Basic Information | |
---|---|
Family ID | F059687 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 44 residues |
Representative Sequence | RWSAYWDKKHGVWRVAEDDPDSDLYAESSDADTVIGYITAHT |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 8.27 % |
% of genes near scaffold ends (potentially truncated) | 83.46 % |
% of genes from short scaffolds (< 2000 bps) | 92.48 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.045 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.556 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.105 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.71% β-sheet: 22.86% Coil/Unstructured: 61.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF03869 | Arc | 4.51 |
PF05016 | ParE_toxin | 4.51 |
PF13376 | OmdA | 2.26 |
PF04149 | DUF397 | 1.50 |
PF01844 | HNH | 1.50 |
PF01042 | Ribonuc_L-PSP | 1.50 |
PF01636 | APH | 1.50 |
PF00589 | Phage_integrase | 1.50 |
PF14031 | D-ser_dehydrat | 1.50 |
PF13391 | HNH_2 | 1.50 |
PF13560 | HTH_31 | 1.50 |
PF12697 | Abhydrolase_6 | 1.50 |
PF00406 | ADK | 0.75 |
PF01965 | DJ-1_PfpI | 0.75 |
PF01872 | RibD_C | 0.75 |
PF12840 | HTH_20 | 0.75 |
PF08240 | ADH_N | 0.75 |
PF07690 | MFS_1 | 0.75 |
PF02467 | Whib | 0.75 |
PF07927 | HicA_toxin | 0.75 |
PF07714 | PK_Tyr_Ser-Thr | 0.75 |
PF03109 | ABC1 | 0.75 |
PF02577 | BFN_dom | 0.75 |
PF03793 | PASTA | 0.75 |
PF13411 | MerR_1 | 0.75 |
PF11356 | T2SSC | 0.75 |
PF03372 | Exo_endo_phos | 0.75 |
PF00005 | ABC_tran | 0.75 |
PF13581 | HATPase_c_2 | 0.75 |
PF01909 | NTP_transf_2 | 0.75 |
PF04191 | PEMT | 0.75 |
PF01243 | Putative_PNPOx | 0.75 |
PF00440 | TetR_N | 0.75 |
PF00571 | CBS | 0.75 |
PF06240 | COXG | 0.75 |
PF12680 | SnoaL_2 | 0.75 |
PF08751 | TrwC | 0.75 |
PF13091 | PLDc_2 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.01 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.50 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.75 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.75 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.75 |
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.75 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.75 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.75 |
COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.14 % |
Unclassified | root | N/A | 42.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004091|Ga0062387_100220592 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300005176|Ga0066679_10085811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1889 | Open in IMG/M |
3300005329|Ga0070683_101341002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 688 | Open in IMG/M |
3300005335|Ga0070666_11060630 | Not Available | 602 | Open in IMG/M |
3300005434|Ga0070709_10223880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1343 | Open in IMG/M |
3300005435|Ga0070714_100165920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2001 | Open in IMG/M |
3300005435|Ga0070714_100800885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 912 | Open in IMG/M |
3300005435|Ga0070714_102188634 | Not Available | 538 | Open in IMG/M |
3300005467|Ga0070706_101337128 | Not Available | 657 | Open in IMG/M |
3300005467|Ga0070706_101993055 | Not Available | 526 | Open in IMG/M |
3300005531|Ga0070738_10159285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1089 | Open in IMG/M |
3300005534|Ga0070735_10589747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 660 | Open in IMG/M |
3300005554|Ga0066661_10733734 | Not Available | 579 | Open in IMG/M |
3300005591|Ga0070761_10985856 | Not Available | 534 | Open in IMG/M |
3300005614|Ga0068856_101086304 | Not Available | 818 | Open in IMG/M |
3300005841|Ga0068863_102552972 | Not Available | 520 | Open in IMG/M |
3300005921|Ga0070766_11224246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 520 | Open in IMG/M |
3300006028|Ga0070717_12044207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
3300006954|Ga0079219_10034813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2030 | Open in IMG/M |
3300009137|Ga0066709_100477198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinophytocola | 1751 | Open in IMG/M |
3300009162|Ga0075423_12708303 | Not Available | 543 | Open in IMG/M |
3300009174|Ga0105241_10163318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1833 | Open in IMG/M |
3300009520|Ga0116214_1059709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1386 | Open in IMG/M |
3300009665|Ga0116135_1193993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
3300009672|Ga0116215_1117297 | Not Available | 1190 | Open in IMG/M |
3300009698|Ga0116216_10201297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WM6378 | 1222 | Open in IMG/M |
3300009839|Ga0116223_10498288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 709 | Open in IMG/M |
3300010048|Ga0126373_12713014 | Not Available | 553 | Open in IMG/M |
3300010335|Ga0134063_10302822 | Not Available | 769 | Open in IMG/M |
3300010343|Ga0074044_10543781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti | 758 | Open in IMG/M |
3300010396|Ga0134126_11706943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 691 | Open in IMG/M |
3300010876|Ga0126361_10178895 | Not Available | 518 | Open in IMG/M |
3300010876|Ga0126361_10548532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1239 | Open in IMG/M |
3300010876|Ga0126361_10676862 | Not Available | 596 | Open in IMG/M |
3300010876|Ga0126361_11101695 | Not Available | 1417 | Open in IMG/M |
3300011271|Ga0137393_10240991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1534 | Open in IMG/M |
3300012198|Ga0137364_10639762 | Not Available | 802 | Open in IMG/M |
3300012200|Ga0137382_11154292 | Not Available | 552 | Open in IMG/M |
3300012206|Ga0137380_10035181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4621 | Open in IMG/M |
3300012208|Ga0137376_10306848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1377 | Open in IMG/M |
3300012209|Ga0137379_10194285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1942 | Open in IMG/M |
3300012209|Ga0137379_10755508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
3300012361|Ga0137360_11865134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 507 | Open in IMG/M |
3300012395|Ga0134044_1015828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300012507|Ga0157342_1018360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 792 | Open in IMG/M |
3300012510|Ga0157316_1020503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 719 | Open in IMG/M |
3300012532|Ga0137373_11010011 | Not Available | 602 | Open in IMG/M |
3300013308|Ga0157375_11803197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 725 | Open in IMG/M |
3300014657|Ga0181522_10710288 | Not Available | 614 | Open in IMG/M |
3300015373|Ga0132257_101006595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
3300017926|Ga0187807_1058702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1195 | Open in IMG/M |
3300017942|Ga0187808_10276785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 754 | Open in IMG/M |
3300017955|Ga0187817_10947847 | Not Available | 551 | Open in IMG/M |
3300017970|Ga0187783_10188920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1515 | Open in IMG/M |
3300018046|Ga0187851_10823556 | Not Available | 522 | Open in IMG/M |
3300018085|Ga0187772_11458978 | Not Available | 509 | Open in IMG/M |
3300020579|Ga0210407_10512150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 938 | Open in IMG/M |
3300020582|Ga0210395_10538216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 878 | Open in IMG/M |
3300021403|Ga0210397_10663123 | Not Available | 800 | Open in IMG/M |
3300021404|Ga0210389_10768707 | Not Available | 753 | Open in IMG/M |
3300021405|Ga0210387_10690696 | Not Available | 905 | Open in IMG/M |
3300021407|Ga0210383_10077944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2773 | Open in IMG/M |
3300021407|Ga0210383_10309330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1360 | Open in IMG/M |
3300021407|Ga0210383_10403748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1179 | Open in IMG/M |
3300021407|Ga0210383_10444436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1119 | Open in IMG/M |
3300021407|Ga0210383_11507867 | Not Available | 556 | Open in IMG/M |
3300021433|Ga0210391_10996405 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300021474|Ga0210390_10153454 | Not Available | 1940 | Open in IMG/M |
3300021474|Ga0210390_11450418 | Not Available | 545 | Open in IMG/M |
3300021476|Ga0187846_10344366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 615 | Open in IMG/M |
3300021477|Ga0210398_10547521 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300021477|Ga0210398_11049717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium | 649 | Open in IMG/M |
3300022721|Ga0242666_1208840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Myxococcales incertae sedis → Enhygromyxa → Enhygromyxa salina | 501 | Open in IMG/M |
3300024222|Ga0247691_1057743 | Not Available | 586 | Open in IMG/M |
3300024295|Ga0224556_1095229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
3300025898|Ga0207692_10710085 | Not Available | 653 | Open in IMG/M |
3300025910|Ga0207684_10448493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1108 | Open in IMG/M |
3300025916|Ga0207663_11473367 | Not Available | 548 | Open in IMG/M |
3300025928|Ga0207700_10104129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinisilvae | 2270 | Open in IMG/M |
3300025928|Ga0207700_10870435 | Not Available | 806 | Open in IMG/M |
3300025928|Ga0207700_10985788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
3300025929|Ga0207664_10390130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1237 | Open in IMG/M |
3300025949|Ga0207667_11598078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 621 | Open in IMG/M |
3300026078|Ga0207702_10855468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 900 | Open in IMG/M |
3300026078|Ga0207702_11553353 | Not Available | 655 | Open in IMG/M |
3300026326|Ga0209801_1073951 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300026489|Ga0257160_1027965 | Not Available | 921 | Open in IMG/M |
3300027641|Ga0208827_1127659 | Not Available | 726 | Open in IMG/M |
3300027737|Ga0209038_10087294 | Not Available | 939 | Open in IMG/M |
3300027795|Ga0209139_10242234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Myxococcales incertae sedis → Enhygromyxa → Enhygromyxa salina | 637 | Open in IMG/M |
3300027905|Ga0209415_10076494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3907 | Open in IMG/M |
3300027905|Ga0209415_10649163 | Not Available | 769 | Open in IMG/M |
3300028536|Ga0137415_10730613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 802 | Open in IMG/M |
3300028808|Ga0302228_10400667 | Not Available | 609 | Open in IMG/M |
3300028879|Ga0302229_10183636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
3300029943|Ga0311340_10475121 | Not Available | 1125 | Open in IMG/M |
3300029943|Ga0311340_11383901 | Not Available | 556 | Open in IMG/M |
3300029999|Ga0311339_11004604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
3300030007|Ga0311338_10782756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
3300030056|Ga0302181_10384517 | Not Available | 608 | Open in IMG/M |
3300030494|Ga0310037_10072813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1614 | Open in IMG/M |
3300030520|Ga0311372_12316232 | Not Available | 612 | Open in IMG/M |
3300030580|Ga0311355_10832163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alboflavus | 844 | Open in IMG/M |
3300030617|Ga0311356_10071805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3663 | Open in IMG/M |
3300031028|Ga0302180_10585645 | Not Available | 538 | Open in IMG/M |
3300031233|Ga0302307_10631688 | Not Available | 539 | Open in IMG/M |
3300031234|Ga0302325_10666185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1510 | Open in IMG/M |
3300031234|Ga0302325_12246605 | Not Available | 662 | Open in IMG/M |
3300031234|Ga0302325_12913895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola → Marmoricola mangrovicus | 556 | Open in IMG/M |
3300031236|Ga0302324_100621045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1545 | Open in IMG/M |
3300031236|Ga0302324_101086298 | Not Available | 1078 | Open in IMG/M |
3300031525|Ga0302326_10326074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2434 | Open in IMG/M |
3300031564|Ga0318573_10412322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
3300031708|Ga0310686_112317260 | Not Available | 754 | Open in IMG/M |
3300031720|Ga0307469_10371273 | Not Available | 1210 | Open in IMG/M |
3300031793|Ga0318548_10517404 | Not Available | 583 | Open in IMG/M |
3300031896|Ga0318551_10573485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
3300031942|Ga0310916_11049136 | Not Available | 679 | Open in IMG/M |
3300032063|Ga0318504_10541548 | Not Available | 558 | Open in IMG/M |
3300032068|Ga0318553_10678447 | Not Available | 539 | Open in IMG/M |
3300032515|Ga0348332_12844956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 856 | Open in IMG/M |
3300032770|Ga0335085_10261521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2073 | Open in IMG/M |
3300032770|Ga0335085_11477168 | Not Available | 709 | Open in IMG/M |
3300032770|Ga0335085_11581079 | Not Available | 680 | Open in IMG/M |
3300032783|Ga0335079_10156635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2552 | Open in IMG/M |
3300032783|Ga0335079_11830986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300032805|Ga0335078_10501290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1560 | Open in IMG/M |
3300032805|Ga0335078_11989544 | Not Available | 623 | Open in IMG/M |
3300032892|Ga0335081_12125003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
3300032893|Ga0335069_11178338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
3300032895|Ga0335074_10346176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1657 | Open in IMG/M |
3300032895|Ga0335074_11025982 | Not Available | 723 | Open in IMG/M |
3300033158|Ga0335077_10282252 | Not Available | 1825 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.05% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.53% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.52% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.02% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.01% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.01% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.26% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.50% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.75% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062387_1002205923 | 3300004091 | Bog Forest Soil | WSAFWDKKRGVWQVAEDDPDSDFHAESPDASTVIAYMKSHS* |
Ga0066679_100858111 | 3300005176 | Soil | KLAPMPRWSVCWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIMAHA* |
Ga0070683_1013410021 | 3300005329 | Corn Rhizosphere | FLADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC* |
Ga0070666_110606302 | 3300005335 | Switchgrass Rhizosphere | PRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC* |
Ga0070709_102238802 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VVIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIVAHA* |
Ga0070714_1001659203 | 3300005435 | Agricultural Soil | LHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITACS* |
Ga0070714_1008008851 | 3300005435 | Agricultural Soil | SVFWDKRDGLWRVAEDDPDSDLYAEAANADTVIDYMVAHS* |
Ga0070714_1021886342 | 3300005435 | Agricultural Soil | LADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC* |
Ga0070706_1013371281 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSPGGDKKYGLWRVAEDDPDSDLYAESSDADTVISYFMAHT* |
Ga0070706_1019930552 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGRPRWSVFWDKAYGVWRAAEDDPDSVLYTESRDADTVIGYIATHS* |
Ga0070738_101592851 | 3300005531 | Surface Soil | PQWSAFWDKRNGLWRVADDDPYSDLYAASADADKVIAYMAAHS* |
Ga0070735_105897472 | 3300005534 | Surface Soil | LADHPRWSAWWDKKHGLWRVAEDDQDSDLYAESSDADTVMDYITAHA* |
Ga0066661_107337342 | 3300005554 | Soil | RASTRPAHLGDKLAPMPRWSVCWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIMAHA* |
Ga0070761_109858561 | 3300005591 | Soil | WDKASGVWRVTEDDPDSALHAESSDAATVVSYIQSHA* |
Ga0068856_1010863041 | 3300005614 | Corn Rhizosphere | FLADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIGYIVAHA* |
Ga0068863_1025529721 | 3300005841 | Switchgrass Rhizosphere | YWDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHA* |
Ga0070766_112242461 | 3300005921 | Soil | SCFLADHPRWSAWWDKKHGLWRVAEDDPDSDLYAESSDADTVMGYITAHA* |
Ga0070717_120442072 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | WSAFWDKRDGVWRVAEDDPDSDLYAECRDADTVIGYITAHL* |
Ga0079219_100348137 | 3300006954 | Agricultural Soil | FLTDQPRWSIYWDKKYGLWRVAEDDPDSDLYAESNDADTVIGYVVTHA* |
Ga0066709_1004771984 | 3300009137 | Grasslands Soil | MAGRPRWSVFWDKAYGVWRASEDDPDSALYAESRDPDTVISYITAHA* |
Ga0075423_127083033 | 3300009162 | Populus Rhizosphere | EHLRWSIYWDKKYGLWRVAEDDSDSDLYAESSDADIVISYVVAHA* |
Ga0105241_101633182 | 3300009174 | Corn Rhizosphere | YWDKKYGLWRVAEDDPDSDLYAESSNADTVIGYIVAHA* |
Ga0116214_10597095 | 3300009520 | Peatlands Soil | LADQPRWSVYWDKKHGLWHRAEDDPDSDLYAESSDADAVIGYIAAHA* |
Ga0116135_11939931 | 3300009665 | Peatland | DHRSWSAWWDKHYGLWRVAEDDTDSDLYAESCDADVVIRYMQAHS* |
Ga0116215_11172974 | 3300009672 | Peatlands Soil | GWSASWDKKHGVWRVADDDPDSDLYAESADAATVIGYITAHR* |
Ga0116216_102012971 | 3300009698 | Peatlands Soil | RWSVYWDKRFGVWRVSEDDPDSELYAESSDADTVLAYITAHS* |
Ga0116223_104982883 | 3300009839 | Peatlands Soil | SCFLADQPRWSVYWDNKHGLWRVAEDDPDSDLYAESSDADAVIGYIAAHA* |
Ga0126373_127130142 | 3300010048 | Tropical Forest Soil | AFWDKRYGVWRVAEDDPDSALYAESADAAEVLRYMTVHS* |
Ga0134063_103028222 | 3300010335 | Grasslands Soil | VSCFLAEHPRWSAWWDKKYGLWRVAEDDPDSGLYLESSDADAVIGYIMAHA* |
Ga0074044_105437812 | 3300010343 | Bog Forest Soil | HQRWSVCWDKRHGVWRAAEDDPESDLYAESLDADTVISYIAAHS* |
Ga0134126_117069433 | 3300010396 | Terrestrial Soil | ADQLRWSVYWDKKYGLWRVAEDDPDSDLYAESSDADTVISYIVAHA* |
Ga0126361_101788952 | 3300010876 | Boreal Forest Soil | CFLADHPRWSAWWDKRYGLWRVAEDDPDSDLYAESSDADTVMGYITAHA* |
Ga0126361_105485323 | 3300010876 | Boreal Forest Soil | DHPGWSVFWDKAHGVWRVADDDPDSGLYAESSDADAVISYIQAHC* |
Ga0126361_106768622 | 3300010876 | Boreal Forest Soil | VFWDKAHGVWRVADDDPDSGLYAESSDAGTVIGYIQAHA* |
Ga0126361_111016952 | 3300010876 | Boreal Forest Soil | VFWDKRSSVWRVADDDPDSGLYAESSDADTVISYIQAHG* |
Ga0137393_102409911 | 3300011271 | Vadose Zone Soil | SLPEPPGLSAFLSKRHGVWLVTEDDPDSALYAESADATEVLGYMTAHS* |
Ga0137364_106397621 | 3300012198 | Vadose Zone Soil | MPRWSVCWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIMAHA* |
Ga0137382_111542921 | 3300012200 | Vadose Zone Soil | MQDRPRWSVFWDKRYGVWRAAEDDPDSALYTESCDADTVIGYITSHA* |
Ga0137380_100351815 | 3300012206 | Vadose Zone Soil | MSGSRIWSGAAYWDKKYGLWRVAEDDPDSDLYAESSDADTVISYISAHS* |
Ga0137376_103068482 | 3300012208 | Vadose Zone Soil | MQDRPRWSVFWDKRYGVWRAAEDDPDSALYTESCDADTVIGYITTHT* |
Ga0137379_101942854 | 3300012209 | Vadose Zone Soil | LAEHLRWSVWWDKKYGLWRVAEDDPDSDLYAEGSDADTVISYIMAHA* |
Ga0137379_107555081 | 3300012209 | Vadose Zone Soil | PRWSIYWDKNYGLWRVAEDDPDSDLYAESSDADTVIGYITEHA* |
Ga0137360_118651342 | 3300012361 | Vadose Zone Soil | SFLQEHLPWSAFWDKGRGVWRVAEDDPDSTLYTESRDVDTVIGYITEKS* |
Ga0134044_10158282 | 3300012395 | Grasslands Soil | DKRYGVWRVAEDDPDSDLYAESSQATIVITYIQAHSRDW* |
Ga0157342_10183603 | 3300012507 | Arabidopsis Rhizosphere | RWSIYWDKKYGLWRVAEDDPDSELYAESSDADTVIGYIVAHA* |
Ga0157316_10205033 | 3300012510 | Arabidopsis Rhizosphere | LAYQPRWSIYWDKKYGLWRAAEDDPDSDLYAESSDADTVIGYIVAHA* |
Ga0137373_110100112 | 3300012532 | Vadose Zone Soil | LAEHLRWSVWWDKKYGLWRVAEDDPDSDLYAEGSDADTVIRYIMAHA* |
Ga0157375_118031971 | 3300013308 | Miscanthus Rhizosphere | LADQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSDADTVIGYIVAHA* |
Ga0181522_107102882 | 3300014657 | Bog | AGHLGWSAFWDKGSGVWRVAEDDPDSGLHAESSDAATVISYIQAHA* |
Ga0132257_1010065951 | 3300015373 | Arabidopsis Rhizosphere | DQLRWSVYWDKKYGLRRVAEDDPDSDLYAESSDADTVIGYIVAHA* |
Ga0187807_10587022 | 3300017926 | Freshwater Sediment | LRWSAYWDKKYGLWRVAEDDPDSDLYAESSDADAVIGYIVAHA |
Ga0187808_102767852 | 3300017942 | Freshwater Sediment | WWSAFWDKEYGVWRVAEDDPDSALYAESADAAEVLSYMTAHT |
Ga0187817_109478471 | 3300017955 | Freshwater Sediment | SAFRDKRHGVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0187783_101889202 | 3300017970 | Tropical Peatland | VFLSEYSCWSVFWDKKYAVWRAAEDDPCSVLYAEAADVDAVISFITAHT |
Ga0187851_108235561 | 3300018046 | Peatland | WSAWWDKHYGLWRVAEDDTDSDLYAESCDADVVIRYMRAHS |
Ga0187772_114589781 | 3300018085 | Tropical Peatland | VAQLTSFLQQHPWWSAFWDKRYAVWRVAEDDPDSALYAESADAAEILS |
Ga0210407_105121502 | 3300020579 | Soil | HDHPRWSVFWDKRYGLWRAAEDDPDSDLYAEAANADAVIQYMTAHS |
Ga0210395_105382161 | 3300020582 | Soil | FLQQHPWWSAFWDKKYAVWRVAEDDPDSALYAESADAAEVVRYMAAHS |
Ga0210397_106631231 | 3300021403 | Soil | SIFWDKRYGLWRAAEDDPDSDLYAEAGNADTVIQYMTAHS |
Ga0210389_107687071 | 3300021404 | Soil | ADHLRWSAYWDKKYGLWRVAEDDPDSDLYAESSNADAVISYIVAHG |
Ga0210387_106906962 | 3300021405 | Soil | GHWDKKYGLWRVAEDNPDSDLYAESSDADTVTGYITAHS |
Ga0210383_100779445 | 3300021407 | Soil | RPYHQLPRDHSRWSVFWDKRYGLWRAAEDDPDSDLYAEAGNADTVIQYMAAHS |
Ga0210383_103093302 | 3300021407 | Soil | VVHLVGQEHGLWRVAEDDPDSDLYAESSDADAVMGYITAHA |
Ga0210383_104037482 | 3300021407 | Soil | SAYWDKKYGLWRVAEDDPDSDLHAESSDADTVISYIAAHA |
Ga0210383_104444362 | 3300021407 | Soil | TFLEQHPWWSAFWDKQYSVWRVAEDDPDSNLYAESADATEVLSYMAAHP |
Ga0210383_115078672 | 3300021407 | Soil | WDQRYGVWRVAEDDPDSGLYAESSDADAVISYIQAHA |
Ga0210391_109964052 | 3300021433 | Soil | GRLIAFLQHHPRWSVFYDKRHRLWRAAEDDPDSDLYTEASDVDTVIGYITAHR |
Ga0210390_101534545 | 3300021474 | Soil | RWSVFWDKRYGLWRAAEDDPDSDLYAEAGNADTVIQYMTAHS |
Ga0210390_114504182 | 3300021474 | Soil | WDKTHAVWRAAEDDPDSGLYTESSDADTVISYIQAHG |
Ga0187846_103443661 | 3300021476 | Biofilm | TSFLQQHPWWSAFWDKEHGVWRVAEDDPDSALYAESADAAEVLRYMAAHS |
Ga0210398_105475212 | 3300021477 | Soil | LIAFLQHHPRWSVFYDKRHRLWRAAEDDPDSDLYTEASDVDTVIGYITAHR |
Ga0210398_110497172 | 3300021477 | Soil | WDKRHAVWRAAEDEPGSVLYAEGADVDAVISYITAHT |
Ga0242666_12088401 | 3300022721 | Soil | KKHGLWRVAEDDPDSDLYAESSDADTVMGYITAHARESA |
Ga0247691_10577431 | 3300024222 | Soil | DHPRWSVFWDKRYGLWRAAEDDPDSDLYAEAANADAVIQYMTAHS |
Ga0224556_10952291 | 3300024295 | Soil | RWSAYWDKKHGVWRVAEDDPDSDLYAESSDADTVIGYITAHT |
Ga0207692_107100851 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGASRLAAFLRRHPGWSAFWDKQYGVWRAAEDDPLSAWYTETPEPAAVISYITAHT |
Ga0207684_104484931 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGRPRWSVFWDKAYGVWRAAEDDPDSVLYTESRDADTVIGYIATHS |
Ga0207663_114733672 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SFLHDHPHWSVFWDKRDGLWRVAEDDPDSDLYAEAANADTVIDYMIAHS |
Ga0207700_101041295 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | CFLADQKYGLWRVAEDDPDSDLYAESSDADTVIGYIVAHA |
Ga0207700_108704353 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FLRCHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITACS |
Ga0207700_109857882 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITA |
Ga0207664_103901303 | 3300025929 | Agricultural Soil | LHPGWSAFWDKAYGVWRAAEDDPCSDLYTETPDPTAVIRYITACS |
Ga0207667_115980782 | 3300025949 | Corn Rhizosphere | WDKKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHC |
Ga0207702_108554683 | 3300026078 | Corn Rhizosphere | KKYGLWRVAEDDPDSDLYAESSDADTVIRYIMAHA |
Ga0207702_115533531 | 3300026078 | Corn Rhizosphere | QLTRWSIFWDKRYGVWRAAEDDPDSALYTEARDLDTVLGYITTHS |
Ga0209801_10739513 | 3300026326 | Soil | LADHPQWSACWDKRFGVWRVTEDDPDSDLYAESSAVDTVISYIMAHA |
Ga0257160_10279651 | 3300026489 | Soil | LTAFLRKHPWWSAFWDKRYGLWRVAEDDPDSELYAESADTDAVLGYMTTHS |
Ga0208827_11276591 | 3300027641 | Peatlands Soil | PRWSAFWDKRYGAWRVAEDDPDSCLYAESRDLDTVIGYITAHVRATSCPA |
Ga0209038_100872941 | 3300027737 | Bog Forest Soil | VFWDKRFGVWRVADDDPDSGLYAESSDADIVIGYIQAHA |
Ga0209139_102422342 | 3300027795 | Bog Forest Soil | WQVSCFLADHPRWSAWWDKKHGLWHVAEDDPDSDLYAESSDADTVMGYITAHARESA |
Ga0209415_100764944 | 3300027905 | Peatlands Soil | FLADHLGWSAYWDKKYGLWRVAEDDSDSDLYAESSDADAVISYIAAHA |
Ga0209415_106491632 | 3300027905 | Peatlands Soil | FVSEHLCWSVFWDKQAGLWRAAEDDPDSDLYVQSPDADVVIRYMVAHS |
Ga0137415_107306131 | 3300028536 | Vadose Zone Soil | DQPRWSIYWDKKYGLWRVAEDDPDSDLYAESSNADTVIGYIVAHA |
Ga0302228_104006672 | 3300028808 | Palsa | LLDHPRWSAFWDKRHGVWRVAEDDPDSDLYAKSSDADIVIGYIQAHA |
Ga0302229_101836363 | 3300028879 | Palsa | LRDHPDWSVFWDKAHGVWRVADDDPDSGLYAESSDADTVIGYIRAHA |
Ga0311340_104751213 | 3300029943 | Palsa | SVLHDDPRWSAFWDKRHGVWRVAEDDPDSDLYAESSDAGAVIGYIQAHA |
Ga0311340_113839012 | 3300029943 | Palsa | TCFLQDHLRWSAFWDKKHGVWRVAEDDPDSDLYAESSDADTVIGYISAHS |
Ga0311339_110046042 | 3300029999 | Palsa | HPRWSAFWDKAYGVWRVAEDDPDSSLYAESRDLDTVISYITAHS |
Ga0311338_107827562 | 3300030007 | Palsa | VWWDKKHGLWRVAEDDPDSDLYAESSDADTVMSYITMHA |
Ga0302181_103845171 | 3300030056 | Palsa | WSAFWDKAHGVWRVAEDDPDSDLYAESSDAATVISYIKAHA |
Ga0310037_100728131 | 3300030494 | Peatlands Soil | WWDKKHGLWRVAEDDPDSELYAESSDAETVMGYITAHA |
Ga0311372_123162323 | 3300030520 | Palsa | LQGHPRWSAFWDKRHGVWRVAEDDPDSSLYAESSDLDTVISYITSHS |
Ga0311355_108321632 | 3300030580 | Palsa | DHPRWSAFWDKRHGVWRVAEDDPDSDLYAKSSDADIVIGYIQAHA |
Ga0311356_100718055 | 3300030617 | Palsa | KRHAVWRAAEDDPDSALYTESGDLDTVIGYILAHA |
Ga0302180_105856452 | 3300031028 | Palsa | PRWSAFWDKRHGVWRVAEDDPDSSLYAESSDLDTVISYITSHS |
Ga0302307_106316881 | 3300031233 | Palsa | IIRFLQDHERWSVYWDKKHGVWRVAEDDPDSDLYAESSDADTVISYMTAHG |
Ga0302325_106661853 | 3300031234 | Palsa | SAFWDKAHGVWRVAEDDPDSDLYAESSDAATVISYIKAHA |
Ga0302325_122466051 | 3300031234 | Palsa | GHPRWSAFWDKAYGVWRVAEDDPDSSLYAESRDVDTVISYITSHS |
Ga0302325_129138951 | 3300031234 | Palsa | FLQDHLPWSACWDKRRGVWRVAEDDPDSDLYAESRDAETVIRYIAANS |
Ga0302324_1006210451 | 3300031236 | Palsa | RWSAFWDKAYGVWRVAEDDPDSDLYAESSDAGTVISYIQAHA |
Ga0302324_1010862981 | 3300031236 | Palsa | FLQHHLNWSACWDKRHGVWRVAEDDPDSDLYAESQDADTVITYIAAHS |
Ga0302326_103260741 | 3300031525 | Palsa | LSWSMFWDKRYGVWRAAEDDPDSDLYAENSDIDVVIQYMVAHSSIQGPP |
Ga0318573_104123222 | 3300031564 | Soil | LQQHPGWSAFWDKRYGVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0310686_1123172601 | 3300031708 | Soil | DKAHEVWRVADDDPDSGLYAESSDADTVISYIQAHG |
Ga0307469_103712732 | 3300031720 | Hardwood Forest Soil | KKYGLWRVAEDDPDSDLYAESSDADTVISYITAHT |
Ga0318548_105174041 | 3300031793 | Soil | KRYAVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0318551_105734852 | 3300031896 | Soil | LQQHPWWSAFWDKRYAVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0310916_110491361 | 3300031942 | Soil | SAFWDKRYAVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0318504_105415481 | 3300032063 | Soil | HPGWSAFWDKRYGVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0318553_106784471 | 3300032068 | Soil | WSAFWDKRYGVWRVAEDDPDSALYAESADAAEVLSYMTAHS |
Ga0348332_128449562 | 3300032515 | Plant Litter | WQVSCFLADHPRWSAWWDKKHGLWRVAEDDPDSDLYAESSDADTVMGYITAHARESA |
Ga0335085_102615213 | 3300032770 | Soil | VLAGQPRWSAFWDKRDGVWRVAEDDPDSDLYAASSDASTVIAYIQAHS |
Ga0335085_114771682 | 3300032770 | Soil | VFWDKKYGVWRAAEDDPGSALYAESREADTVIGYITAHS |
Ga0335085_115810791 | 3300032770 | Soil | HPRWSVFWDKRYRLWRAAEDDPDSALYTESPDLDTVIGYITAHT |
Ga0335079_101566353 | 3300032783 | Soil | VFWDKRYGVWRAAEDDPGSAAYAESPDLDAVIGYIISRA |
Ga0335079_118309861 | 3300032783 | Soil | DKRHGVWRVTEDDPDSALYAESADATEVLGYMTAHS |
Ga0335078_105012904 | 3300032805 | Soil | KRFGVWRVAEDDPDSDLYAESSDADTVIAYITANS |
Ga0335078_119895442 | 3300032805 | Soil | LQDHQRWSVFWDKRHGLWRAAEDDPDSALYTASRDVDTVIGYIISHP |
Ga0335081_121250031 | 3300032892 | Soil | ARTGRSKRDGPWRVAEDNPDSDLYAEAANADTVIDYMIAHS |
Ga0335069_111783382 | 3300032893 | Soil | RDQPRWSVYWNKKPGLWRVAEDDPGSDLYAEIRDADAVIGYIMAHP |
Ga0335074_103461761 | 3300032895 | Soil | SWSAYWDKRHAVWRVAEDDPGSDLYAESSDAATVIAYIQAHA |
Ga0335074_110259821 | 3300032895 | Soil | HPQWSACWDKKRGLWHVAEDDPDSDLCAESPDADTVIGYIAAHA |
Ga0335077_102822524 | 3300033158 | Soil | VFWDKHLGVWRAAEDDPDSGLYTECSDADTVIGYIRAHG |
⦗Top⦘ |