NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059687

Metagenome / Metatranscriptome Family F059687

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059687
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 44 residues
Representative Sequence RWSAYWDKKHGVWRVAEDDPDSDLYAESSDADTVIGYITAHT
Number of Associated Samples 107
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.27 %
% of genes near scaffold ends (potentially truncated) 83.46 %
% of genes from short scaffolds (< 2000 bps) 92.48 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.045 % of family members)
Environment Ontology (ENVO) Unclassified
(22.556 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.105 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.71%    β-sheet: 22.86%    Coil/Unstructured: 61.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF03869Arc 4.51
PF05016ParE_toxin 4.51
PF13376OmdA 2.26
PF04149DUF397 1.50
PF01844HNH 1.50
PF01042Ribonuc_L-PSP 1.50
PF01636APH 1.50
PF00589Phage_integrase 1.50
PF14031D-ser_dehydrat 1.50
PF13391HNH_2 1.50
PF13560HTH_31 1.50
PF12697Abhydrolase_6 1.50
PF00406ADK 0.75
PF01965DJ-1_PfpI 0.75
PF01872RibD_C 0.75
PF12840HTH_20 0.75
PF08240ADH_N 0.75
PF07690MFS_1 0.75
PF02467Whib 0.75
PF07927HicA_toxin 0.75
PF07714PK_Tyr_Ser-Thr 0.75
PF03109ABC1 0.75
PF02577BFN_dom 0.75
PF03793PASTA 0.75
PF13411MerR_1 0.75
PF11356T2SSC 0.75
PF03372Exo_endo_phos 0.75
PF00005ABC_tran 0.75
PF13581HATPase_c_2 0.75
PF01909NTP_transf_2 0.75
PF04191PEMT 0.75
PF01243Putative_PNPOx 0.75
PF00440TetR_N 0.75
PF00571CBS 0.75
PF06240COXG 0.75
PF12680SnoaL_2 0.75
PF08751TrwC 0.75
PF13091PLDc_2 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.01
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.50
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.75
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.75
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.75
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.75
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.75
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.75
COG3427Carbon monoxide dehydrogenase subunit CoxGEnergy production and conversion [C] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.14 %
UnclassifiedrootN/A42.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_100220592All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300005176|Ga0066679_10085811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1889Open in IMG/M
3300005329|Ga0070683_101341002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium688Open in IMG/M
3300005335|Ga0070666_11060630Not Available602Open in IMG/M
3300005434|Ga0070709_10223880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1343Open in IMG/M
3300005435|Ga0070714_100165920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2001Open in IMG/M
3300005435|Ga0070714_100800885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii912Open in IMG/M
3300005435|Ga0070714_102188634Not Available538Open in IMG/M
3300005467|Ga0070706_101337128Not Available657Open in IMG/M
3300005467|Ga0070706_101993055Not Available526Open in IMG/M
3300005531|Ga0070738_10159285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1089Open in IMG/M
3300005534|Ga0070735_10589747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium660Open in IMG/M
3300005554|Ga0066661_10733734Not Available579Open in IMG/M
3300005591|Ga0070761_10985856Not Available534Open in IMG/M
3300005614|Ga0068856_101086304Not Available818Open in IMG/M
3300005841|Ga0068863_102552972Not Available520Open in IMG/M
3300005921|Ga0070766_11224246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii520Open in IMG/M
3300006028|Ga0070717_12044207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300006954|Ga0079219_10034813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2030Open in IMG/M
3300009137|Ga0066709_100477198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola1751Open in IMG/M
3300009162|Ga0075423_12708303Not Available543Open in IMG/M
3300009174|Ga0105241_10163318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1833Open in IMG/M
3300009520|Ga0116214_1059709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1386Open in IMG/M
3300009665|Ga0116135_1193993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300009672|Ga0116215_1117297Not Available1190Open in IMG/M
3300009698|Ga0116216_10201297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WM63781222Open in IMG/M
3300009839|Ga0116223_10498288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba709Open in IMG/M
3300010048|Ga0126373_12713014Not Available553Open in IMG/M
3300010335|Ga0134063_10302822Not Available769Open in IMG/M
3300010343|Ga0074044_10543781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti758Open in IMG/M
3300010396|Ga0134126_11706943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba691Open in IMG/M
3300010876|Ga0126361_10178895Not Available518Open in IMG/M
3300010876|Ga0126361_10548532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1239Open in IMG/M
3300010876|Ga0126361_10676862Not Available596Open in IMG/M
3300010876|Ga0126361_11101695Not Available1417Open in IMG/M
3300011271|Ga0137393_10240991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1534Open in IMG/M
3300012198|Ga0137364_10639762Not Available802Open in IMG/M
3300012200|Ga0137382_11154292Not Available552Open in IMG/M
3300012206|Ga0137380_10035181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4621Open in IMG/M
3300012208|Ga0137376_10306848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1377Open in IMG/M
3300012209|Ga0137379_10194285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1942Open in IMG/M
3300012209|Ga0137379_10755508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300012361|Ga0137360_11865134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi507Open in IMG/M
3300012395|Ga0134044_1015828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300012507|Ga0157342_1018360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba792Open in IMG/M
3300012510|Ga0157316_1020503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba719Open in IMG/M
3300012532|Ga0137373_11010011Not Available602Open in IMG/M
3300013308|Ga0157375_11803197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba725Open in IMG/M
3300014657|Ga0181522_10710288Not Available614Open in IMG/M
3300015373|Ga0132257_101006595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1049Open in IMG/M
3300017926|Ga0187807_1058702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1195Open in IMG/M
3300017942|Ga0187808_10276785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales754Open in IMG/M
3300017955|Ga0187817_10947847Not Available551Open in IMG/M
3300017970|Ga0187783_10188920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1515Open in IMG/M
3300018046|Ga0187851_10823556Not Available522Open in IMG/M
3300018085|Ga0187772_11458978Not Available509Open in IMG/M
3300020579|Ga0210407_10512150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii938Open in IMG/M
3300020582|Ga0210395_10538216All Organisms → cellular organisms → Bacteria → Terrabacteria group878Open in IMG/M
3300021403|Ga0210397_10663123Not Available800Open in IMG/M
3300021404|Ga0210389_10768707Not Available753Open in IMG/M
3300021405|Ga0210387_10690696Not Available905Open in IMG/M
3300021407|Ga0210383_10077944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2773Open in IMG/M
3300021407|Ga0210383_10309330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1360Open in IMG/M
3300021407|Ga0210383_10403748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1179Open in IMG/M
3300021407|Ga0210383_10444436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1119Open in IMG/M
3300021407|Ga0210383_11507867Not Available556Open in IMG/M
3300021433|Ga0210391_10996405All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300021474|Ga0210390_10153454Not Available1940Open in IMG/M
3300021474|Ga0210390_11450418Not Available545Open in IMG/M
3300021476|Ga0187846_10344366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii615Open in IMG/M
3300021477|Ga0210398_10547521All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300021477|Ga0210398_11049717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium649Open in IMG/M
3300022721|Ga0242666_1208840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Myxococcales incertae sedis → Enhygromyxa → Enhygromyxa salina501Open in IMG/M
3300024222|Ga0247691_1057743Not Available586Open in IMG/M
3300024295|Ga0224556_1095229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300025898|Ga0207692_10710085Not Available653Open in IMG/M
3300025910|Ga0207684_10448493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1108Open in IMG/M
3300025916|Ga0207663_11473367Not Available548Open in IMG/M
3300025928|Ga0207700_10104129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinisilvae2270Open in IMG/M
3300025928|Ga0207700_10870435Not Available806Open in IMG/M
3300025928|Ga0207700_10985788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300025929|Ga0207664_10390130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1237Open in IMG/M
3300025949|Ga0207667_11598078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium621Open in IMG/M
3300026078|Ga0207702_10855468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium900Open in IMG/M
3300026078|Ga0207702_11553353Not Available655Open in IMG/M
3300026326|Ga0209801_1073951All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300026489|Ga0257160_1027965Not Available921Open in IMG/M
3300027641|Ga0208827_1127659Not Available726Open in IMG/M
3300027737|Ga0209038_10087294Not Available939Open in IMG/M
3300027795|Ga0209139_10242234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Myxococcales incertae sedis → Enhygromyxa → Enhygromyxa salina637Open in IMG/M
3300027905|Ga0209415_10076494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3907Open in IMG/M
3300027905|Ga0209415_10649163Not Available769Open in IMG/M
3300028536|Ga0137415_10730613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba802Open in IMG/M
3300028808|Ga0302228_10400667Not Available609Open in IMG/M
3300028879|Ga0302229_10183636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia960Open in IMG/M
3300029943|Ga0311340_10475121Not Available1125Open in IMG/M
3300029943|Ga0311340_11383901Not Available556Open in IMG/M
3300029999|Ga0311339_11004604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia781Open in IMG/M
3300030007|Ga0311338_10782756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300030056|Ga0302181_10384517Not Available608Open in IMG/M
3300030494|Ga0310037_10072813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1614Open in IMG/M
3300030520|Ga0311372_12316232Not Available612Open in IMG/M
3300030580|Ga0311355_10832163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alboflavus844Open in IMG/M
3300030617|Ga0311356_10071805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3663Open in IMG/M
3300031028|Ga0302180_10585645Not Available538Open in IMG/M
3300031233|Ga0302307_10631688Not Available539Open in IMG/M
3300031234|Ga0302325_10666185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1510Open in IMG/M
3300031234|Ga0302325_12246605Not Available662Open in IMG/M
3300031234|Ga0302325_12913895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → Marmoricola mangrovicus556Open in IMG/M
3300031236|Ga0302324_100621045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1545Open in IMG/M
3300031236|Ga0302324_101086298Not Available1078Open in IMG/M
3300031525|Ga0302326_10326074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2434Open in IMG/M
3300031564|Ga0318573_10412322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300031708|Ga0310686_112317260Not Available754Open in IMG/M
3300031720|Ga0307469_10371273Not Available1210Open in IMG/M
3300031793|Ga0318548_10517404Not Available583Open in IMG/M
3300031896|Ga0318551_10573485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300031942|Ga0310916_11049136Not Available679Open in IMG/M
3300032063|Ga0318504_10541548Not Available558Open in IMG/M
3300032068|Ga0318553_10678447Not Available539Open in IMG/M
3300032515|Ga0348332_12844956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium856Open in IMG/M
3300032770|Ga0335085_10261521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2073Open in IMG/M
3300032770|Ga0335085_11477168Not Available709Open in IMG/M
3300032770|Ga0335085_11581079Not Available680Open in IMG/M
3300032783|Ga0335079_10156635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2552Open in IMG/M
3300032783|Ga0335079_11830986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300032805|Ga0335078_10501290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1560Open in IMG/M
3300032805|Ga0335078_11989544Not Available623Open in IMG/M
3300032892|Ga0335081_12125003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300032893|Ga0335069_11178338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia840Open in IMG/M
3300032895|Ga0335074_10346176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1657Open in IMG/M
3300032895|Ga0335074_11025982Not Available723Open in IMG/M
3300033158|Ga0335077_10282252Not Available1825Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.05%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa13.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.02%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.52%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.02%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil3.01%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.01%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.01%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.26%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.50%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.75%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.75%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10022059233300004091Bog Forest SoilWSAFWDKKRGVWQVAEDDPDSDFHAESPDASTVIAYMKSHS*
Ga0066679_1008581113300005176SoilKLAPMPRWSVCWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIMAHA*
Ga0070683_10134100213300005329Corn RhizosphereFLADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC*
Ga0070666_1106063023300005335Switchgrass RhizospherePRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC*
Ga0070709_1022388023300005434Corn, Switchgrass And Miscanthus RhizosphereVVIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIVAHA*
Ga0070714_10016592033300005435Agricultural SoilLHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITACS*
Ga0070714_10080088513300005435Agricultural SoilSVFWDKRDGLWRVAEDDPDSDLYAEAANADTVIDYMVAHS*
Ga0070714_10218863423300005435Agricultural SoilLADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC*
Ga0070706_10133712813300005467Corn, Switchgrass And Miscanthus RhizosphereVSPGGDKKYGLWRVAEDDPDSDLYAESSDADTVISYFMAHT*
Ga0070706_10199305523300005467Corn, Switchgrass And Miscanthus RhizosphereMAGRPRWSVFWDKAYGVWRAAEDDPDSVLYTESRDADTVIGYIATHS*
Ga0070738_1015928513300005531Surface SoilPQWSAFWDKRNGLWRVADDDPYSDLYAASADADKVIAYMAAHS*
Ga0070735_1058974723300005534Surface SoilLADHPRWSAWWDKKHGLWRVAEDDQDSDLYAESSDADTVMDYITAHA*
Ga0066661_1073373423300005554SoilRASTRPAHLGDKLAPMPRWSVCWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIMAHA*
Ga0070761_1098585613300005591SoilWDKASGVWRVTEDDPDSALHAESSDAATVVSYIQSHA*
Ga0068856_10108630413300005614Corn RhizosphereFLADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIGYIVAHA*
Ga0068863_10255297213300005841Switchgrass RhizosphereYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHA*
Ga0070766_1122424613300005921SoilSCFLADHPRWSAWWDKKHGLWRVAEDDPDSDLYAESSDADTVMGYITAHA*
Ga0070717_1204420723300006028Corn, Switchgrass And Miscanthus RhizosphereWSAFWDKRDGVWRVAEDDPDSDLYAECRDADTVIGYITAHL*
Ga0079219_1003481373300006954Agricultural SoilFLTDQPRWSIYWDKKYGLWRVAEDDPDSDLYAESNDADTVIGYVVTHA*
Ga0066709_10047719843300009137Grasslands SoilMAGRPRWSVFWDKAYGVWRASEDDPDSALYAESRDPDTVISYITAHA*
Ga0075423_1270830333300009162Populus RhizosphereEHLRWSIYWDKKYGLWRVAEDDSDSDLYAESSDADIVISYVVAHA*
Ga0105241_1016331823300009174Corn RhizosphereYWDKKYGLWRVAEDDPDSDLYAESSNADTVIGYIVAHA*
Ga0116214_105970953300009520Peatlands SoilLADQPRWSVYWDKKHGLWHRAEDDPDSDLYAESSDADAVIGYIAAHA*
Ga0116135_119399313300009665PeatlandDHRSWSAWWDKHYGLWRVAEDDTDSDLYAESCDADVVIRYMQAHS*
Ga0116215_111729743300009672Peatlands SoilGWSASWDKKHGVWRVADDDPDSDLYAESADAATVIGYITAHR*
Ga0116216_1020129713300009698Peatlands SoilRWSVYWDKRFGVWRVSEDDPDSELYAESSDADTVLAYITAHS*
Ga0116223_1049828833300009839Peatlands SoilSCFLADQPRWSVYWDNKHGLWRVAEDDPDSDLYAESSDADAVIGYIAAHA*
Ga0126373_1271301423300010048Tropical Forest SoilAFWDKRYGVWRVAEDDPDSALYAESADAAEVLRYMTVHS*
Ga0134063_1030282223300010335Grasslands SoilVSCFLAEHPRWSAWWDKKYGLWRVAEDDPDSGLYLESSDADAVIGYIMAHA*
Ga0074044_1054378123300010343Bog Forest SoilHQRWSVCWDKRHGVWRAAEDDPESDLYAESLDADTVISYIAAHS*
Ga0134126_1170694333300010396Terrestrial SoilADQLRWSVYWDKKYGLWRVAEDDPDSDLYAESSDADTVISYIVAHA*
Ga0126361_1017889523300010876Boreal Forest SoilCFLADHPRWSAWWDKRYGLWRVAEDDPDSDLYAESSDADTVMGYITAHA*
Ga0126361_1054853233300010876Boreal Forest SoilDHPGWSVFWDKAHGVWRVADDDPDSGLYAESSDADAVISYIQAHC*
Ga0126361_1067686223300010876Boreal Forest SoilVFWDKAHGVWRVADDDPDSGLYAESSDAGTVIGYIQAHA*
Ga0126361_1110169523300010876Boreal Forest SoilVFWDKRSSVWRVADDDPDSGLYAESSDADTVISYIQAHG*
Ga0137393_1024099113300011271Vadose Zone SoilSLPEPPGLSAFLSKRHGVWLVTEDDPDSALYAESADATEVLGYMTAHS*
Ga0137364_1063976213300012198Vadose Zone SoilMPRWSVCWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIMAHA*
Ga0137382_1115429213300012200Vadose Zone SoilMQDRPRWSVFWDKRYGVWRAAEDDPDSALYTESCDADTVIGYITSHA*
Ga0137380_1003518153300012206Vadose Zone SoilMSGSRIWSGAAYWDKKYGLWRVAEDDPDSDLYAESSDADTVISYISAHS*
Ga0137376_1030684823300012208Vadose Zone SoilMQDRPRWSVFWDKRYGVWRAAEDDPDSALYTESCDADTVIGYITTHT*
Ga0137379_1019428543300012209Vadose Zone SoilLAEHLRWSVWWDKKYGLWRVAEDDPDSDLYAEGSDADTVISYIMAHA*
Ga0137379_1075550813300012209Vadose Zone SoilPRWSIYWDKNYGLWRVAEDDPDSDLYAESSDADTVIGYITEHA*
Ga0137360_1186513423300012361Vadose Zone SoilSFLQEHLPWSAFWDKGRGVWRVAEDDPDSTLYTESRDVDTVIGYITEKS*
Ga0134044_101582823300012395Grasslands SoilDKRYGVWRVAEDDPDSDLYAESSQATIVITYIQAHSRDW*
Ga0157342_101836033300012507Arabidopsis RhizosphereRWSIYWDKKYGLWRVAEDDPDSELYAESSDADTVIGYIVAHA*
Ga0157316_102050333300012510Arabidopsis RhizosphereLAYQPRWSIYWDKKYGLWRAAEDDPDSDLYAESSDADTVIGYIVAHA*
Ga0137373_1101001123300012532Vadose Zone SoilLAEHLRWSVWWDKKYGLWRVAEDDPDSDLYAEGSDADTVIRYIMAHA*
Ga0157375_1180319713300013308Miscanthus RhizosphereLADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIGYIVAHA*
Ga0181522_1071028823300014657BogAGHLGWSAFWDKGSGVWRVAEDDPDSGLHAESSDAATVISYIQAHA*
Ga0132257_10100659513300015373Arabidopsis RhizosphereDQLRWSVYWDKKYGLRRVAEDDPDSDLYAESSDADTVIGYIVAHA*
Ga0187807_105870223300017926Freshwater SedimentLRWSAYWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIVAHA
Ga0187808_1027678523300017942Freshwater SedimentWWSAFWDKEYGVWRVAEDDPDSALYAESADAAEVLSYMTAHT
Ga0187817_1094784713300017955Freshwater SedimentSAFRDKRHGVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0187783_1018892023300017970Tropical PeatlandVFLSEYSCWSVFWDKKYAVWRAAEDDPCSVLYAEAADVDAVISFITAHT
Ga0187851_1082355613300018046PeatlandWSAWWDKHYGLWRVAEDDTDSDLYAESCDADVVIRYMRAHS
Ga0187772_1145897813300018085Tropical PeatlandVAQLTSFLQQHPWWSAFWDKRYAVWRVAEDDPDSALYAESADAAEILS
Ga0210407_1051215023300020579SoilHDHPRWSVFWDKRYGLWRAAEDDPDSDLYAEAANADAVIQYMTAHS
Ga0210395_1053821613300020582SoilFLQQHPWWSAFWDKKYAVWRVAEDDPDSALYAESADAAEVVRYMAAHS
Ga0210397_1066312313300021403SoilSIFWDKRYGLWRAAEDDPDSDLYAEAGNADTVIQYMTAHS
Ga0210389_1076870713300021404SoilADHLRWSAYWDKKYGLWRVAEDDPDSDLYAESSNADAVISYIVAHG
Ga0210387_1069069623300021405SoilGHWDKKYGLWRVAEDNPDSDLYAESSDADTVTGYITAHS
Ga0210383_1007794453300021407SoilRPYHQLPRDHSRWSVFWDKRYGLWRAAEDDPDSDLYAEAGNADTVIQYMAAHS
Ga0210383_1030933023300021407SoilVVHLVGQEHGLWRVAEDDPDSDLYAESSDADAVMGYITAHA
Ga0210383_1040374823300021407SoilSAYWDKKYGLWRVAEDDPDSDLHAESSDADTVISYIAAHA
Ga0210383_1044443623300021407SoilTFLEQHPWWSAFWDKQYSVWRVAEDDPDSNLYAESADATEVLSYMAAHP
Ga0210383_1150786723300021407SoilWDQRYGVWRVAEDDPDSGLYAESSDADAVISYIQAHA
Ga0210391_1099640523300021433SoilGRLIAFLQHHPRWSVFYDKRHRLWRAAEDDPDSDLYTEASDVDTVIGYITAHR
Ga0210390_1015345453300021474SoilRWSVFWDKRYGLWRAAEDDPDSDLYAEAGNADTVIQYMTAHS
Ga0210390_1145041823300021474SoilWDKTHAVWRAAEDDPDSGLYTESSDADTVISYIQAHG
Ga0187846_1034436613300021476BiofilmTSFLQQHPWWSAFWDKEHGVWRVAEDDPDSALYAESADAAEVLRYMAAHS
Ga0210398_1054752123300021477SoilLIAFLQHHPRWSVFYDKRHRLWRAAEDDPDSDLYTEASDVDTVIGYITAHR
Ga0210398_1104971723300021477SoilWDKRHAVWRAAEDEPGSVLYAEGADVDAVISYITAHT
Ga0242666_120884013300022721SoilKKHGLWRVAEDDPDSDLYAESSDADTVMGYITAHARESA
Ga0247691_105774313300024222SoilDHPRWSVFWDKRYGLWRAAEDDPDSDLYAEAANADAVIQYMTAHS
Ga0224556_109522913300024295SoilRWSAYWDKKHGVWRVAEDDPDSDLYAESSDADTVIGYITAHT
Ga0207692_1071008513300025898Corn, Switchgrass And Miscanthus RhizosphereAGASRLAAFLRRHPGWSAFWDKQYGVWRAAEDDPLSAWYTETPEPAAVISYITAHT
Ga0207684_1044849313300025910Corn, Switchgrass And Miscanthus RhizosphereMAGRPRWSVFWDKAYGVWRAAEDDPDSVLYTESRDADTVIGYIATHS
Ga0207663_1147336723300025916Corn, Switchgrass And Miscanthus RhizosphereSFLHDHPHWSVFWDKRDGLWRVAEDDPDSDLYAEAANADTVIDYMIAHS
Ga0207700_1010412953300025928Corn, Switchgrass And Miscanthus RhizosphereCFLADQKYGLWRVAEDDPDSDLYAESSDADTVIGYIVAHA
Ga0207700_1087043533300025928Corn, Switchgrass And Miscanthus RhizosphereFLRCHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITACS
Ga0207700_1098578823300025928Corn, Switchgrass And Miscanthus RhizosphereLHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITA
Ga0207664_1039013033300025929Agricultural SoilLHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITACS
Ga0207667_1159807823300025949Corn RhizosphereWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC
Ga0207702_1085546833300026078Corn RhizosphereKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHA
Ga0207702_1155335313300026078Corn RhizosphereQLTRWSIFWDKRYGVWRAAEDDPDSALYTEARDLDTVLGYITTHS
Ga0209801_107395133300026326SoilLADHPQWSACWDKRFGVWRVTEDDPDSDLYAESSAVDTVISYIMAHA
Ga0257160_102796513300026489SoilLTAFLRKHPWWSAFWDKRYGLWRVAEDDPDSELYAESADTDAVLGYMTTHS
Ga0208827_112765913300027641Peatlands SoilPRWSAFWDKRYGAWRVAEDDPDSCLYAESRDLDTVIGYITAHVRATSCPA
Ga0209038_1008729413300027737Bog Forest SoilVFWDKRFGVWRVADDDPDSGLYAESSDADIVIGYIQAHA
Ga0209139_1024223423300027795Bog Forest SoilWQVSCFLADHPRWSAWWDKKHGLWHVAEDDPDSDLYAESSDADTVMGYITAHARESA
Ga0209415_1007649443300027905Peatlands SoilFLADHLGWSAYWDKKYGLWRVAEDDSDSDLYAESSDADAVISYIAAHA
Ga0209415_1064916323300027905Peatlands SoilFVSEHLCWSVFWDKQAGLWRAAEDDPDSDLYVQSPDADVVIRYMVAHS
Ga0137415_1073061313300028536Vadose Zone SoilDQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSNADTVIGYIVAHA
Ga0302228_1040066723300028808PalsaLLDHPRWSAFWDKRHGVWRVAEDDPDSDLYAKSSDADIVIGYIQAHA
Ga0302229_1018363633300028879PalsaLRDHPDWSVFWDKAHGVWRVADDDPDSGLYAESSDADTVIGYIRAHA
Ga0311340_1047512133300029943PalsaSVLHDDPRWSAFWDKRHGVWRVAEDDPDSDLYAESSDAGAVIGYIQAHA
Ga0311340_1138390123300029943PalsaTCFLQDHLRWSAFWDKKHGVWRVAEDDPDSDLYAESSDADTVIGYISAHS
Ga0311339_1100460423300029999PalsaHPRWSAFWDKAYGVWRVAEDDPDSSLYAESRDLDTVISYITAHS
Ga0311338_1078275623300030007PalsaVWWDKKHGLWRVAEDDPDSDLYAESSDADTVMSYITMHA
Ga0302181_1038451713300030056PalsaWSAFWDKAHGVWRVAEDDPDSDLYAESSDAATVISYIKAHA
Ga0310037_1007281313300030494Peatlands SoilWWDKKHGLWRVAEDDPDSELYAESSDAETVMGYITAHA
Ga0311372_1231623233300030520PalsaLQGHPRWSAFWDKRHGVWRVAEDDPDSSLYAESSDLDTVISYITSHS
Ga0311355_1083216323300030580PalsaDHPRWSAFWDKRHGVWRVAEDDPDSDLYAKSSDADIVIGYIQAHA
Ga0311356_1007180553300030617PalsaKRHAVWRAAEDDPDSALYTESGDLDTVIGYILAHA
Ga0302180_1058564523300031028PalsaPRWSAFWDKRHGVWRVAEDDPDSSLYAESSDLDTVISYITSHS
Ga0302307_1063168813300031233PalsaIIRFLQDHERWSVYWDKKHGVWRVAEDDPDSDLYAESSDADTVISYMTAHG
Ga0302325_1066618533300031234PalsaSAFWDKAHGVWRVAEDDPDSDLYAESSDAATVISYIKAHA
Ga0302325_1224660513300031234PalsaGHPRWSAFWDKAYGVWRVAEDDPDSSLYAESRDVDTVISYITSHS
Ga0302325_1291389513300031234PalsaFLQDHLPWSACWDKRRGVWRVAEDDPDSDLYAESRDAETVIRYIAANS
Ga0302324_10062104513300031236PalsaRWSAFWDKAYGVWRVAEDDPDSDLYAESSDAGTVISYIQAHA
Ga0302324_10108629813300031236PalsaFLQHHLNWSACWDKRHGVWRVAEDDPDSDLYAESQDADTVITYIAAHS
Ga0302326_1032607413300031525PalsaLSWSMFWDKRYGVWRAAEDDPDSDLYAENSDIDVVIQYMVAHSSIQGPP
Ga0318573_1041232223300031564SoilLQQHPGWSAFWDKRYGVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0310686_11231726013300031708SoilDKAHEVWRVADDDPDSGLYAESSDADTVISYIQAHG
Ga0307469_1037127323300031720Hardwood Forest SoilKKYGLWRVAEDDPDSDLYAESSDADTVISYITAHT
Ga0318548_1051740413300031793SoilKRYAVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0318551_1057348523300031896SoilLQQHPWWSAFWDKRYAVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0310916_1104913613300031942SoilSAFWDKRYAVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0318504_1054154813300032063SoilHPGWSAFWDKRYGVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0318553_1067844713300032068SoilWSAFWDKRYGVWRVAEDDPDSALYAESADAAEVLSYMTAHS
Ga0348332_1284495623300032515Plant LitterWQVSCFLADHPRWSAWWDKKHGLWRVAEDDPDSDLYAESSDADTVMGYITAHARESA
Ga0335085_1026152133300032770SoilVLAGQPRWSAFWDKRDGVWRVAEDDPDSDLYAASSDASTVIAYIQAHS
Ga0335085_1147716823300032770SoilVFWDKKYGVWRAAEDDPGSALYAESREADTVIGYITAHS
Ga0335085_1158107913300032770SoilHPRWSVFWDKRYRLWRAAEDDPDSALYTESPDLDTVIGYITAHT
Ga0335079_1015663533300032783SoilVFWDKRYGVWRAAEDDPGSAAYAESPDLDAVIGYIISRA
Ga0335079_1183098613300032783SoilDKRHGVWRVTEDDPDSALYAESADATEVLGYMTAHS
Ga0335078_1050129043300032805SoilKRFGVWRVAEDDPDSDLYAESSDADTVIAYITANS
Ga0335078_1198954423300032805SoilLQDHQRWSVFWDKRHGLWRAAEDDPDSALYTASRDVDTVIGYIISHP
Ga0335081_1212500313300032892SoilARTGRSKRDGPWRVAEDNPDSDLYAEAANADTVIDYMIAHS
Ga0335069_1117833823300032893SoilRDQPRWSVYWNKKPGLWRVAEDDPGSDLYAEIRDADAVIGYIMAHP
Ga0335074_1034617613300032895SoilSWSAYWDKRHAVWRVAEDDPGSDLYAESSDAATVIAYIQAHA
Ga0335074_1102598213300032895SoilHPQWSACWDKKRGLWHVAEDDPDSDLCAESPDADTVIGYIAAHA
Ga0335077_1028225243300033158SoilVFWDKHLGVWRAAEDDPDSGLYTECSDADTVIGYIRAHG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.