Basic Information | |
---|---|
Family ID | F059510 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 47 residues |
Representative Sequence | MAPKRGGGNAKKAATGASHDKEWVPSLMGEMELNEMVEAGVLPN |
Number of Associated Samples | 64 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 5.22 % |
% of genes near scaffold ends (potentially truncated) | 54.14 % |
% of genes from short scaffolds (< 2000 bps) | 86.47 % |
Associated GOLD sequencing projects | 64 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (90.226 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.489 % of family members) |
Environment Ontology (ENVO) | Unclassified (95.489 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (95.489 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF04195 | Transposase_28 | 8.27 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 90.23 % |
All Organisms | root | All Organisms | 9.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300013297|Ga0157378_11631725 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 691 | Open in IMG/M |
3300014745|Ga0157377_11657697 | Not Available | 514 | Open in IMG/M |
3300015267|Ga0182122_1019676 | Not Available | 718 | Open in IMG/M |
3300015268|Ga0182154_1005326 | Not Available | 1018 | Open in IMG/M |
3300015268|Ga0182154_1061607 | Not Available | 530 | Open in IMG/M |
3300015269|Ga0182113_1040871 | Not Available | 653 | Open in IMG/M |
3300015269|Ga0182113_1052405 | Not Available | 608 | Open in IMG/M |
3300015274|Ga0182188_1019990 | Not Available | 676 | Open in IMG/M |
3300015274|Ga0182188_1060715 | Not Available | 506 | Open in IMG/M |
3300015275|Ga0182172_1029660 | Not Available | 660 | Open in IMG/M |
3300015276|Ga0182170_1025731 | Not Available | 688 | Open in IMG/M |
3300015276|Ga0182170_1028301 | Not Available | 671 | Open in IMG/M |
3300015276|Ga0182170_1076136 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 505 | Open in IMG/M |
3300015276|Ga0182170_1076373 | Not Available | 504 | Open in IMG/M |
3300015277|Ga0182128_1072592 | Not Available | 517 | Open in IMG/M |
3300015277|Ga0182128_1072608 | Not Available | 517 | Open in IMG/M |
3300015279|Ga0182174_1057613 | Not Available | 568 | Open in IMG/M |
3300015281|Ga0182160_1067054 | Not Available | 538 | Open in IMG/M |
3300015283|Ga0182156_1053351 | Not Available | 585 | Open in IMG/M |
3300015287|Ga0182171_1040625 | Not Available | 632 | Open in IMG/M |
3300015289|Ga0182138_1035161 | Not Available | 659 | Open in IMG/M |
3300015289|Ga0182138_1042548 | Not Available | 625 | Open in IMG/M |
3300015291|Ga0182125_1031217 | Not Available | 695 | Open in IMG/M |
3300015292|Ga0182141_1024764 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 740 | Open in IMG/M |
3300015292|Ga0182141_1049302 | Not Available | 609 | Open in IMG/M |
3300015294|Ga0182126_1036584 | Not Available | 668 | Open in IMG/M |
3300015294|Ga0182126_1040793 | Not Available | 648 | Open in IMG/M |
3300015294|Ga0182126_1066641 | Not Available | 562 | Open in IMG/M |
3300015294|Ga0182126_1093806 | Not Available | 506 | Open in IMG/M |
3300015296|Ga0182157_1011910 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 938 | Open in IMG/M |
3300015298|Ga0182106_1076251 | Not Available | 552 | Open in IMG/M |
3300015300|Ga0182108_1089794 | Not Available | 531 | Open in IMG/M |
3300015302|Ga0182143_1073987 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 560 | Open in IMG/M |
3300015303|Ga0182123_1045369 | Not Available | 630 | Open in IMG/M |
3300015303|Ga0182123_1080335 | Not Available | 535 | Open in IMG/M |
3300015303|Ga0182123_1092248 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 513 | Open in IMG/M |
3300015307|Ga0182144_1017275 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 862 | Open in IMG/M |
3300015307|Ga0182144_1034439 | Not Available | 709 | Open in IMG/M |
3300015308|Ga0182142_1014677 | Not Available | 921 | Open in IMG/M |
3300015308|Ga0182142_1048375 | Not Available | 655 | Open in IMG/M |
3300015314|Ga0182140_1025501 | Not Available | 788 | Open in IMG/M |
3300015314|Ga0182140_1044357 | Not Available | 674 | Open in IMG/M |
3300015314|Ga0182140_1055212 | Not Available | 633 | Open in IMG/M |
3300015321|Ga0182127_1078435 | Not Available | 584 | Open in IMG/M |
3300015322|Ga0182110_1051824 | Not Available | 660 | Open in IMG/M |
3300015341|Ga0182187_1159497 | Not Available | 547 | Open in IMG/M |
3300015341|Ga0182187_1166554 | Not Available | 538 | Open in IMG/M |
3300015342|Ga0182109_1056165 | Not Available | 836 | Open in IMG/M |
3300015342|Ga0182109_1157869 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 574 | Open in IMG/M |
3300015342|Ga0182109_1223669 | Not Available | 502 | Open in IMG/M |
3300015343|Ga0182155_1057954 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 815 | Open in IMG/M |
3300015343|Ga0182155_1083635 | Not Available | 720 | Open in IMG/M |
3300015343|Ga0182155_1145516 | Not Available | 592 | Open in IMG/M |
3300015343|Ga0182155_1168333 | Not Available | 561 | Open in IMG/M |
3300015344|Ga0182189_1073055 | Not Available | 767 | Open in IMG/M |
3300015344|Ga0182189_1107620 | Not Available | 667 | Open in IMG/M |
3300015345|Ga0182111_1170547 | Not Available | 579 | Open in IMG/M |
3300015346|Ga0182139_1132852 | Not Available | 638 | Open in IMG/M |
3300015346|Ga0182139_1168598 | Not Available | 583 | Open in IMG/M |
3300015346|Ga0182139_1200805 | Not Available | 544 | Open in IMG/M |
3300015346|Ga0182139_1215985 | Not Available | 528 | Open in IMG/M |
3300015346|Ga0182139_1216568 | Not Available | 528 | Open in IMG/M |
3300015347|Ga0182177_1020899 | Not Available | 1239 | Open in IMG/M |
3300015347|Ga0182177_1147637 | Not Available | 615 | Open in IMG/M |
3300015351|Ga0182161_1137739 | Not Available | 655 | Open in IMG/M |
3300015351|Ga0182161_1162791 | Not Available | 614 | Open in IMG/M |
3300015351|Ga0182161_1185318 | Not Available | 583 | Open in IMG/M |
3300015351|Ga0182161_1226652 | Not Available | 537 | Open in IMG/M |
3300015355|Ga0182159_1154159 | Not Available | 718 | Open in IMG/M |
3300015355|Ga0182159_1186687 | Not Available | 662 | Open in IMG/M |
3300015355|Ga0182159_1254580 | Not Available | 579 | Open in IMG/M |
3300015355|Ga0182159_1282477 | Not Available | 553 | Open in IMG/M |
3300015355|Ga0182159_1308729 | Not Available | 532 | Open in IMG/M |
3300015361|Ga0182145_1066450 | Not Available | 720 | Open in IMG/M |
3300015361|Ga0182145_1130066 | Not Available | 576 | Open in IMG/M |
3300017404|Ga0182203_1139335 | Not Available | 531 | Open in IMG/M |
3300017407|Ga0182220_1037419 | Not Available | 676 | Open in IMG/M |
3300017407|Ga0182220_1095854 | Not Available | 521 | Open in IMG/M |
3300017409|Ga0182204_1090026 | Not Available | 550 | Open in IMG/M |
3300017411|Ga0182208_1074348 | Not Available | 599 | Open in IMG/M |
3300017411|Ga0182208_1085588 | Not Available | 573 | Open in IMG/M |
3300017411|Ga0182208_1094758 | Not Available | 555 | Open in IMG/M |
3300017415|Ga0182202_1053973 | Not Available | 680 | Open in IMG/M |
3300017415|Ga0182202_1087037 | Not Available | 586 | Open in IMG/M |
3300017415|Ga0182202_1093400 | Not Available | 573 | Open in IMG/M |
3300017415|Ga0182202_1124617 | Not Available | 521 | Open in IMG/M |
3300017420|Ga0182228_1091131 | Not Available | 571 | Open in IMG/M |
3300017424|Ga0182219_1133314 | Not Available | 511 | Open in IMG/M |
3300017425|Ga0182224_1045055 | Not Available | 758 | Open in IMG/M |
3300017425|Ga0182224_1073883 | Not Available | 651 | Open in IMG/M |
3300017427|Ga0182190_1027003 | Not Available | 922 | Open in IMG/M |
3300017427|Ga0182190_1111588 | Not Available | 576 | Open in IMG/M |
3300017427|Ga0182190_1133458 | Not Available | 541 | Open in IMG/M |
3300017433|Ga0182206_1054756 | Not Available | 705 | Open in IMG/M |
3300017433|Ga0182206_1060903 | Not Available | 683 | Open in IMG/M |
3300017433|Ga0182206_1125873 | Not Available | 543 | Open in IMG/M |
3300017433|Ga0182206_1138617 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 526 | Open in IMG/M |
3300017433|Ga0182206_1143498 | Not Available | 520 | Open in IMG/M |
3300017436|Ga0182209_1105544 | Not Available | 592 | Open in IMG/M |
3300017436|Ga0182209_1120092 | Not Available | 568 | Open in IMG/M |
3300017438|Ga0182191_1054846 | Not Available | 750 | Open in IMG/M |
3300017442|Ga0182221_1052923 | Not Available | 721 | Open in IMG/M |
3300017442|Ga0182221_1084038 | Not Available | 627 | Open in IMG/M |
3300017442|Ga0182221_1122402 | Not Available | 558 | Open in IMG/M |
3300017443|Ga0182193_1054698 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 774 | Open in IMG/M |
3300017443|Ga0182193_1063219 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 739 | Open in IMG/M |
3300017680|Ga0182233_1078982 | Not Available | 595 | Open in IMG/M |
3300017683|Ga0182218_1129956 | Not Available | 530 | Open in IMG/M |
3300017684|Ga0182225_1124867 | Not Available | 527 | Open in IMG/M |
3300017685|Ga0182227_1135732 | Not Available | 503 | Open in IMG/M |
3300017686|Ga0182205_1065467 | Not Available | 694 | Open in IMG/M |
3300017686|Ga0182205_1093531 | Not Available | 618 | Open in IMG/M |
3300025899|Ga0207642_10467522 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300025942|Ga0207689_11018374 | Not Available | 698 | Open in IMG/M |
3300026089|Ga0207648_12007120 | Not Available | 540 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 95.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.26% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0157378_116317251 | 3300013297 | Miscanthus Rhizosphere | MAPKRGGGNAKRAAIGVSHDKEWVPSLMGEMELNEMVEAGVLPDRVIAE* |
Ga0157378_122299351 | 3300013297 | Miscanthus Rhizosphere | MAPKRGGGNAKKAATGVSRDKEWVPSLMGEMELHE |
Ga0157377_116576971 | 3300014745 | Miscanthus Rhizosphere | MAPKRGGGNLKKAATRASHDKEWVSSLMGEMELNDMVEVC |
Ga0182122_10196761 | 3300015267 | Miscanthus Phyllosphere | MAPKRGDGNPKKATAGASHDKEWVPSNIGEAELNRMLEAGILPDRITAG |
Ga0182154_10053262 | 3300015268 | Miscanthus Phyllosphere | MAPKRGGGNPKKAAVGASHDNEWVPSLMGEMELNEMVEAGILPNRITAG* |
Ga0182154_10616071 | 3300015268 | Miscanthus Phyllosphere | MAPKRGVGNPKKVAARSSHDKEWVLSLMGEAELNGMVEAG |
Ga0182113_10408711 | 3300015269 | Miscanthus Phyllosphere | MALKRGGGNPKKAATGTSRDKEWVPSLMGETELNEMVVAGILPERVIAGWRPVDGE |
Ga0182113_10524052 | 3300015269 | Miscanthus Phyllosphere | MAPKRGGGNAKKAAAGTSRDKEWGPSLMGKTELNEMVEAGVLPDRVTIGWRPVDGEPYP |
Ga0182188_10199901 | 3300015274 | Miscanthus Phyllosphere | MAPKRGVGNPKKAATGSSRDKEWVPSLMGEAELNGMVEAGFLPDRVTAGWRPANSE |
Ga0182188_10607151 | 3300015274 | Miscanthus Phyllosphere | MAPKRGGGNPKKVAVGVSHDKEWVPLLMGETNLNGVVEEGVLPDRVTIGWRPTDGE |
Ga0182172_10296601 | 3300015275 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATGASHDKEWVLSLMGETDLNEMEKAGVLHLVEIR |
Ga0182170_10257311 | 3300015276 | Miscanthus Phyllosphere | MAPKRGGGNAKKAAAGSSRDKEWVPSLMGETEPNEMVEASILDHVTTGWRPANGEP |
Ga0182170_10283011 | 3300015276 | Miscanthus Phyllosphere | MASKRGGGNPKKAASRASCDNEWVPSLMGETELNEMVEVGVLPDCI |
Ga0182170_10761362 | 3300015276 | Miscanthus Phyllosphere | GGGNAKKAAAGTSHDTEWVPSLLGEMKLNEMVEAGVLPDRVTVGWCPAER* |
Ga0182170_10763731 | 3300015276 | Miscanthus Phyllosphere | MAPKRGGGNPKKATAGASRDKEWVQSLMGETELNEMVEAGVLPDRVTTGWCPA |
Ga0182128_10725921 | 3300015277 | Miscanthus Phyllosphere | MAPKKGGGNPKKAAARTSRDKEWVPSLMGEMELNEMVAAGIPLK* |
Ga0182128_10726081 | 3300015277 | Miscanthus Phyllosphere | MAPKRGGGNAKKATAGTSHDQEWVPSLMGEMELNEMVAAGVLTKRVELFVVSNFG* |
Ga0182174_10241012 | 3300015279 | Miscanthus Phyllosphere | MAPKRGGGNPKKAASGGSHDNEWVSSLMGEMDLNEMV |
Ga0182174_10576132 | 3300015279 | Miscanthus Phyllosphere | MAPKRGGGNAKKATAGASQDHEWVSSLMGETELNGMVEASILPDRVTVGWR |
Ga0182160_10670542 | 3300015281 | Miscanthus Phyllosphere | MAPKRGGGNTKKAPTGVSHDKEWVPLLMGETELNEMVEAGILPDRV |
Ga0182156_10355892 | 3300015283 | Miscanthus Phyllosphere | MAPKRGGGSTKKAAAGVSRDKEWVPSLMGETELNEM |
Ga0182156_10533511 | 3300015283 | Miscanthus Phyllosphere | MAPKRGGGNPKKVAAGASHDKEWLPSLMGEMELNEMVAAGVLPKRVELFVVSNFG* |
Ga0182171_10406251 | 3300015287 | Miscanthus Phyllosphere | MALKRGGGNPKKAVARASHDKEWVSSLMGETDLNEMVEASVPPDRFTAGWCPADGE |
Ga0182171_10606001 | 3300015287 | Miscanthus Phyllosphere | MASKRGGGNPKKAAAGVSHDKKWVPSLMGETELNEMVE |
Ga0182173_10670051 | 3300015288 | Miscanthus Phyllosphere | MAPKRGGGNAKKASTRASHDKEWVPILMGETELNEM |
Ga0182138_10351611 | 3300015289 | Miscanthus Phyllosphere | MGLKRGGGNTKKAAAGTSRDKECVPSLMGETELNEMVAAGVLP* |
Ga0182138_10425481 | 3300015289 | Miscanthus Phyllosphere | MALKRGKGNAKNAAAGASHDKEWVSSLMGETELNEMVEAGDLPNRVTTGWRPADGEPY |
Ga0182125_10312171 | 3300015291 | Miscanthus Phyllosphere | MAPKRGGGNPKKAATGMSRDKEWVLSLMGETELNEMVEAGVLPDHDTVRWCSVDGEP* |
Ga0182141_10247641 | 3300015292 | Miscanthus Phyllosphere | MVLKRGGGNPKRAAVEMSHDKEWVPSLMGETELNEMVAAGVLPK* |
Ga0182141_10493021 | 3300015292 | Miscanthus Phyllosphere | MASKRGGGNPKKAAIGASHDKECVLSLMGEMELNEMV |
Ga0182126_10365841 | 3300015294 | Miscanthus Phyllosphere | MAPKRGVGNPKKAAARTSRDKEWVPSLMGEMELNEMVAAGIPLK* |
Ga0182126_10407932 | 3300015294 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATGASHDKEWVPSLMGEMELNEMVEAGVLPN* |
Ga0182126_10666412 | 3300015294 | Miscanthus Phyllosphere | MAPKRGGGNPKKAAIGASRDKEWVLSLMGEMELDKMVEAGVLPD* |
Ga0182126_10938061 | 3300015294 | Miscanthus Phyllosphere | MAPKRGRGNAKKAAAGTSRDKEWVPSLMGETELNEMVEAGVLPD |
Ga0182157_10119101 | 3300015296 | Miscanthus Phyllosphere | MAPKRGSGNTKKVADGASHDKEWVLSLMGEMELNEMVEAGILPNRITAG* |
Ga0182157_10590671 | 3300015296 | Miscanthus Phyllosphere | MVPKRGGGNPKKAATRVSHDKEWVSSLLGEMKLNEMVETGVLPDR |
Ga0182106_10762511 | 3300015298 | Miscanthus Phyllosphere | MAPKRGGGNVKKVAAGASHDKEWVPSVMGETKLNEMVEVDV |
Ga0182108_10897941 | 3300015300 | Miscanthus Phyllosphere | MVPKRGGGNAKKAATGMSRDKECVPSLMGETELNEMVEAGVLPDHDTVRWCSVDGEP* |
Ga0182143_10205052 | 3300015302 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATEVSRDKEWVTSLMGVTKLNE |
Ga0182143_10739871 | 3300015302 | Miscanthus Phyllosphere | MTPKRGGGNPKKTAAKASYDKEWVPSLIGEIELSEMVEASILPD* |
Ga0182123_10453691 | 3300015303 | Miscanthus Phyllosphere | MAPKRGGGNPKKAATGTSRDKEWVPSLMGEMELNEMVAVGILPK* |
Ga0182123_10803351 | 3300015303 | Miscanthus Phyllosphere | MALKRGGGNAKKAAIGASHGKEWVPSLMWETEVNEIVE |
Ga0182123_10922482 | 3300015303 | Miscanthus Phyllosphere | MAPKRGGGNAKKVAIGASRNKEWVPSLMGETKLNEMVETGILPDRVIIASGRR* |
Ga0182112_10847291 | 3300015304 | Miscanthus Phyllosphere | MAPKRGVGNPKKAAARASHDNEWVPSLMGEAEINRMVEAGILSDRVTAG* |
Ga0182112_10999321 | 3300015304 | Miscanthus Phyllosphere | MAPKRGGGNAKKAAAGTSHDKERVPSLMGETELNEMVETS |
Ga0182144_10172751 | 3300015307 | Miscanthus Phyllosphere | MALKRGGGNPKKAATGTSRDKEWVPSLMGEMELNEMVAVGILPK* |
Ga0182144_10344391 | 3300015307 | Miscanthus Phyllosphere | MTPKRGVGNPKKATAGTSHDQEWVPSLMGEMELNEMVAAGVLTKRVELFVVSNFG* |
Ga0182142_10146771 | 3300015308 | Miscanthus Phyllosphere | MAPKRGGGNVKKAAIGASHDKEWVPSLMGEMELNEMVEVGVLLDR |
Ga0182142_10483751 | 3300015308 | Miscanthus Phyllosphere | MAPKRGVGNLKKVAAGSSRDKEWVPSLMGEAELNGMVEAGFLPDRVTAGWRPANSELYPM |
Ga0182140_10255011 | 3300015314 | Miscanthus Phyllosphere | MAPKRGGGNPKKVAVWTSRDKECLPSLMGEKELNEMVEAGVLPDRVTAGWCPANGEP* |
Ga0182140_10443571 | 3300015314 | Miscanthus Phyllosphere | MALKRGGGNAKKAVTGASCDKEWVPTLMEETELNKMVEAGVLPDCVTT* |
Ga0182140_10552121 | 3300015314 | Miscanthus Phyllosphere | MAPKKGGGNAKKAATGASRDKEWVPSLMGETELNEMVEAGDLPDRVTVGWHPADGEP |
Ga0182127_10784352 | 3300015321 | Miscanthus Phyllosphere | MAPKRRGGNPKKAAAGTSRDKEWVPSLMGETELNEMVEAGVLP |
Ga0182110_10518241 | 3300015322 | Miscanthus Phyllosphere | MAPKRGGGNAKKANAVMSHEKEWVSSLMQETELNEMVEAGVLPDRFTAGWRPADEIVV |
Ga0182187_11594971 | 3300015341 | Miscanthus Phyllosphere | MASKRGGGNPKKAATGASYDKEWMSSLMGEAELNGMVEVGILPDRITTGWR |
Ga0182187_11665541 | 3300015341 | Miscanthus Phyllosphere | MASKKGGGNPKKTVAGASHDMEWVPSLMGETKLNEMVEAGILPDRATAGWRLT |
Ga0182109_10561651 | 3300015342 | Miscanthus Phyllosphere | MALKRGGGNPKKAVARASHDKEWVSSLMGETDLNEMVEASVPPDRF |
Ga0182109_11578691 | 3300015342 | Miscanthus Phyllosphere | MAPKRRGGNPKKAAAGASRDNEWVPSLMGETELNEMVEAGVLPDRITVG* |
Ga0182109_12236691 | 3300015342 | Miscanthus Phyllosphere | MVPKRGGGNAKKAAAGVNRDKEWVPSLLGEMELNEMVDAGVLPDRVTAGWRLA |
Ga0182155_10579541 | 3300015343 | Miscanthus Phyllosphere | MAPKRGVGNLKKVAARSSHDKEWVLSLMGEAELNGMVEAGVLLDRVTAG* |
Ga0182155_10836352 | 3300015343 | Miscanthus Phyllosphere | MAPKKGSGNPKKATAGASHDNEWVPSLMGEAEINRMVEAGVLPDRVTAG* |
Ga0182155_11455161 | 3300015343 | Miscanthus Phyllosphere | MVPKRGGGNAKKAATGASHDNEWVHSLMGKTELNEMVEASILPDRVTAGWRPADGE |
Ga0182155_11683332 | 3300015343 | Miscanthus Phyllosphere | MAPKKGGGNAKKVAIGASRDKKWVPSLMGETELIEMVEAGVLPDRVTAGWHLADG* |
Ga0182189_10730552 | 3300015344 | Miscanthus Phyllosphere | MAPKRGGGNPKKVAVGASHDNEWVPSLMGETELNEMVEVGVLPN |
Ga0182189_10923341 | 3300015344 | Miscanthus Phyllosphere | MVSMRGGGNAKKAAAGTSHDTEWVPSLLGEMKLNEMVEAGVLPDR |
Ga0182189_11076202 | 3300015344 | Miscanthus Phyllosphere | MAPKRGGGNTKKAAARVSHDKEWVPSLRGETELNEMVEAGVLPDCVTVG* |
Ga0182189_11986041 | 3300015344 | Miscanthus Phyllosphere | MALKRGSASMKKAATRMSHDKEWVLSLMGEMDLNEMVEVCVLP |
Ga0182111_11705471 | 3300015345 | Miscanthus Phyllosphere | MASKRGFGNLKKATTGESHDNEWVSLLMGDMKLNGMVEAGVLPDCVTA |
Ga0182139_11171641 | 3300015346 | Miscanthus Phyllosphere | MVSMRGGGTAKKAAAGTSHDTEWVPSLLGEMKLNEM |
Ga0182139_11328521 | 3300015346 | Miscanthus Phyllosphere | MVPKRGVGNPKKATAGASHDNEWVSSLMGETKLNRMVEAGVLPDRVTTG |
Ga0182139_11685981 | 3300015346 | Miscanthus Phyllosphere | MAPKRGGGNPKKAVAEASRDNEWVPSLMGETELNDMVEAGVLPDRVTVGWRPTDGEPYP |
Ga0182139_12008051 | 3300015346 | Miscanthus Phyllosphere | MAPKRGKGSAKKAATKASYDKEWVPSLMGETELNEMVEAGVLPNHVTAG |
Ga0182139_12159851 | 3300015346 | Miscanthus Phyllosphere | MAPKRGVGNPKKVAAGSSHYKEWVPSLLGEAELNGMAEEGILPDRVTA* |
Ga0182139_12165681 | 3300015346 | Miscanthus Phyllosphere | MAPKRGGGNQKKANARASHDNEWVPSLMGETELNKMMEAGILPD |
Ga0182177_10208992 | 3300015347 | Miscanthus Phyllosphere | MASKRGGGNPKKAAARTSRDKEWVPSLMGEMELNEMVAAGIPLK* |
Ga0182177_11476372 | 3300015347 | Miscanthus Phyllosphere | MAPKRRVGNPKKAAAGASRDNEWVPSLMEEVEINRIMEVDVLPDRVTAGWLPANGE |
Ga0182161_11377391 | 3300015351 | Miscanthus Phyllosphere | MAPKRGGGNPKKVATGASRDKEWVPSLMGETELNRMVEASVLPDRVTAG* |
Ga0182161_11627911 | 3300015351 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATGVSRDMEWVPSLMGETKLNKMVEAGILPDR |
Ga0182161_11853182 | 3300015351 | Miscanthus Phyllosphere | MALQRGGGNTKKVAAGASRDKEWVPSLMGETKLNEMVEAGVLPDHVTAG* |
Ga0182161_12266521 | 3300015351 | Miscanthus Phyllosphere | MAPKRGGGNPKKAATGTSHDKEWVPSLMGEMEPNEMVA |
Ga0182159_11541592 | 3300015355 | Miscanthus Phyllosphere | MVPKRGGGNAKKAAAGTSRDKEWVLSLMGEMELNEMVEAGVLPDRVTTGWRPA |
Ga0182159_11866872 | 3300015355 | Miscanthus Phyllosphere | MAPKRGVGNPKKVATGASRYNEWVSSLMRETQINGMVEAGI |
Ga0182159_12545801 | 3300015355 | Miscanthus Phyllosphere | MASKRGGGNAKKATTEASHDKEWVPSLMGETKLDEMVEAGVLPD |
Ga0182159_12824772 | 3300015355 | Miscanthus Phyllosphere | MAPKRGGGNAKKAAARASLDKEWVPSLIGETELNEMVEA |
Ga0182159_13087292 | 3300015355 | Miscanthus Phyllosphere | MAPKRGGGNTKKAVAGASHEKEWVPSVMGETELNKMVEAGVLPDHVTAGC |
Ga0182145_10664501 | 3300015361 | Miscanthus Phyllosphere | MAPKWGGGNQKKVAIRASHDKEWVPSLMEEMELNEMVEVDILPN* |
Ga0182145_11300662 | 3300015361 | Miscanthus Phyllosphere | MTSKRGGGNPKKAATGTSRDKEWVPSLMGETELNEMVAAGILPERVIAGW |
Ga0182203_11393351 | 3300017404 | Miscanthus Phyllosphere | MAPKRGRGNAKKAAVGTSRDKEWVPSLMGETELNKMVEAGVL |
Ga0182220_10374191 | 3300017407 | Miscanthus Phyllosphere | MAPKRGGGNTKKAAARVSRDKEWAPSLMGETELNEMVEAGVLLDRVTAGWCPADGE |
Ga0182220_10958541 | 3300017407 | Miscanthus Phyllosphere | MALQRGGGNTKKVAAGASRDKEWVPSLMGETKLNEMVEAGVLPDRVII |
Ga0182204_10900261 | 3300017409 | Miscanthus Phyllosphere | MKKAAAEMSRDKEWVPSLMGETELNEMVEAGVLLDRVTVGWRPTNG |
Ga0182207_11597601 | 3300017410 | Miscanthus Phyllosphere | MAPKRGGGNAKKAAAGVSRDMEWVPSLMGETKLNKMVE |
Ga0182208_10743481 | 3300017411 | Miscanthus Phyllosphere | MVPKRGGGNAKKAVAGASRDKEWVPSLMGETELNEMVEAGVLPERVTAGWRPADGEPY |
Ga0182208_10855882 | 3300017411 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATGASHDKEWVPSLMEEMELNEMVEVDILPN |
Ga0182208_10947581 | 3300017411 | Miscanthus Phyllosphere | MAPKRGGGNAKKVAAGASHDKEWVPSLMWETKLNGMVEVGVLLD |
Ga0182208_11155192 | 3300017411 | Miscanthus Phyllosphere | MRGGGNAKKAAAGTSHDTEWVPSLLGEMKLNEMVEAGVLPD |
Ga0182222_10596601 | 3300017413 | Miscanthus Phyllosphere | MAPKRGGGNMKKAATGVSHDMEWVQSLMGEMDLNEMV |
Ga0182202_10539732 | 3300017415 | Miscanthus Phyllosphere | MAPKKGSGNPKKATAGASHDNEWVPSLMGEAEINRMVEAGVLPDRVTAG |
Ga0182202_10870372 | 3300017415 | Miscanthus Phyllosphere | MAPKRGGGNPKKAAARTSHDKEWVPSLMGETELNEMVAAGVLPK |
Ga0182202_10934002 | 3300017415 | Miscanthus Phyllosphere | MASKRGGGNTKKAAVGASRDKEWVPSLMGETKLNEMVEAGILPDRITAETT |
Ga0182202_11246171 | 3300017415 | Miscanthus Phyllosphere | MAPKRGVGNLKKVAAGSSRDKEWVLSLMGEAKLNGMVEAGVLPDHVTTGSRPAN |
Ga0182230_10775861 | 3300017417 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATGVSRDKEWVPSLMGEMELHEMVEVGVL |
Ga0182228_10911311 | 3300017420 | Miscanthus Phyllosphere | MAPKRGGGNPKKVATGASHDKECVPSLMGETELNEIMEVGVLPDRITTRWRPADGEP |
Ga0182219_10841691 | 3300017424 | Miscanthus Phyllosphere | VKKVAAGVSRDKEWVPSLMGETELNEMVEAGVLPERVTAGWRPADGEPYPMPHTNEL |
Ga0182219_11333141 | 3300017424 | Miscanthus Phyllosphere | MAPKRGVGNPKKVTVGASHDNEWVPSLMGDMELNGMVEASVLPDR |
Ga0182224_10450551 | 3300017425 | Miscanthus Phyllosphere | MAPKKGDGNAKKAATGASHDKEWVPSLMGETELNEMVEAGVLPDRVTTGWRPADD |
Ga0182224_10738832 | 3300017425 | Miscanthus Phyllosphere | MAPKRGVGNPKKATAGASHDNEWVPSLMGEMELNEMVEAGVLPN |
Ga0182190_10270031 | 3300017427 | Miscanthus Phyllosphere | MASKKGGGNPKKTVAGASHDMEWVPSLMGETKLNEMVEAGILPDRATAGWR |
Ga0182190_11115881 | 3300017427 | Miscanthus Phyllosphere | MTSKRGGGNPKKAATGTSRDKEWVPSLMGETELNEMVVAGIL |
Ga0182190_11334581 | 3300017427 | Miscanthus Phyllosphere | MALQRGGGNTKKVAAGASRDKEWVPSLMGETKLNEMVEAGVLPDHVTTG |
Ga0182206_10547561 | 3300017433 | Miscanthus Phyllosphere | MAPKKGGGNAKKAATGASRDKEWVPSLMGETELNEMVEAG |
Ga0182206_10609031 | 3300017433 | Miscanthus Phyllosphere | MAPKRGVGNPKKVAVGASRDSEWVPSLMGEAEINRMVEAGVLPDRVTAGW |
Ga0182206_11258733 | 3300017433 | Miscanthus Phyllosphere | MAPKRGGGNTKKAAAGTSRDKEWVPSLMGETELNEMVEVGVLPDHV |
Ga0182206_11386172 | 3300017433 | Miscanthus Phyllosphere | MASKRGGGNPKKAASGASHDKEWVPSLMGETELNEMVEAGVLPDRVTTGWRPADD |
Ga0182206_11434981 | 3300017433 | Miscanthus Phyllosphere | MAPKRGGGNQKKANARASHDNEWVPSLMGETELNKMMEAGILPDRITAG |
Ga0182209_11055441 | 3300017436 | Miscanthus Phyllosphere | MAPKRGGGNPKKAVAGASHDKEWVSSVMGETELNEMVEAGVL |
Ga0182209_11200921 | 3300017436 | Miscanthus Phyllosphere | MAPKRGGGNTKKAPTGVSHDKEWVPLLMGETELNEMVEAGI |
Ga0182191_10548461 | 3300017438 | Miscanthus Phyllosphere | MAPKRGSGNTKKAAVGASHDKEWVLSLMEEMELNGMAKVGIL |
Ga0182221_10529231 | 3300017442 | Miscanthus Phyllosphere | MAPKRGGGNPKKATVGASRDKEWVPSLMGEVERNGMVEVGVLP |
Ga0182221_10840382 | 3300017442 | Miscanthus Phyllosphere | MALKRGGGNPKKATIGASRDKEWVPSLMGETELNDMVETGILPDHV |
Ga0182221_11224022 | 3300017442 | Miscanthus Phyllosphere | MAPKRGGGNPKKAVAEASRDNEWVPSLMGETELNDMVEAGVLPDRVTVG |
Ga0182193_10546982 | 3300017443 | Miscanthus Phyllosphere | MAPKRGGGNPKKAAAGASRDKEWVPSLMGETELNEMVEACVLLDRVTTG |
Ga0182193_10632192 | 3300017443 | Miscanthus Phyllosphere | MAPKRGGGNTKKAAAGTSRDKECVPSLMGETELNEMVAAGVLP |
Ga0182233_10789821 | 3300017680 | Miscanthus Phyllosphere | MAPKRGGGNPKKAAIGESHDKEWVLSLMGETELNGMVEVAV |
Ga0182218_11250491 | 3300017683 | Miscanthus Phyllosphere | MGGGNAKKATAGASHDKEWVQSLMGEMELNEMVEV |
Ga0182218_11299561 | 3300017683 | Miscanthus Phyllosphere | MAPKRGGGNAKKAATGVSHDKEWVPSLRGETELNEMVEAGVLPDCVTVG |
Ga0182225_11248671 | 3300017684 | Miscanthus Phyllosphere | MVPKRGGGNAKKVAAGVSRDKEWVPSLMGEMKLNEMVEAGLLPDRVTAGWRP |
Ga0182227_11357322 | 3300017685 | Miscanthus Phyllosphere | MAPKKGGGNPKKAAAGTSHDKEWVPSLMGETELNGMVEAGVLADRVTARWRSA |
Ga0182205_10654671 | 3300017686 | Miscanthus Phyllosphere | MASKRGGGNPKKAATGASHDKEWVPSLMGEMELNEMVAAGIPLK |
Ga0182205_10935311 | 3300017686 | Miscanthus Phyllosphere | MAVKRGGGNSKKATIGASHDNEWVPSLMGEMELNEMVEAGVLPNRITAG |
Ga0207642_104675221 | 3300025899 | Miscanthus Rhizosphere | MAPKRGGGNTNKAAIEASHDKEWVPPLMGEMKLNEM |
Ga0207689_110183741 | 3300025942 | Miscanthus Rhizosphere | MAPKRGDGNPKKVATEASHDKEWVPSFMGDTELIEMVEAGVLPV |
Ga0207648_120071201 | 3300026089 | Miscanthus Rhizosphere | MASKRGGGNTKKAATGVSHDKEWVPSLMGETELNEMVEAGVLPDRVTVGWR |
⦗Top⦘ |