Basic Information | |
---|---|
Family ID | F059459 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 46 residues |
Representative Sequence | MALTNSLAGRNLGMILLGLWLILTGLLPLLNIRLSSTVTTGLAVLGIAA |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.01 % |
% of genes near scaffold ends (potentially truncated) | 83.58 % |
% of genes from short scaffolds (< 2000 bps) | 91.04 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.821 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.164 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.284 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.687 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.74% β-sheet: 0.00% Coil/Unstructured: 40.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF07676 | PD40 | 10.45 |
PF09285 | Elong-fact-P_C | 4.48 |
PF00069 | Pkinase | 3.73 |
PF03061 | 4HBT | 2.99 |
PF07969 | Amidohydro_3 | 2.24 |
PF07690 | MFS_1 | 2.24 |
PF00326 | Peptidase_S9 | 2.24 |
PF13432 | TPR_16 | 1.49 |
PF13174 | TPR_6 | 1.49 |
PF11008 | DUF2846 | 1.49 |
PF09579 | Spore_YtfJ | 1.49 |
PF07583 | PSCyt2 | 0.75 |
PF00884 | Sulfatase | 0.75 |
PF13245 | AAA_19 | 0.75 |
PF00254 | FKBP_C | 0.75 |
PF02075 | RuvC | 0.75 |
PF03938 | OmpH | 0.75 |
PF14534 | DUF4440 | 0.75 |
PF00930 | DPPIV_N | 0.75 |
PF01695 | IstB_IS21 | 0.75 |
PF13414 | TPR_11 | 0.75 |
PF04264 | YceI | 0.75 |
PF05163 | DinB | 0.75 |
PF00012 | HSP70 | 0.75 |
PF13360 | PQQ_2 | 0.75 |
PF06831 | H2TH | 0.75 |
PF02910 | Succ_DH_flav_C | 0.75 |
PF00072 | Response_reg | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 14.93 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.75 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.75 |
COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.75 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.75 |
COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.75 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.75 |
COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.82 % |
Unclassified | root | N/A | 14.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100365145 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 831 | Open in IMG/M |
3300000532|CNAas_1007011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
3300000550|F24TB_12273307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 537 | Open in IMG/M |
3300001432|JGI24034J14986_101331 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300002562|JGI25382J37095_10185576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300002907|JGI25613J43889_10156586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300004114|Ga0062593_100086058 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
3300004156|Ga0062589_101202708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → unclassified Actinomyces → Actinomyces sp. oral taxon 170 | 725 | Open in IMG/M |
3300005167|Ga0066672_10535986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300005178|Ga0066688_10160776 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300005294|Ga0065705_10197501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1430 | Open in IMG/M |
3300005295|Ga0065707_11006017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 538 | Open in IMG/M |
3300005332|Ga0066388_108547536 | Not Available | 509 | Open in IMG/M |
3300005337|Ga0070682_100945113 | Not Available | 711 | Open in IMG/M |
3300005353|Ga0070669_101841080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 528 | Open in IMG/M |
3300005367|Ga0070667_101607515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 611 | Open in IMG/M |
3300005438|Ga0070701_11161235 | Not Available | 546 | Open in IMG/M |
3300005444|Ga0070694_101946433 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005445|Ga0070708_100154648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
3300005454|Ga0066687_10801035 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300005466|Ga0070685_11536349 | Not Available | 514 | Open in IMG/M |
3300005467|Ga0070706_101268590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300005468|Ga0070707_100336956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1465 | Open in IMG/M |
3300005471|Ga0070698_101119632 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300005536|Ga0070697_100279453 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300005543|Ga0070672_101292393 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005544|Ga0070686_100981730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 692 | Open in IMG/M |
3300005545|Ga0070695_101702440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300005546|Ga0070696_100508380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 959 | Open in IMG/M |
3300005547|Ga0070693_100541565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
3300005549|Ga0070704_100262952 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300005555|Ga0066692_10087485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1823 | Open in IMG/M |
3300005563|Ga0068855_100455607 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300005563|Ga0068855_101554090 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005574|Ga0066694_10523335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300005577|Ga0068857_101432133 | Not Available | 672 | Open in IMG/M |
3300005598|Ga0066706_11258291 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005616|Ga0068852_102407072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300005840|Ga0068870_11084027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 575 | Open in IMG/M |
3300006031|Ga0066651_10788900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300006032|Ga0066696_10773588 | Not Available | 614 | Open in IMG/M |
3300006791|Ga0066653_10523871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300006796|Ga0066665_11387217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 543 | Open in IMG/M |
3300006881|Ga0068865_101625559 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300007004|Ga0079218_10001161 | All Organisms → cellular organisms → Bacteria | 9243 | Open in IMG/M |
3300007076|Ga0075435_100986547 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300009012|Ga0066710_101747629 | Not Available | 943 | Open in IMG/M |
3300009092|Ga0105250_10613275 | Not Available | 505 | Open in IMG/M |
3300009093|Ga0105240_10041348 | All Organisms → cellular organisms → Bacteria | 5884 | Open in IMG/M |
3300009101|Ga0105247_11585338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300009147|Ga0114129_12566103 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300009147|Ga0114129_12840537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 574 | Open in IMG/M |
3300009162|Ga0075423_13055222 | Not Available | 513 | Open in IMG/M |
3300009176|Ga0105242_11893108 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300009177|Ga0105248_10480057 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300010159|Ga0099796_10098507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
3300010303|Ga0134082_10426525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300010320|Ga0134109_10427550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300010325|Ga0134064_10229154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300010399|Ga0134127_10621059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
3300010399|Ga0134127_12124301 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300010400|Ga0134122_12687299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 549 | Open in IMG/M |
3300011003|Ga0138514_100103247 | Not Available | 619 | Open in IMG/M |
3300011271|Ga0137393_10796903 | Not Available | 808 | Open in IMG/M |
3300012043|Ga0136631_10411386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 550 | Open in IMG/M |
3300012096|Ga0137389_10868292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300012189|Ga0137388_10767762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
3300012189|Ga0137388_10956007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
3300012201|Ga0137365_10933800 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012203|Ga0137399_10848939 | Not Available | 769 | Open in IMG/M |
3300012209|Ga0137379_10064882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3514 | Open in IMG/M |
3300012209|Ga0137379_10433936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
3300012285|Ga0137370_10766615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300012360|Ga0137375_10113568 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
3300012361|Ga0137360_10119608 | Not Available | 2046 | Open in IMG/M |
3300012532|Ga0137373_10044455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4181 | Open in IMG/M |
3300012685|Ga0137397_11125938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300012922|Ga0137394_10842564 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 767 | Open in IMG/M |
3300012923|Ga0137359_10178153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1898 | Open in IMG/M |
3300012923|Ga0137359_10359003 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300012927|Ga0137416_11956865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300012929|Ga0137404_10103082 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300012929|Ga0137404_10452350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1140 | Open in IMG/M |
3300012948|Ga0126375_10773233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → environmental samples → uncultured Desulfobacterales bacterium HF0200_07G10 | 757 | Open in IMG/M |
3300012955|Ga0164298_11623572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300012985|Ga0164308_11196353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 686 | Open in IMG/M |
3300013307|Ga0157372_10215629 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
3300013308|Ga0157375_11298306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron | 856 | Open in IMG/M |
3300013760|Ga0120188_1007892 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300014487|Ga0182000_10121559 | Not Available | 907 | Open in IMG/M |
3300015245|Ga0137409_10454252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
3300015371|Ga0132258_13681167 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300017657|Ga0134074_1328638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300017789|Ga0136617_10729053 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300018028|Ga0184608_10432670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300018028|Ga0184608_10506114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 516 | Open in IMG/M |
3300018075|Ga0184632_10102144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
3300018429|Ga0190272_11087591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300018433|Ga0066667_11824938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 551 | Open in IMG/M |
3300018466|Ga0190268_11009567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300018469|Ga0190270_12002539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
3300018469|Ga0190270_12754330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 554 | Open in IMG/M |
3300018476|Ga0190274_11493573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
3300018482|Ga0066669_11886224 | Not Available | 555 | Open in IMG/M |
3300020001|Ga0193731_1130368 | Not Available | 632 | Open in IMG/M |
3300020022|Ga0193733_1193238 | Not Available | 527 | Open in IMG/M |
3300025900|Ga0207710_10536613 | Not Available | 609 | Open in IMG/M |
3300025907|Ga0207645_10209270 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300025910|Ga0207684_10152391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
3300025910|Ga0207684_10788839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300025910|Ga0207684_11404875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300025913|Ga0207695_10045678 | All Organisms → cellular organisms → Bacteria | 4648 | Open in IMG/M |
3300025925|Ga0207650_10773817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300025926|Ga0207659_10705703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300025934|Ga0207686_11110033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300025938|Ga0207704_10624782 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300025949|Ga0207667_10767833 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300025960|Ga0207651_11203961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300026023|Ga0207677_10956121 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 775 | Open in IMG/M |
3300026088|Ga0207641_12144852 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300026095|Ga0207676_11501925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300026095|Ga0207676_12203388 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300026318|Ga0209471_1231372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300027691|Ga0209485_1125860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300027748|Ga0209689_1173719 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300027875|Ga0209283_10501349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300027880|Ga0209481_10490714 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300027882|Ga0209590_10577105 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300027886|Ga0209486_10510020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300028792|Ga0307504_10007756 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
3300028878|Ga0307278_10363357 | Not Available | 638 | Open in IMG/M |
3300032180|Ga0307471_102196987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300032180|Ga0307471_102338549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300032180|Ga0307471_103094371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.16% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.73% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.24% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.49% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.49% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1003651452 | 3300000364 | Soil | MALTSNLAGRNLGLILLGLWLILTGLLPLLNIKISSTVTT |
CNAas_10070113 | 3300000532 | Quercus Rhizosphere | MALTNTLAGRNLGMILLGVWLILTGLLPLANIRISPT |
F24TB_122733072 | 3300000550 | Soil | MNLTRSWAGRNXXXXXXXXXXXXXXLLPLLNMRLSPNVTIGLAVLGIVAGILILLNR* |
JGI24034J14986_1013311 | 3300001432 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTNSLAGRNLGMLLLGLWLILTGLLPLLNMKLSSTVTTGLAVLGIVAGI |
JGI25382J37095_101855762 | 3300002562 | Grasslands Soil | MALTXXLAGKNLGMILLGLWLILTGLLPMLNIKVSSTWH* |
JGI25613J43889_101565861 | 3300002907 | Grasslands Soil | MSLTSAAGRNLGMLLLGLWLILTGLLPLLNFKLSSTVATGLAV |
Ga0062593_1000860581 | 3300004114 | Soil | VAITNTLAGRNLGMILLAIWLILTGLLPLLNIRVSTTVNTVLAVIA |
Ga0062589_1012027081 | 3300004156 | Soil | MALTSSLAGRNLGMILLGLWLILTGLLPLANVRVSSTVTTGLAVLGIVAGILILLKR* |
Ga0066672_105359862 | 3300005167 | Soil | MALTGGLAGRNLGMILLGLWLILTGLLPLLNIRISSTVTTGLAVL |
Ga0066688_101607761 | 3300005178 | Soil | KEERMALTSSLAGRNLGMILLGLWLILTGLLPLLNIRVSSTVTTGLGVLGIVAGISILLRR* |
Ga0065705_101975012 | 3300005294 | Switchgrass Rhizosphere | MALTNSLAGRNLGMILLGLWLILTGLLPLLSIRVSATVTTGLAVLAIAA |
Ga0065707_110060172 | 3300005295 | Switchgrass Rhizosphere | MALTNSLAGRNFGMILLGLWLILTGLLPLLSIRVSATVTTGLAVLAIAAG |
Ga0066388_1085475361 | 3300005332 | Tropical Forest Soil | MALTSGLAGKNFGMLLLGIWLILTGLLPLLNVRISATFTT |
Ga0070682_1009451131 | 3300005337 | Corn Rhizosphere | LAITNTLAGRNLGMILLAVWLILTGLLPLLSVRISPTVNT |
Ga0070669_1018410802 | 3300005353 | Switchgrass Rhizosphere | MALTNTLAGRNIGMLLLGLWLILTGLLPLLNIKLSSTMTTGLAVLAII |
Ga0070667_1016075151 | 3300005367 | Switchgrass Rhizosphere | LSKTKDPRPKAKDQIQKGEHMALTSSLAGRNLGMILLGLWLILTGLLPLANVRVSSTVTTGLAVLGIVAGILILLKR* |
Ga0070701_111612351 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFTGGLGSRKLGMLLLGIWLILTGLLPLLSVRLSPTFNTVLAV |
Ga0070694_1019464332 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTNTLAGRNIGMLLLGLWLILTGLLPLLNIKLSSTMTTGLAVLAIIAGI |
Ga0070708_1001546482 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTSGLAGRNPGMLLLGLWLILTGLLPLLNIKVSSTVTTGLAVLGIVAGILIVIRR* |
Ga0066687_108010352 | 3300005454 | Soil | MALTNSLAGRNLGMILLGLWLILTGLLPLLSIRVSSTVTT |
Ga0070685_115363491 | 3300005466 | Switchgrass Rhizosphere | MTLTSSLAGRNLGMLLLGLWLILTGLLPLLSIRTSPTVTTGLAVLG |
Ga0070706_1012685902 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVTNSLAGRNLGMLLLGLWLILTGLLPLLSIRVSPTVTTG |
Ga0070707_1003369562 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTSSLAGRNLGMILLGLWLILTGLLPLLNMRLSSTITTGL |
Ga0070698_1011196321 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTNSFAGRNFGMILLGLWLILTGLLPLLNMKLSSTVTTGL |
Ga0070697_1002794532 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTNSLAGRNLGMILLGLWLILTGLLPLFNMRVSTTVTTGLAVLGIIAGILILLRR* |
Ga0070672_1012923931 | 3300005543 | Miscanthus Rhizosphere | MGITNTLAGRNLGMALLAIWLILTGLLPLLSIRVSTTV |
Ga0070686_1009817302 | 3300005544 | Switchgrass Rhizosphere | KDQIQKGEHMALTSSLAGRNLGMILLGLWLILTGLLPLANVRVSSTVTTGLAVLGIVAGILILLKR* |
Ga0070695_1017024401 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTNSLAGRNLGLLLLGIWLILNGLLPLLNMRLSSTVTTGLGV |
Ga0070696_1005083801 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTSSLAGRNLGMILLGLWLILTGLLPLLSIRVSPTVTTGLAVLG |
Ga0070693_1005415651 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LAITNTLAGRNLGMILLAIWLILTGLLPLLSIRVSTTVNTVLA |
Ga0070704_1002629523 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLTRGWAGRNLGMTLLGLWLIITGLLPLLNMRLSANVTIGLAVLGIVAGILILLRR* |
Ga0066692_100874852 | 3300005555 | Soil | MALTGGLAGRNLGMILLGLWLILTGLLPLVNIRISSTV |
Ga0068855_1004556072 | 3300005563 | Corn Rhizosphere | MALTNSLAGRNLGMILLALWLIITGFLQILSVRVSETAMMALAVLAIAAGLLILLRR* |
Ga0068855_1015540901 | 3300005563 | Corn Rhizosphere | MALTNSLAGRNFGMILLAIWLILTGLLPLLNVRISSTVSMALAILAIA |
Ga0066694_105233352 | 3300005574 | Soil | MALTGTLAGRNLGLTLLGLWLILTGLLPLLNIKVS |
Ga0068857_1014321332 | 3300005577 | Corn Rhizosphere | MAIGLEGRNIGMILLGLWLILTGLLPLLKVSVSSTVATGLGVL |
Ga0066706_112582911 | 3300005598 | Soil | MVITNSLAGRNLGMLLLGLWLILTGLLPLLNMRLSSAVTTGLSILGIVAGILI |
Ga0068852_1024070722 | 3300005616 | Corn Rhizosphere | MALTNNLAGRNLGMLLLGLWLILPGILPLLNVKVSATVTTGLAILGIVAGILILLRR* |
Ga0068870_110840271 | 3300005840 | Miscanthus Rhizosphere | MALTNSLAGRNFGMVLLGVWLILTGLLPLLSVRISPTFTT |
Ga0066651_107889001 | 3300006031 | Soil | MALTSGLIGRNLGMLLLGLWLILTGLLPLLSIKVSST |
Ga0066696_107735883 | 3300006032 | Soil | MALTSFAGRSLGMVLLGLWLILTGLLPLLNMKISSTVTTGLAILGIAAG |
Ga0066653_105238712 | 3300006791 | Soil | MALTSSLAGRNLGMTLLGLWLILTGLLPFLNIKVSSTVTTGLAVLGIV |
Ga0066665_113872171 | 3300006796 | Soil | MALTNSLIGRNLGMILLGLWLILTGLLPLLSIRVSSTVTTGLA |
Ga0068865_1016255592 | 3300006881 | Miscanthus Rhizosphere | MALTSSLAGRNLGMILLGLWLILTGLLPLANVRVSSTVTTGLAVLGIVACILILLKR* |
Ga0079218_100011618 | 3300007004 | Agricultural Soil | MALTDSLAGRNLGMILLGLWLILTGLLPLLDVRVSATV |
Ga0075435_1009865471 | 3300007076 | Populus Rhizosphere | MALTSFAGRSLGMLLLGLWLILTGLLPLLNMKLSSTVNTGLAVLGIIAGILIL |
Ga0066710_1017476292 | 3300009012 | Grasslands Soil | MALTNSLAGRNLGLLLLGLWLILNGLLPLLNMRLSSTVTTGLAVLGIVAVVRQLGQLGMRHGP |
Ga0105250_106132751 | 3300009092 | Switchgrass Rhizosphere | MALTSTLAGKNLGMVLLGIWLILTGLLPLLSVRVS |
Ga0105240_100413487 | 3300009093 | Corn Rhizosphere | MALTNSLAGRNLGMILLALWLIINGFLQILSVRVSATAMMALAVLAIAAGLLILLRR* |
Ga0105247_115853382 | 3300009101 | Switchgrass Rhizosphere | LAITNTLAGKNLGMILLAIWLILTGLLPLLNIRVSTTVN |
Ga0114129_125661032 | 3300009147 | Populus Rhizosphere | LALTNTLAGRNLGMILLAVWLILTRLLPLLNVRVSTTVTTVLAVLAIA |
Ga0114129_128405372 | 3300009147 | Populus Rhizosphere | MALTNSLAGRNLGMLLLGLWLILTGLLLLLNMKLSSEV |
Ga0075423_130552222 | 3300009162 | Populus Rhizosphere | MALTSSLAGRNLGMLLLGIWLILTGLLPLLNMKLSSTVTTGLAVLGIVAG |
Ga0105242_118931082 | 3300009176 | Miscanthus Rhizosphere | MALTSSLAGRNLGMILLGLWLILTGLLPLLNMRISS |
Ga0105248_104800571 | 3300009177 | Switchgrass Rhizosphere | MALTDSLAGRNLGMILLGLWLIITGLLPLLNIRVSSTVTTGLAIL |
Ga0099796_100985072 | 3300010159 | Vadose Zone Soil | MALTNSLAGRNLGMTLLGLWLILTGLLPFLNIKVSSTVTTGLAVLGIVAGILILLRR* |
Ga0134082_104265251 | 3300010303 | Grasslands Soil | MALTSGLAGKNLGMILLGLWLILTGLLPMLNIKVSSTVTT |
Ga0134109_104275502 | 3300010320 | Grasslands Soil | MALTSCLAGRNLGLLLLGLWLILTGLLPLLNIKVSS |
Ga0134064_102291541 | 3300010325 | Grasslands Soil | MALTSGLAGKNLGMILLGLWLILTGLLPLLNIKVSSTVTTG |
Ga0134127_106210592 | 3300010399 | Terrestrial Soil | MALTSSLAGRNLGMILLGVWLILTGLLPLLSIRVSPTVT |
Ga0134127_121243011 | 3300010399 | Terrestrial Soil | MTLSSFAGKNLGMILLGPWLILTCLLPLLNIKLSSTVTTGLAVLGIIAGIL |
Ga0134122_126872992 | 3300010400 | Terrestrial Soil | MALTNSLAGRNIGMLLLGLWLILTGLLPLLNIKLSS |
Ga0138514_1001032471 | 3300011003 | Soil | MALTNSLAGRNLGLLLLGVWLILTGLLPLLNMKLSSTVTTGLAVLG |
Ga0137393_107969031 | 3300011271 | Vadose Zone Soil | MALTNSLAGRNLGLTLLGLLLILTGILPFLNMRVSATVTTGLAVLGIVAGILILLRR* |
Ga0136631_104113861 | 3300012043 | Polar Desert Sand | MALTNGFANRNLGMILLGLWLILTGLLPFLDMKLSPMVTTGLAVLGIVAGIL |
Ga0137389_108682922 | 3300012096 | Vadose Zone Soil | MALTNSLAGRNLGMTLLGLWLILTGLLPFLNMRVSSTVYTALAALGIVAGILI |
Ga0137388_107677622 | 3300012189 | Vadose Zone Soil | MALTSLAGRNLGMLLLGLWLILTGLLPLLNIKLSSTV |
Ga0137388_109560071 | 3300012189 | Vadose Zone Soil | MRFAESFVGRNVGLLLLGIWLILTGLLPLLNVRLSSTMLTALAVLAIAAGIL |
Ga0137365_109338002 | 3300012201 | Vadose Zone Soil | MTLINSFAGRNLGMLLLGLWLILTGLLPLLSVRPSS |
Ga0137399_108489391 | 3300012203 | Vadose Zone Soil | MALTTSLAGRNLGLTLLGLWLILTGLLPFLNIRISSTVTTGLAVLAVVAGILILLRR* |
Ga0137379_100648821 | 3300012209 | Vadose Zone Soil | MALTSSLAGRNLGLTLLGVWLILTGLLPLLNIKVSSTVTTGLAV |
Ga0137379_104339361 | 3300012209 | Vadose Zone Soil | MALTSSLAGRNLGLTLLGVWLILTGLLPLLNIKVSSTVTTGLAVLGIAAGVLI |
Ga0137370_107666152 | 3300012285 | Vadose Zone Soil | MASILAGRNLGMILLGLWLILTGLLPLLSVRLSST |
Ga0137375_101135684 | 3300012360 | Vadose Zone Soil | MALTNSLAGRNLGMLLLGIWLILTGLLPLLNMRLSATVT |
Ga0137360_101196082 | 3300012361 | Vadose Zone Soil | MALISSFAGRNLGMLLLGLWLILTGLLPLLSVRPSSTVTTGLAVLG |
Ga0137373_100444551 | 3300012532 | Vadose Zone Soil | MKMTSLGGRNLGMLLLGIWLILTGLLPLLSIRVSSTVTMV |
Ga0137397_111259381 | 3300012685 | Vadose Zone Soil | MRFAESFVGRNVGLLLLGIWLILTGLLPLLNVRLSSTMLTALAVLAIVAGI |
Ga0137394_108425643 | 3300012922 | Vadose Zone Soil | MALTNSLAGRNLGMILLGLWLILTGLLPLLNMRLS |
Ga0137359_101781533 | 3300012923 | Vadose Zone Soil | MALTSFAGRNLGMLLLGLWLILTGLLPLLNMRLSSTVTTGLAVLG |
Ga0137359_103590032 | 3300012923 | Vadose Zone Soil | MALTSSFAGRNLGMLLLGLWLILTGLLPLLNMRLSSTVTTGLAVLG |
Ga0137416_119568652 | 3300012927 | Vadose Zone Soil | MALTSSLAGRNLGMTLLGLWLILTGLLPLLNIKVSSTVTTGLAVLGIAASILILLRR* |
Ga0137404_101030823 | 3300012929 | Vadose Zone Soil | MALTNSLAGRNFGMILLGLWLILTGLLPLLNMRVSTTVTTGLAVLGIIAGILILLRR* |
Ga0137404_104523501 | 3300012929 | Vadose Zone Soil | MALTNSLAGRNLGMLLLGLWLILTGLLPFLNMRPTSTVITGLAVLGIIAGVLILLKR* |
Ga0126375_107732331 | 3300012948 | Tropical Forest Soil | MALTNGLAGKNLGMLLLGIWLILTGLLPLLNVRISATF |
Ga0164298_116235721 | 3300012955 | Soil | MALTNNLAGRNFGMILLGLWLILTGLLPLLSIRVSSTVTTGLAVL |
Ga0164308_111963531 | 3300012985 | Soil | MSLTSTLKGRSLGMILLALWLILTGLLPLINTHLSGNVAM |
Ga0157372_102156294 | 3300013307 | Corn Rhizosphere | LAITNALAGRNLGMVLLAVWLILTGLLPLLSIRVSTTVNTVLA |
Ga0157375_112983061 | 3300013308 | Miscanthus Rhizosphere | MAIGLEGRNIGMILLGLWLILTGLLPLLKVSVSSTVATGLGVLA |
Ga0120188_10078923 | 3300013760 | Terrestrial | MAVTNSLAGRNLGMILLGIWLILTGLLPLLNVRLS |
Ga0182000_101215592 | 3300014487 | Soil | MLPGDAKERGADMALTTGFAGRSWGMILLGLWLIITGLLPLLSIRVSSTVSTAISVLAIAAGLLILLRRY* |
Ga0137409_104542521 | 3300015245 | Vadose Zone Soil | MALTSSLAGRNLGMILLGLWLILTGLLPLLNMKMSS |
Ga0132258_136811671 | 3300015371 | Arabidopsis Rhizosphere | MGITNTLAGRNLGMALLAIWLILTGLLPLLSIRVST |
Ga0134074_13286381 | 3300017657 | Grasslands Soil | MALTSGLIGRNLGMLLLGLWLILTGLLPLLSIKVSSTVTTA |
Ga0136617_107290531 | 3300017789 | Polar Desert Sand | MAVTNSLAGRNLGMLLLGLWLILTGLLPLLNMKVSSAVMTGLA |
Ga0184608_104326701 | 3300018028 | Groundwater Sediment | MSLTSSVGKNLGMILLGLWLILTGLLPLLNIKVSSTV |
Ga0184608_105061141 | 3300018028 | Groundwater Sediment | MALTNSLAGRNLGMILLAIWLILTGLLPLLNVRISPTVSM |
Ga0184632_101021443 | 3300018075 | Groundwater Sediment | MKLTDSLGSRNLGMLLLGIWLILTGLLPLINMRISPTVT |
Ga0190272_110875911 | 3300018429 | Soil | MAVTDGFAGRSLGMILLAIWLILTGLLPLLNVKLSPTMTMGLAILAIAAG |
Ga0066667_118249381 | 3300018433 | Grasslands Soil | MALTSSLAGRNLGMILLGLWLILTGLLPLLNMRVSSTVATGLAVLAIVAG |
Ga0190268_110095671 | 3300018466 | Soil | MAVTDGFAGRSFGMILLAIWLIVTGLLPLLNVKLSTNVTMGLAILAIAA |
Ga0190270_120025391 | 3300018469 | Soil | MALTSSLAGRNLGMILLGVWLILTGLLPLANMRLSP |
Ga0190270_127543301 | 3300018469 | Soil | MAITNSLAGRNLGMILLGLWLILTGLLPLLSIRVSSTVTTGLAVLGIAAGL |
Ga0190274_114935731 | 3300018476 | Soil | MAITNGLAGRNLGMLLLGLWLILTGLLPLLNVRVSTAVTTGLAVLGIVD |
Ga0066669_118862241 | 3300018482 | Grasslands Soil | MALTNSLAGRNLGLLLLGLWLILNGLLPLLNMRLSSTVTTGLAVLGIVAGILILLRR |
Ga0193731_11303681 | 3300020001 | Soil | MGLTNNLAGRNLGMLLLGLWLILTGLLPLLNMKLSATVTTGLAVLGIVA |
Ga0193733_11932381 | 3300020022 | Soil | MALTSFAGRSFGMLLLGLWLILTGLLPLLSIKVSSTVTTGLAVLAIVAG |
Ga0207710_105366132 | 3300025900 | Switchgrass Rhizosphere | VAITNTLAGRNLGMILLAIWLILTGLLPLLSIRVSPTVNTVLAVLAIA |
Ga0207645_102092701 | 3300025907 | Miscanthus Rhizosphere | MALTSSLAGRNLGMILLGLWLILTGLLPLLNMRISSTVTTGLAILGI |
Ga0207684_101523911 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFAGSFVGRNVGLLLLGIWLILTGLLPLLNVRLSSTMLTALAVLAIVA |
Ga0207684_107888392 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTSLAGRNLGMILLGLWLILTGLLPLLNIKLSSTVTTGLAVLGIAAGI |
Ga0207684_114048751 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTSLAGRNLGMLLLGLWLILYNLLPLLNIKLSS |
Ga0207695_100456782 | 3300025913 | Corn Rhizosphere | MALTNSLAGRNLGMILLALWLIINGFLQILSVRVSATAMMALAVLAIAAGLLILLRR |
Ga0207650_107738171 | 3300025925 | Switchgrass Rhizosphere | MALTNSLAGRNLGMILLALWLIITGFLQILDVRVSATAMMALAIL |
Ga0207659_107057031 | 3300025926 | Miscanthus Rhizosphere | MAISNTLAGRNLGMILLAIWLILTGLLPLLSIRVSTTVTTVLAIL |
Ga0207686_111100332 | 3300025934 | Miscanthus Rhizosphere | MALTNNLAGRNFGVILLGLWLILTGLLPLLNIRVSSTV |
Ga0207704_106247822 | 3300025938 | Miscanthus Rhizosphere | MALTNSLAGRNLGMILLGVWLILTGLLPLLSVRISPTVTTVL |
Ga0207667_107678332 | 3300025949 | Corn Rhizosphere | MALTNSLAGRNLGMILLALWLIITGFLQILSVRVSETAMMALAVLAIAAGLLILLRR |
Ga0207651_112039612 | 3300025960 | Switchgrass Rhizosphere | MALTNTLAGRNIGMLLLGLWLILTGLLPLLNIKLSSTVTTGL |
Ga0207677_109561211 | 3300026023 | Miscanthus Rhizosphere | MPLTNNLAGRNLGMLLLGLWLILTGLLPLLSIRVSSTVTMGLAVLGIVA |
Ga0207641_121448521 | 3300026088 | Switchgrass Rhizosphere | MALTDGLAGRNLGMILLGLWLILTGLLPLLNIKISSTVTT |
Ga0207676_115019252 | 3300026095 | Switchgrass Rhizosphere | MALTNSLAGRNLGMILLGLWLILTGLLPLLNIRLSSTVTTGLAVLGIAA |
Ga0207676_122033881 | 3300026095 | Switchgrass Rhizosphere | VAITNTLASRSLGMILLAIWLILTGLLPLLNVRISATVNTVLAVIAIA |
Ga0209471_12313722 | 3300026318 | Soil | MAVTSTLAGRNLGMLLLGLWLILTGLLPLLSIRISSTVTTALAVLGIVAGIL |
Ga0209485_11258601 | 3300027691 | Agricultural Soil | MAVTDGFAGRNLGMILLAIWLILTGLLPLLNVKLSPTMTT |
Ga0209689_11737192 | 3300027748 | Soil | MALTGGLAGRNLGMILLGLWLILTGLLPLVNIRISSTVTTGLAVLGIAAG |
Ga0209283_105013492 | 3300027875 | Vadose Zone Soil | MALTSGLAGRNLGMLLLGVWLILTGLLPLLNMRLSSTVTTGLAVLGIVAGIL |
Ga0209481_104907142 | 3300027880 | Populus Rhizosphere | MALTNSVAGRNLGMLLLGLWLILTGLLPLLNIKVSSTVT |
Ga0209590_105771052 | 3300027882 | Vadose Zone Soil | MALTSSLAGRNLGMILLGLWLILTGLLPLLSIRVSTTVTTGLAVLGIV |
Ga0209486_105100203 | 3300027886 | Agricultural Soil | MAVTNSLAGRNLGMILLGIWLILTGLLPLLNVRLSSTVNMGLAVLAIAA |
Ga0307504_100077563 | 3300028792 | Soil | MAFTKSLAGRNFGMILLGLWLILTGLLPLLSMKVSTTVTTGLAVLGIIAGILILLRR |
Ga0307278_103633571 | 3300028878 | Soil | MALTNSLAGRNLGMLLLGLWLILNGLLPLLNMKLSPTV |
Ga0307471_1021969872 | 3300032180 | Hardwood Forest Soil | MKLTDGLGNRNLGMLLLGIWLILTGLLPLVNMRVSPAVSTGL |
Ga0307471_1023385492 | 3300032180 | Hardwood Forest Soil | MKLTSSLAGRSVGMLLLGIWLILTGLLPLLNMRFSATVGTVLAVIAVVA |
Ga0307471_1030943712 | 3300032180 | Hardwood Forest Soil | MKLTNSLGSRSVGMLLLGVWLILTGLLPLLNMRLSATVSTALAVLAVVAGIL |
⦗Top⦘ |