 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F059676 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 133 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPSVKGIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 32.33 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (94.737 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.045 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.180 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.80% β-sheet: 0.00% Coil/Unstructured: 94.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF13368 | Toprim_C_rpt | 42.86 |
| PF13604 | AAA_30 | 1.50 |
| PF13484 | Fer4_16 | 0.75 |
| PF01844 | HNH | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 94.74 % |
| All Organisms | root | All Organisms | 5.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 17.29% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 16.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 7.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.26% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.50% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.75% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.75% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.75% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.75% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.75% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.75% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002305 | Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007200 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020492 | Freshwater microbial communities from Lake Mendota, WI - 01JUN2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020503 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020520 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020523 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020540 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020689 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020732 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnion | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TBL_comb48_EPIDRAFT_10150756 | 3300000439 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK* |
| JGI24218J26658_10141722 | 3300002092 | Lentic | MPAVKTIGYSNYSSRPMEKTNSMNKYVADHGNKAHYNKIGK* |
| B570J29619_10007471 | 3300002305 | Freshwater | YIMPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVGK* |
| B570J29032_1094366274 | 3300002408 | Freshwater | MPSVKGIGYTNFSSRPMEKTTSMNKLVADHGNKTNYNKVGK* |
| B570J40625_1000475762 | 3300002835 | Freshwater | MPSVKGIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK* |
| Ga0007787_105558582 | 3300004240 | Freshwater Lake | MPSVKGIGYTPYTSRPMEKTTSMSKMVADHGNKSNYNKVGK* |
| Ga0007804_10653242 | 3300004770 | Freshwater | MPVKSIGYSNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK* |
| Ga0007854_101532432 | 3300004806 | Freshwater | MPSVKTIGWTNYSSRPMEKTTSMNKYTSDHGNKAHYNKVGK* |
| Ga0068882_16258152 | 3300005421 | Freshwater Lake | MPVKSIAHTNYNSRPMEKLTSMNKQMSDHGNKTHYMKVGK* |
| Ga0068876_102142882 | 3300005527 | Freshwater Lake | MPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVGK* |
| Ga0068872_102171912 | 3300005528 | Freshwater Lake | MPVKSIAHTNYNSRPMEKSTSMNKQMSDHGNKTHYMKVGK* |
| Ga0078894_107576921 | 3300005662 | Freshwater Lake | MPLIKSIGKTNYTIRPIEKTTSMNKNVADNNNKAHYNKVAK* |
| Ga0007870_10954411 | 3300006109 | Freshwater | MPVKSIGYSNYSSRPMEKTTSMNKNVADHGNKAHYNKVG |
| Ga0007871_10879242 | 3300006110 | Freshwater | MPVKSIGYSNYSSRPMEKTTSMNKNIADHGNKAHYNKVGK* |
| Ga0007805_10706192 | 3300006127 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKTHYNKVGK* |
| Ga0102978_12776152 | 3300007177 | Freshwater Lake | MPVKSIAHSNYAYRPMEKTTSMNKQMSDNGNKTHYMKVGK* |
| Ga0102978_13189913 | 3300007177 | Freshwater Lake | MPVKSIAHTNYNSRPMEKLTSMNKQMSDHGNKTHYMKVG |
| Ga0103273_10977651 | 3300007200 | Freshwater Lake | MPSVKSIGYTSYASRPMEKTTSMNKQVSDHGNKAHYM |
| Ga0102828_11024901 | 3300007559 | Estuarine | MPSVKGIGYTNHAVRPMEKTTSMNKQVADHGNKAHYNKVGK* |
| Ga0102828_11476701 | 3300007559 | Estuarine | MPSVKGIGYTNFSSRPMEKTTSMSKYVADHGNKTNYNKVGK* |
| Ga0105736_11101391 | 3300007861 | Estuary Water | MPSIKGIGHSNYSSRPMEKTTSMSKSVADHGNKTNYNKVGK* |
| Ga0114341_100845193 | 3300008108 | Freshwater, Plankton | MPSVKGIGHTNFHSRPMEKTTSMSKMVADHGNKSNYNKVGK* |
| Ga0114341_101464403 | 3300008108 | Freshwater, Plankton | MPIKSIGKTNYTSRPIEKTTSMNKNVADHNNKAHYNKVAK* |
| Ga0114341_102103851 | 3300008108 | Freshwater, Plankton | MPSVKGIGYTNFSSRPMEKTTSMNKYVADHGNKTNYNKVGK* |
| Ga0114341_104134142 | 3300008108 | Freshwater, Plankton | MPVKGIGHSNYTSRQMEKTTSMSKYVADHGNKTNYNKVGK* |
| Ga0114343_11761353 | 3300008110 | Freshwater, Plankton | KGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVGK* |
| Ga0114344_10098253 | 3300008111 | Freshwater, Plankton | MIYIMPSVKGIGYTNFSSRPMEKTTSMSKYVADHGNKTNYNKVGK* |
| Ga0114344_10672836 | 3300008111 | Freshwater, Plankton | MPVKGIGHSNYTSRPMEKTTSMSKPVPDHGNKTNYNKVGK* |
| Ga0114346_10455732 | 3300008113 | Freshwater, Plankton | MPSVKGIGHSNYSFRPMEKTTSMSKSVADHGNKTNYNKVGK* |
| Ga0114346_10805353 | 3300008113 | Freshwater, Plankton | MPSVKGIGHTNFHSRPMEKTTSMSKMVADHGNKSNDNKVEK* |
| Ga0114346_11703531 | 3300008113 | Freshwater, Plankton | MPSVKGIGNTNFSSRPMEKTNSMNKQLADNGNKTHYNKVGK* |
| Ga0114346_12395722 | 3300008113 | Freshwater, Plankton | MPSVKGIGYTNFSSRPMEKTTSMNKYVADHGNKTNYNKV |
| Ga0114346_12480352 | 3300008113 | Freshwater, Plankton | MPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKNNYNKVGK* |
| Ga0114347_10072325 | 3300008114 | Freshwater, Plankton | MPVKSIAHTNYNSRPMEKLTSMNKQMSDHGNKTHYMKVGVRGS* |
| Ga0114350_10575462 | 3300008116 | Freshwater, Plankton | MPSVKGIGNTNYSSRPMEKTTNMNKQLADNGNKTHYNKVGK* |
| Ga0114351_10270517 | 3300008117 | Freshwater, Plankton | MPVKSIGINNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK* |
| Ga0114351_12957013 | 3300008117 | Freshwater, Plankton | MPSVKGIGYTPYTSRPMEKTTSMSKMVADHGNKSNYNKVGARGS* |
| Ga0114354_10038653 | 3300008119 | Freshwater, Plankton | MPSVKSIGYTNYATRPMEKTTSMNKQVSDHGNKAHYMKVGK* |
| Ga0114355_10290944 | 3300008120 | Freshwater, Plankton | MPVKSIDHTNYNSRPMEKLTSMNKQMSDHGNKTHYMKVGK* |
| Ga0114841_11643831 | 3300008259 | Freshwater, Plankton | MPVKSIGMTNYSSRPMEKTTSMNKNVADHGNKTHYNKVGK* |
| Ga0114336_10905633 | 3300008261 | Freshwater, Plankton | MPSVKGIGYTNHAVRPMEKTTSMNKQVSDHGNKTHYMK |
| Ga0114336_11031592 | 3300008261 | Freshwater, Plankton | MIYIMPSVKGIGITNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK* |
| Ga0114336_11661932 | 3300008261 | Freshwater, Plankton | MPSVKGIGYTNFSSRPMEKTTSMSKHVADHGNKTNYNKVGK* |
| Ga0114973_106234572 | 3300009068 | Freshwater Lake | MPSVKGIGNTNYSSRPMEKTTSMNKQLADNGNKTHYNKVGK* |
| Ga0114962_101355573 | 3300009151 | Freshwater Lake | MPSVKTIGYTNYSSRPMEKTTSMNKYTSDHGNKAHYKKVGK* |
| Ga0114980_105293662 | 3300009152 | Freshwater Lake | MPVKTIGYYNLRSRPMEKTTSMNKMVADHGNKTHYNEIGK* |
| Ga0114963_101827702 | 3300009154 | Freshwater Lake | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAPYNKVGK* |
| Ga0114981_103364713 | 3300009160 | Freshwater Lake | IMPVKTIGYSNFSSRPMEKTTSMNKMVADHGNKTHYNKIGK* |
| Ga0114975_103647611 | 3300009164 | Freshwater Lake | MPVKSIGITNYSSRPMEKTTSMNKNVDDHGNKAHYNKVGK* |
| Ga0114969_104456122 | 3300009181 | Freshwater Lake | MPSVKGIGHSNYSSRPMEKTTSMSKSVADHGNKTNYNKVGK* |
| Ga0114972_104737992 | 3300009187 | Freshwater Lake | MPVKSIGYSNYSSRPMEKTTSMNKNSADHGNKAHYNKVGK* |
| Ga0114982_12190781 | 3300009419 | Deep Subsurface | MPSVKSIGYTSYASRPMEKTTSMNKQVADHGNKAHYNKVGK* |
| Ga0114964_103260393 | 3300010157 | Freshwater Lake | DIYMPSVKGIGNTNYNSRPMEKTTSMNKQLADNGNKTHYNKVGK* |
| Ga0133913_104847221 | 3300010885 | Freshwater Lake | TIIYNMPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK* |
| Ga0133913_112979203 | 3300010885 | Freshwater Lake | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHYKKVGK* |
| Ga0133913_121008443 | 3300010885 | Freshwater Lake | MPSVKSIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK* |
| Ga0133913_130859582 | 3300010885 | Freshwater Lake | MPVKTIGYSNFSSRPMEKTTSMNKMVADHGNKTHYNKIGK* |
| Ga0157605_10571711 | 3300012716 | Freshwater | IGHSNYTSRPMEKTTTMSKSVADHGNKTNYNIVGK* |
| Ga0164292_103948322 | 3300013005 | Freshwater | MIYIMPSVKGIGYTNHSSRPMEKTTSMNKQVADHGNKTHYNKVGK* |
| Ga0164294_103580312 | 3300013006 | Freshwater | MPVKSIGMTNYSSRPMEKTTSMNKNVADHGNKAHYN |
| Ga0164294_104716381 | 3300013006 | Freshwater | VKSIGMTNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK* |
| Ga0164295_105398714 | 3300013014 | Freshwater | MPVKSIGMRNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK* |
| Ga0164295_108975691 | 3300013014 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHYN |
| Ga0157622_11608491 | 3300013310 | Freshwater | MPVKGIGHSNYTSRPMEKTTSMSKPVADHGNKTNYNKVGK* |
| Ga0207193_10257226 | 3300020048 | Freshwater Lake Sediment | MPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVGK |
| Ga0207193_12124634 | 3300020048 | Freshwater Lake Sediment | MPSVKGIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0211732_15656412 | 3300020141 | Freshwater | MPSVKGIGYTNHATRPMEKTTSMNKQVSDHGNKTHYMKVGK |
| Ga0211736_104871421 | 3300020151 | Freshwater | MPSVKGIGYTNHAVRPMEKTTSMNKQLADHGNKTNYMKVGK |
| Ga0211736_107882451 | 3300020151 | Freshwater | IIYIMPSVKGIGYTNHAVRPMEKTTSMNKQVSDHGNKAHYMKVGK |
| Ga0211736_108612171 | 3300020151 | Freshwater | MPSVKGIGYSNHATRPMEKTTSMNKQVADHGNKTHYMKVGK |
| Ga0211734_107861632 | 3300020159 | Freshwater | MIYIMPSVKGIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0211733_105914632 | 3300020160 | Freshwater | MYNIYIIMPSVKGIGYTNHAVRPMEKTTSMNKQVSDHGNKTHYMKVGK |
| Ga0211735_107948992 | 3300020162 | Freshwater | MYKYIMPSVKGIGHTNYASRPMEKTTSMNKQVSDHGNKTNYMKVGK |
| Ga0211735_109208751 | 3300020162 | Freshwater | MPSVKGIGYTNHAVRPMEKTTSMNKQVSDHGNKTHYMKVGK |
| Ga0211729_103359462 | 3300020172 | Freshwater | MPSVKGIGYTNFSSRPMEKTTSMSKLTSDHGNKTNYNKVGK |
| Ga0211731_113427102 | 3300020205 | Freshwater | MIYIMPSVKGIGYTNYSSRPMEKTTSMNKQVADHGN |
| Ga0208483_10176211 | 3300020492 | Freshwater | DIYIMPSVKGIGITNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0208591_10062491 | 3300020493 | Freshwater | MPSVKGIGHSNYSSRPMEKTTSMSKSVADHGNKTNYNKVGK |
| Ga0208591_10332621 | 3300020493 | Freshwater | MPSVKGIGYTNFSSRPMEKTTSMSKYVADHGNKTNYNKVGK |
| Ga0208363_10233873 | 3300020503 | Freshwater | SVKGIGNTNFSSRPMEKTNSMNKQLADNGNKTHYNKVGK |
| Ga0208088_10170151 | 3300020505 | Freshwater | MPVKGIGHSNYTSRPMEKTTSMSKPVADHGNKTNYNKVGK |
| Ga0208481_10125332 | 3300020520 | Freshwater | MYDIYIMPSVKGIGYTNHSSRPMEKTTSMNKQVADHGNKTHYNKVGK |
| Ga0208226_10083263 | 3300020523 | Freshwater | MIYIMPSVKGIGITNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0208224_10005277 | 3300020528 | Freshwater | MPSIKGIGHSNYSSRPMEKTTSMSKSVADHGNKTNYNKVGK |
| Ga0208224_10034301 | 3300020528 | Freshwater | MPSVKSIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0208227_10317562 | 3300020540 | Freshwater | MPVKGIGHSNYTSRPMEKTTSMNKQVADHGNKTHYNKVGK |
| Ga0208856_10148483 | 3300020548 | Freshwater | MPVKGIGHSNNTSRPMEKTTSMSKHVADHGNKTNYNKVGK |
| Ga0207934_10705103 | 3300020561 | Freshwater | PSVKGIGYTNHAVRPMEKTTSMNKQVSDHGNKTHYMKVGK |
| Ga0208718_10471151 | 3300020565 | Freshwater | MPSVKGIGYTNHAVGPMEKTTSMNKHVSDHGNKTHYMKVGK |
| Ga0207909_10609973 | 3300020572 | Freshwater | IGYSNHATRPMEKTTSMNKQVADHGNKTHYMKVGK |
| Ga0208053_10203952 | 3300020575 | Freshwater | MYDIYIMPSVKGIGITNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0214210_10003995 | 3300020689 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK |
| Ga0214178_10057102 | 3300020718 | Freshwater | MPVKSIGYSNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK |
| Ga0214170_10651051 | 3300020731 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHY |
| Ga0214201_10140571 | 3300020732 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKTHYNKVGK |
| Ga0214201_10277361 | 3300020732 | Freshwater | MPVKSIGYSNYSSRPMEKTTSMNKNVADHGNKTHYNKVGK |
| Ga0214162_10105123 | 3300021108 | Freshwater | MPSVKGIGYTNFSSRPMEKTTSMNKYVADHGNKTNYNKVGK |
| Ga0214162_10727612 | 3300021108 | Freshwater | MPSVKSIGHSNYASRPMEKTTSMNKQVSDHGNKAHYMKVGK |
| Ga0208742_10704461 | 3300025437 | Freshwater | MPVKSIGITNYSSRPMEKTTSMNKNVADHGNKAHYNKV |
| Ga0208872_11052701 | 3300025838 | Freshwater | MPVKSIGYSNYSSRPMEKTTSMNKNIADHGNKAHY |
| Ga0208960_11475141 | 3300027649 | Freshwater Lentic | MIYIMPSVKGIGYTNHSSRPMEKTTSMNKQVADHGNKT |
| Ga0209107_104430612 | 3300027797 | Freshwater And Sediment | MPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYN |
| Ga0209668_104395393 | 3300027899 | Freshwater Lake Sediment | SIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0209299_12567792 | 3300027974 | Freshwater Lake | MPVKTIGYSNFSSRPMEKTTSMNKMVADHGNKTHY |
| Ga0209299_13248782 | 3300027974 | Freshwater Lake | MPVKTIGYSNFSSRPMEKTTSMNKMVADHGNKTHYNKIGK |
| Ga0247722_100071652 | 3300028027 | Deep Subsurface Sediment | MIYIMPSVKGIGYTNHSSRPMEKTTSMNKQVADHGNKTHYNKVGK |
| Ga0315899_105964942 | 3300031784 | Freshwater | MPVKSIGMTNYSSRPMEKTTSMNKNVADHGNKAHYNKVGKK |
| Ga0315899_108010752 | 3300031784 | Freshwater | MPVKGIGHSNYTSRPIEKTTSMSKHVADHGNKTNYNKVGK |
| Ga0315899_110787063 | 3300031784 | Freshwater | GIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVGK |
| Ga0315899_111380221 | 3300031784 | Freshwater | IIIYNMPVKSIGMTNYSSRPMEKTTSMNKNVADHGNKAHYNKVGK |
| Ga0315899_111582041 | 3300031784 | Freshwater | MPSVKGIGYTNFSSRPMEKTTSMSKYVADHGNKTN |
| Ga0315899_115484202 | 3300031784 | Freshwater | MPSVKGIGHTNFHSRPMEKTTSMSKMVADHGNKSNYNKVGK |
| Ga0315908_103039982 | 3300031786 | Freshwater | MPSVKGIGHTNFHSRPMEKTTSMSKMVADHGNKSNYNKVGARGS |
| Ga0315908_105767064 | 3300031786 | Freshwater | MPSVKSIGYTNYATRPMEKTTSMNKQVSDHGNKAHYMKVGK |
| Ga0315906_111239142 | 3300032050 | Freshwater | MPSVKGIGNTNYSSRPMGKTTSMNKQLADNGNKTHYNKVGK |
| Ga0315905_107285134 | 3300032092 | Freshwater | GIGYTNFSSRPMEKTTSMSKYVADHGNKTNYSKVGK |
| Ga0334989_0565706_195_320 | 3300033984 | Freshwater | MPSAKGIGNSNYSSRPMEKTTSMNKQLADNGNKTHYNKVGK |
| Ga0334994_0440253_1_126 | 3300033993 | Freshwater | IMPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVGK |
| Ga0335005_0431434_629_748 | 3300034022 | Freshwater | TVKGIGYTNHSSRPMEKTTSMNKQVADHGNKTHYNKVGK |
| Ga0335005_0655560_159_284 | 3300034022 | Freshwater | MPSVKGIGITNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0335023_0297022_505_627 | 3300034050 | Freshwater | MPVKGIGHSNYTSRPMEKTTSVSKHVADHGNKTNYNKVGK |
| Ga0335023_0570850_3_116 | 3300034050 | Freshwater | KGIGHSNYSSRPMEKTTSMSKSVADHGNKTNYNKVGK |
| Ga0335024_0332201_652_771 | 3300034051 | Freshwater | SVKGIGYTNFSSRPMEKTTSMNKYVADHGNKTNYNKVGK |
| Ga0334983_0537129_37_171 | 3300034060 | Freshwater | MIYIMPVKGIGHSNYSSRPMEKTTSMSKPVADHGNKTNYNKVGK |
| Ga0334983_0587630_3_122 | 3300034060 | Freshwater | MPSVKSIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKIG |
| Ga0334983_0627192_2_112 | 3300034060 | Freshwater | MIYIMPVKGIGHSNYSSRPMEKTTSMSKPVADHGNKT |
| Ga0334990_0249356_101_226 | 3300034068 | Freshwater | MPTVKGIGYTNHSSRPMEKTTSMNKQVADHGNKTHYNKVGK |
| Ga0334990_0308028_699_821 | 3300034068 | Freshwater | MPVKGIGHSNYSSRPMEKTTSMSKPVADHGNKTNYNKVGK |
| Ga0335025_0515324_16_153 | 3300034096 | Freshwater | MIYIMPSVKGIGYTNHSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0335035_0099535_3_137 | 3300034105 | Freshwater | VYIMPSVKSIGYTNYSSRPMEKTTSMNKQVADHGNKAHYNKVGK |
| Ga0335066_0663412_414_530 | 3300034112 | Freshwater | MPVKGIGHSNYTSRPMEKTTSMSKHVADHGNKTNYNKVG |
| Ga0335068_0482791_26_163 | 3300034116 | Freshwater | MIYIMPSVKGIRYTNHSSRPMEKTTSMNKQVADHGNKTHYNKVGK |
| Ga0335017_0155649_3_125 | 3300034167 | Freshwater | MPSVKGIGYTNISSRPMEKTTSMNKMVADHGNKTNYNKVGK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |