| Basic Information | |
|---|---|
| Family ID | F059446 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RVLNNVVDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.31 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.254 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.597 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.761 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.269 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.78% β-sheet: 0.00% Coil/Unstructured: 51.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.25 % |
| All Organisms | root | All Organisms | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.37% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 25.37% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.73% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.73% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.99% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.24% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.49% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.49% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.75% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100374873 | 3300000101 | Marine | RDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV* |
| DelMOSum2010_100782442 | 3300000101 | Marine | VLTKVRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEV* |
| DelMOSum2011_100388281 | 3300000115 | Marine | LTKVRDASGLXPSDPKFDRMTARFVEDFARGGLAKILEV* |
| DelMOSpr2010_100551991 | 3300000116 | Marine | VDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| DelMOWin2010_100530311 | 3300000117 | Marine | RVLNNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV* |
| JGI24006J15134_101780411 | 3300001450 | Marine | RDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV* |
| JGI24006J15134_102000332 | 3300001450 | Marine | IAIFTERVLNNVVDANGLRPGDPRFDRLTAKFIENFARGGLAKILEV* |
| JGI24003J15210_100311981 | 3300001460 | Marine | AIFTERVLTKVRDASGLRPSDPRFDRMTARFVEDFARGGLAKILEV* |
| JGI24003J15210_100349023 | 3300001460 | Marine | AIFTERVLTKVRDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV* |
| JGI24004J15324_100181842 | 3300001472 | Marine | IAIFTERVLNNVVDANGLRPGDPRFDRLTAKFTENFARGGLAKILEV* |
| Ga0055584_1002107852 | 3300004097 | Pelagic Marine | IAIFTERVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0075462_100235041 | 3300006027 | Aqueous | RDASGLKPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0075466_10335372 | 3300006029 | Aqueous | DANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0098038_10290132 | 3300006735 | Marine | LNKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0098038_11484042 | 3300006735 | Marine | RVLNKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0098037_11041821 | 3300006737 | Marine | VDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV* |
| Ga0070749_100902172 | 3300006802 | Aqueous | TDRVLTKVRDASGLRPGDPRFDRLTARFVEDFARGGLAKILEV* |
| Ga0070749_101378161 | 3300006802 | Aqueous | VLTKVRDANGLRPSDPRFDRMTARFVEDFARGGLAKILEV* |
| Ga0070749_104465101 | 3300006802 | Aqueous | VRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0075467_100872071 | 3300006803 | Aqueous | VVDANGLRPTDPRFDRLTARFIENFARGGLAKILEV* |
| Ga0070754_100621211 | 3300006810 | Aqueous | NVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0070750_100635381 | 3300006916 | Aqueous | NNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0070748_10550831 | 3300006920 | Aqueous | NNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0098060_10230981 | 3300006921 | Marine | NVVDANGLRPTDPRFDRLTARFVEDFARGGLAKILEV* |
| Ga0098060_10457682 | 3300006921 | Marine | TERVLNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV* |
| Ga0098045_11370932 | 3300006922 | Marine | LNNVVDANGLRPTDPRFDRLTAKFVEDFARGGLAKILEV* |
| Ga0098041_12719632 | 3300006928 | Marine | AIFTERVLNNVVDANGLRPTDPRFDRLTARFVEDFARGGLAKILEV* |
| Ga0098036_10529162 | 3300006929 | Marine | FTDRVLNNVVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV* |
| Ga0075468_100319181 | 3300007229 | Aqueous | NVVDANGLRPTDPRFDRLTARFIENFARGGLAKILEV* |
| Ga0075468_100360591 | 3300007229 | Aqueous | FTERVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0070747_10387262 | 3300007276 | Aqueous | FTERVLTKVRVASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0070747_10929062 | 3300007276 | Aqueous | LNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV* |
| Ga0070747_11291571 | 3300007276 | Aqueous | VRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEV* |
| Ga0070747_12149181 | 3300007276 | Aqueous | VLNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0070752_12114021 | 3300007345 | Aqueous | VVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV* |
| Ga0070752_12219262 | 3300007345 | Aqueous | VVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0099847_10313222 | 3300007540 | Aqueous | LNNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0070751_10822062 | 3300007640 | Aqueous | DANGLRPTDPRFDRLTARFIENFARGGLAKILEV* |
| Ga0115545_12301592 | 3300009433 | Pelagic Marine | RDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0115546_10945651 | 3300009435 | Pelagic Marine | RVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0115546_12277111 | 3300009435 | Pelagic Marine | KVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0098049_10896112 | 3300010149 | Marine | VLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0098049_11210832 | 3300010149 | Marine | TDRVLNKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV* |
| Ga0098056_12501691 | 3300010150 | Marine | VDANGLRPTDFRFDRSTARFIDEIKTPGGPEQPFAHGGLAKILEV* |
| Ga0129324_102079401 | 3300010368 | Freshwater To Marine Saline Gradient | TERVLNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0151674_11130691 | 3300011252 | Marine | TCLRPTYPNFDRLTARFIDETQNFAKGGLAKILEV* |
| Ga0129327_100587411 | 3300013010 | Freshwater To Marine Saline Gradient | IAIFTERVLNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV* |
| Ga0129327_101586201 | 3300013010 | Freshwater To Marine Saline Gradient | TEKVLNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV* |
| Ga0180120_101215521 | 3300017697 | Freshwater To Marine Saline Gradient | RVLNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV |
| Ga0180120_103893371 | 3300017697 | Freshwater To Marine Saline Gradient | IAIFTERVLNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0181377_10451132 | 3300017706 | Marine | IFTERVLNNVVDANGLRPTDPRFDRLTARIIEDFARGGLAKILEI |
| Ga0181383_10222992 | 3300017720 | Seawater | LNNVVDANGLRPGDPRFDRLSARFVEDFARGGLAKILEV |
| Ga0181388_10201311 | 3300017724 | Seawater | RVLTKVRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181381_10380621 | 3300017726 | Seawater | TKVRDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181401_10288891 | 3300017727 | Seawater | TKVKDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181419_10530292 | 3300017728 | Seawater | RVLNNVVDANGLRPTDPRFDRLTARIIEDFARGGLAKILEV |
| Ga0181396_10213551 | 3300017729 | Seawater | TKVRDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181417_11562531 | 3300017730 | Seawater | RDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181416_10158421 | 3300017731 | Seawater | VRDASGLKPSDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181415_11025272 | 3300017732 | Seawater | AIFTERVLTKVRDASGLKPSDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181426_11329241 | 3300017733 | Seawater | RVLTKVRDASGLKPSDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181389_10134961 | 3300017746 | Seawater | VLTKVRDASGLKPSDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181389_10266091 | 3300017746 | Seawater | NNVVDANGLRPGDPRFDRLSARFVEDFARGGLAKILEV |
| Ga0181389_10802651 | 3300017746 | Seawater | RVLNNVVDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181393_10208422 | 3300017748 | Seawater | FTERVLTKVKDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181393_10432462 | 3300017748 | Seawater | LNKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181393_11873591 | 3300017748 | Seawater | RVLNNVVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV |
| Ga0187219_11249071 | 3300017751 | Seawater | KVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181407_11565512 | 3300017753 | Seawater | NNVVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV |
| Ga0181411_10251932 | 3300017755 | Seawater | VVDANGLRPTDFRFDRSTARFIDEVQDFARGGLAKILEV |
| Ga0181411_12289111 | 3300017755 | Seawater | VVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV |
| Ga0181409_10806801 | 3300017758 | Seawater | NKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181409_10912841 | 3300017758 | Seawater | DANGLRPTDFRFDRSTARFIDEVQNFAHGGLAKILEV |
| Ga0181414_10159021 | 3300017759 | Seawater | VLNNVVYANGLRPGDPRFDRLSARFVEDFARGGLAKILEV |
| Ga0181414_10178812 | 3300017759 | Seawater | AIFTERVLTKVRDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0187221_10202191 | 3300017769 | Seawater | RVLNNVVDANGLRPGDPRFDRLSARFVEDFARGGLAKILEV |
| Ga0187221_10973901 | 3300017769 | Seawater | NVVDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0187221_12306461 | 3300017769 | Seawater | RDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181425_10645302 | 3300017771 | Seawater | RDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181425_11799841 | 3300017771 | Seawater | ERVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181430_10578402 | 3300017772 | Seawater | IAIFTQRVLNNVVDANGLRPTDPRFDRLTARIIEDFARGGLAKILEV |
| Ga0181394_10323742 | 3300017776 | Seawater | GLTKVRDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0181395_10375381 | 3300017779 | Seawater | VLNNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0181380_12509391 | 3300017782 | Seawater | TKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0181424_100517473 | 3300017786 | Seawater | FTERVLNNVVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV |
| Ga0212021_10102561 | 3300022068 | Aqueous | FTERVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0196889_10460102 | 3300022072 | Aqueous | VVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV |
| Ga0196887_10146021 | 3300022178 | Aqueous | NVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0196887_10204922 | 3300022178 | Aqueous | NNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV |
| (restricted) Ga0255048_101342722 | 3300024518 | Seawater | KVKDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| (restricted) Ga0255047_100662691 | 3300024520 | Seawater | KVRDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0207896_10084182 | 3300025071 | Marine | VLNNVVDANGLRPGDPRFDRLTAKFIENFARGGLAKILEV |
| Ga0207896_10241511 | 3300025071 | Marine | VVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0207896_10331381 | 3300025071 | Marine | VLTKVKDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0207896_10457032 | 3300025071 | Marine | LNNVVDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0207890_10093472 | 3300025079 | Marine | LTKVRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0207890_10246722 | 3300025079 | Marine | LNNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0208298_10119691 | 3300025084 | Marine | AIFTERVLNNVVDANGLRPTDPRFDRLTARFVEDFARGGLAKILEV |
| Ga0208157_10818002 | 3300025086 | Marine | ERVLNNVVDANGLRPTDPRFDRLTAKFVEDFARGGLAKILEV |
| Ga0208669_10147942 | 3300025099 | Marine | TERVLNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV |
| Ga0209535_10327322 | 3300025120 | Marine | ERVLTKVRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0209535_10394651 | 3300025120 | Marine | ERVLNNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0209535_10446501 | 3300025120 | Marine | LTKVRDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0209535_10468772 | 3300025120 | Marine | ERVLTKVRDASGLKPSDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0209535_10487321 | 3300025120 | Marine | TERVLTKVRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEI |
| Ga0209535_10513252 | 3300025120 | Marine | VLTKVRDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0209535_10535841 | 3300025120 | Marine | RVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0209535_10580031 | 3300025120 | Marine | ERVLTKVRDASGLRPSDPKFDRLTARFVEDFARGGLAKILEV |
| Ga0209535_10683682 | 3300025120 | Marine | ERVLNNVVDANGLRPGDPRFDRLSARFVEDFARGGLAKILEV |
| Ga0209535_10839641 | 3300025120 | Marine | TERVLTKVRDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0209535_11378251 | 3300025120 | Marine | TERVLTKVRDANGLRPGDPRFDRMTARFVEDFARGGLAKILEI |
| Ga0209535_11635112 | 3300025120 | Marine | ERVLTKVKDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0209336_100661112 | 3300025137 | Marine | TERVLNNVVDANGLRPGDPRFDRLTARFVEDFARGGLAKILEV |
| Ga0209336_101554692 | 3300025137 | Marine | IAIFTERVLNNVVDANGLRPGDPRFDRLTAKFIENFARGGLAKILEV |
| Ga0209337_10685911 | 3300025168 | Marine | FTERVLTKVKDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0208303_10213122 | 3300025543 | Aqueous | VIFTERVLNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0208303_10218541 | 3300025543 | Aqueous | NVVDANGLRPTDPRFDRLTARFIENFARGGLAKILEV |
| Ga0208303_10233282 | 3300025543 | Aqueous | AIFTERVLNNVVDANGLRPGDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0209195_11335471 | 3300025590 | Pelagic Marine | TERVLTKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0208134_10332452 | 3300025652 | Aqueous | DRVLNKVRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0208795_10549252 | 3300025655 | Aqueous | ERVLTKVRDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0208899_10424422 | 3300025759 | Aqueous | LNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0208899_10437281 | 3300025759 | Aqueous | ERVLNNVVDANGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0208645_10085491 | 3300025853 | Aqueous | VLTKVRDASGLRPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0208645_10581932 | 3300025853 | Aqueous | VVDANGLRPTDPRFDRLTARFIENFARGGLAKILEV |
| Ga0208644_12938182 | 3300025889 | Aqueous | VRDASGLRPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0209631_100532512 | 3300025890 | Pelagic Marine | AIFTERVLNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV |
| Ga0256382_11733782 | 3300028022 | Seawater | NVVDAAGNRPSDPRFDRFTARFVDEVQDFARGGLAKILEV |
| Ga0183755_10286772 | 3300029448 | Marine | FTERVLTKVRDASGLKPSDPKFDRMTARFVEDFARGGLAKILEV |
| Ga0183757_10115183 | 3300029787 | Marine | FTDRVLNNVVDANGLRPGDPRFDRLTAKFVEDFARGGLAKILEV |
| Ga0183757_10170991 | 3300029787 | Marine | RVLNNVVDANGLRPGDPRFDRLTARFVEDFAKGGLAKILEV |
| Ga0315331_106431252 | 3300031774 | Seawater | RVLTKVRDASGLKPGDPRFDRMTARFVEDFARGGLAKILEV |
| Ga0316202_101777211 | 3300032277 | Microbial Mat | AIFTERVLNNVVDANGLRPTDPRFDRLTAKFVENFARGGLAKILEV |
| Ga0348337_144683_551_682 | 3300034418 | Aqueous | TERVLTKVRDASGLRPSDPRFDRMTARFVEDFARGGLAKILEV |
| ⦗Top⦘ |