MAMEIVLDLQKLEVPREEDLFGSSTTSSTDRCCNGQQN
Ga0207662_100446972	3300025918	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTSDCCNGRQQ
Ga0207662_100446973	3300025918	Switchgrass Rhizosphere	MAMEIILDLQKLEVPQEEDLFGSSTGSSSYKCCNGSEN
Ga0207650_117689782	3300025925	Switchgrass Rhizosphere	MAMDIVLELQKLEIPQEEELLGNSCTSSWSGCCKEN
Ga0207687_107175901	3300025927	Miscanthus Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSSYKCCNGS
Ga0207664_115931941	3300025929	Agricultural Soil	MQIVLELQKLEIPTEENIFGDSCTSSHDGCCNGAANQ
Ga0207690_108306062	3300025932	Corn Rhizosphere	MAMEIILDLQKLEVPQEEDLFGNSSGSSTSGCCNGSSLDGN
Ga0207709_104162251	3300025935	Miscanthus Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTSDCCNGRQ
Ga0207709_106556231	3300025935	Miscanthus Rhizosphere	MAMELVLDLQKLEVPTEEDLFGNSSGSSNSGCCNGKQLDA
Ga0207670_1000036516	3300025936	Switchgrass Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTTSSTDRCCNGQQN
Ga0207711_104350862	3300025941	Switchgrass Rhizosphere	MAMEIILDLQKLEVPQEEDLFGSSTGSSQTNCCNGQN
Ga0207711_104350863	3300025941	Switchgrass Rhizosphere	MAMDIVLDLQKLEVPQEEDLFGSSTGSSQSGCCNNQN
Ga0207689_108043542	3300025942	Miscanthus Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQN
Ga0207689_112283832	3300025942	Miscanthus Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTDHCCNGQQN
Ga0207689_112283833	3300025942	Miscanthus Rhizosphere	TQERRRKVMAMEIILDLQKLELPQQEEELFGNSTGSSSSHCCNNEN
Ga0207679_104616671	3300025945	Corn Rhizosphere	MAMEIILELQKLEVPQEEDLFGNSSGSSTSDCCNNVRDTLG
Ga0207703_106751932	3300026035	Switchgrass Rhizosphere	QTSLKKGGTRTMAMEIVLDLQKLEVPQEEDLFGSSTGSSTGDCCNGRQN
Ga0207648_111456842	3300026089	Miscanthus Rhizosphere	RRKESKPMAMELVLDLQKLEVPTEEDLFGNSSGSSSTDCCNGKQLNG
Ga0207676_102953921	3300026095	Switchgrass Rhizosphere	MAMEIILDLQKLEVPQEEDLFGSSTGSSQFKCCNGSEN
Ga0207676_105641891	3300026095	Switchgrass Rhizosphere	ISRGRRKRAMAMEIVLDLQKLEVPQEEDLFGSSTGSSSKNCCNDQN
Ga0207674_100267952	3300026116	Corn Rhizosphere	MAMEIILELQKLEVPQEEDLFGNSSGSSTSGCCNGSSLDGN
Ga0209818_12009791	3300027637	Agricultural Soil	MAMEIVLDLQKLEVPNEEELFGDSSGSSAAFCCRDNQG
Ga0209818_12009792	3300027637	Agricultural Soil	MAMEIVLDLQKLEVPTEEDLFGNSSGSSAAFCCNDNQG
Ga0209818_12009793	3300027637	Agricultural Soil	MAMDIVLDLQKLELPKEEELFGDSSGSSALACCNDNNG
Ga0209486_107319673	3300027886	Agricultural Soil	MAMDIVLDLQKLELPKEEELFGDSSGSSALACCNDNQG
Ga0207428_100057713	3300027907	Populus Rhizosphere	MQAQMEIVLDLQKLEVPEEEVFFGSSATSSRAGCCNGQN
Ga0209382_105885181	3300027909	Populus Rhizosphere	MQAQMEIVLDLQKLEVPEEEMFFGNSCSSSDYNCCNNPK
Ga0209382_105885182	3300027909	Populus Rhizosphere	MQAQMEIVLDLQKLEVPEEEVFFGNSTTSSRAGCCNGQN
Ga0268265_118982481	3300028380	Switchgrass Rhizosphere	MAMELVLELQKLEVPTEEDLFGNSCTSSTSGCCNDKQLEG
Ga0308184_10006612	3300031095	Soil	MAMDIVLELQKLEVPQEDELLGNSTGSSVSSCCNGKELEA
Ga0308184_10006614	3300031095	Soil	MAMDIVLELQKLEVPQEEDLFGNSTGSSTDHCCNGKELDA
Ga0308184_10006616	3300031095	Soil	MAMDIVLELQKLEVPQEEDLFGNSTGSSTDHCCNNRDLDA
Ga0307408_1015271382	3300031548	Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGHSTGSSTDNCCNGPN
Ga0307468_1011933802	3300031740	Hardwood Forest Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTSGCCNGHQN
Ga0307406_104294693	3300031901	Rhizosphere	MAMEIVLDLQKLEVPQEEDLFGSSTGSSQSNCCNQY
Ga0315912_1000918811	3300032157	Soil	MAMEIVLDLQKLEVPQEEDLFGSSTGSSTSHCCNNQN
Ga0334929_001297_3898_4011	3300034135	Hypolithic Biocrust	MAMEIVLDLQKLEVPQEEDLFGNSSGSSTSNCCNGSN
Ga0334929_001297_4351_4464	3300034135	Hypolithic Biocrust	MAMEIVLDLQKLEVPQEEDLFGNSSGSSTSGCCNGSN
Ga0314796_153746_436_540	3300034671	Soil	MAMELVLDLQKLEVPTEEDLFGNSCTSSTTDCCNG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F059739

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences