NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059417

Metagenome / Metatranscriptome Family F059417

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059417
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 40 residues
Representative Sequence IVMGAGEGRPGLAMNSFMLQPGEDKIVAEQLSRILREHSA
Number of Associated Samples 125
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.49 %
% of genes near scaffold ends (potentially truncated) 97.01 %
% of genes from short scaffolds (< 2000 bps) 87.31 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.164 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.940 % of family members)
Environment Ontology (ENVO) Unclassified
(22.388 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.015 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 0.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF07690MFS_1 41.04
PF03737RraA-like 27.61
PF01522Polysacc_deac_1 2.24
PF00294PfkB 2.24
PF00754F5_F8_type_C 1.49
PF13561adh_short_C2 1.49
PF07969Amidohydro_3 1.49
PF00578AhpC-TSA 0.75
PF02685Glucokinase 0.75
PF00903Glyoxalase 0.75
PF01915Glyco_hydro_3_C 0.75
PF06537DHOR 0.75
PF13378MR_MLE_C 0.75
PF01182Glucosamine_iso 0.75
PF00975Thioesterase 0.75
PF01081Aldolase 0.75
PF00933Glyco_hydro_3 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 27.61
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 2.24
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 1.49
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.75
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.75
COG0837GlucokinaseCarbohydrate transport and metabolism [G] 0.75
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.16 %
UnclassifiedrootN/A32.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0696124All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300001593|JGI12635J15846_10070877Not Available2579Open in IMG/M
3300004092|Ga0062389_103805320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae567Open in IMG/M
3300004479|Ga0062595_101525116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae618Open in IMG/M
3300005187|Ga0066675_11423721All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300005290|Ga0065712_10379295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae754Open in IMG/M
3300005356|Ga0070674_101872860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae545Open in IMG/M
3300005435|Ga0070714_101926369All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005436|Ga0070713_101708552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae611Open in IMG/M
3300005439|Ga0070711_100040686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3136Open in IMG/M
3300005450|Ga0066682_10459045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300005468|Ga0070707_100544262All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1123Open in IMG/M
3300005536|Ga0070697_100076607All Organisms → cellular organisms → Bacteria2750Open in IMG/M
3300005538|Ga0070731_10061614All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2493Open in IMG/M
3300005547|Ga0070693_100706797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae738Open in IMG/M
3300005578|Ga0068854_101341379All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300005602|Ga0070762_10213181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1186Open in IMG/M
3300006046|Ga0066652_100080730All Organisms → cellular organisms → Bacteria2567Open in IMG/M
3300006052|Ga0075029_100601477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae735Open in IMG/M
3300006163|Ga0070715_10014899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2890Open in IMG/M
3300006173|Ga0070716_101851307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae501Open in IMG/M
3300006794|Ga0066658_10423841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae724Open in IMG/M
3300006871|Ga0075434_101777864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae623Open in IMG/M
3300007255|Ga0099791_10635724All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300009012|Ga0066710_102979378All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009038|Ga0099829_10031853All Organisms → cellular organisms → Bacteria3765Open in IMG/M
3300009089|Ga0099828_10778898All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300009137|Ga0066709_104177878All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009137|Ga0066709_104450875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300009143|Ga0099792_10961607All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300009545|Ga0105237_10738164All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300009759|Ga0116101_1123335Not Available618Open in IMG/M
3300009784|Ga0123357_10943006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300009826|Ga0123355_10052691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6600Open in IMG/M
3300010048|Ga0126373_11159137Not Available839Open in IMG/M
3300010048|Ga0126373_12459924Not Available580Open in IMG/M
3300010371|Ga0134125_11021847All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300010376|Ga0126381_104248541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300010396|Ga0134126_12327939All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300010397|Ga0134124_12101586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300010399|Ga0134127_10420796All Organisms → cellular organisms → Bacteria → Acidobacteria1327Open in IMG/M
3300012096|Ga0137389_11643937Not Available538Open in IMG/M
3300012205|Ga0137362_11372571All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300012208|Ga0137376_10207491All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300012349|Ga0137387_10245419All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1290Open in IMG/M
3300012349|Ga0137387_10673322All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300012357|Ga0137384_10760866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium785Open in IMG/M
3300012927|Ga0137416_10781045All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300012971|Ga0126369_12647254Not Available586Open in IMG/M
3300012986|Ga0164304_10342164All Organisms → cellular organisms → Bacteria → Acidobacteria1042Open in IMG/M
3300013105|Ga0157369_10376071All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300013105|Ga0157369_12034836All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300015373|Ga0132257_103065757Not Available608Open in IMG/M
3300016357|Ga0182032_10388802Not Available1125Open in IMG/M
3300017975|Ga0187782_10973701Not Available659Open in IMG/M
3300017995|Ga0187816_10228490Not Available811Open in IMG/M
3300018004|Ga0187865_1091463Not Available1129Open in IMG/M
3300018090|Ga0187770_10315408All Organisms → cellular organisms → Bacteria → Acidobacteria1218Open in IMG/M
3300020022|Ga0193733_1030809Not Available1514Open in IMG/M
3300020061|Ga0193716_1220836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium705Open in IMG/M
3300020579|Ga0210407_10212911Not Available1503Open in IMG/M
3300021088|Ga0210404_10771295Not Available549Open in IMG/M
3300021178|Ga0210408_10773570All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300021401|Ga0210393_10147550Not Available1889Open in IMG/M
3300021403|Ga0210397_10386704Not Available1044Open in IMG/M
3300021405|Ga0210387_10360381All Organisms → cellular organisms → Bacteria → Acidobacteria1285Open in IMG/M
3300021420|Ga0210394_10113620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2344Open in IMG/M
3300021432|Ga0210384_10213270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L461737Open in IMG/M
3300021474|Ga0210390_11517705Not Available530Open in IMG/M
3300021477|Ga0210398_11123050All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300022557|Ga0212123_10185161Not Available1562Open in IMG/M
3300023255|Ga0224547_1026545Not Available743Open in IMG/M
3300024271|Ga0224564_1072843Not Available685Open in IMG/M
3300024271|Ga0224564_1122200All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300025904|Ga0207647_10638141All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300025905|Ga0207685_10584412All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300025916|Ga0207663_11413841All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300025922|Ga0207646_11572188All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300025923|Ga0207681_10245769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1395Open in IMG/M
3300025928|Ga0207700_11261249All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300025929|Ga0207664_11585259Not Available577Open in IMG/M
3300025961|Ga0207712_10971669All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300026078|Ga0207702_10549470Not Available1129Open in IMG/M
3300026088|Ga0207641_11428711All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300026095|Ga0207676_12015888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300026095|Ga0207676_12189245Not Available551Open in IMG/M
3300026294|Ga0209839_10016075All Organisms → cellular organisms → Bacteria3007Open in IMG/M
3300026310|Ga0209239_1249232All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300026317|Ga0209154_1007842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5334Open in IMG/M
3300026335|Ga0209804_1249069All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300026481|Ga0257155_1026351Not Available853Open in IMG/M
3300026547|Ga0209156_10232133All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300026548|Ga0209161_10230441All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300026551|Ga0209648_10155029All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300027117|Ga0209732_1011725Not Available1469Open in IMG/M
3300027117|Ga0209732_1045806All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300027370|Ga0209010_1048156All Organisms → cellular organisms → Bacteria → Acidobacteria726Open in IMG/M
3300027738|Ga0208989_10103683Not Available968Open in IMG/M
3300027842|Ga0209580_10185438Not Available1030Open in IMG/M
3300027855|Ga0209693_10619478All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300027869|Ga0209579_10403849All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300027884|Ga0209275_10031483All Organisms → cellular organisms → Bacteria → Acidobacteria2451Open in IMG/M
3300028047|Ga0209526_10069103Not Available2484Open in IMG/M
3300028536|Ga0137415_10789003All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300028792|Ga0307504_10008747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2221Open in IMG/M
3300028795|Ga0302227_10298489Not Available613Open in IMG/M
3300028884|Ga0307308_10270461Not Available814Open in IMG/M
3300029636|Ga0222749_10445233All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300031090|Ga0265760_10023164All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300031681|Ga0318572_10881027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300031708|Ga0310686_117387521Not Available833Open in IMG/M
3300031715|Ga0307476_11070675All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300031719|Ga0306917_10400931Not Available1071Open in IMG/M
3300031720|Ga0307469_10590328All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300031720|Ga0307469_11416894All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300031753|Ga0307477_10657728Not Available703Open in IMG/M
3300031754|Ga0307475_10468178Not Available1012Open in IMG/M
3300031754|Ga0307475_10813083Not Available741Open in IMG/M
3300031820|Ga0307473_10556970Not Available784Open in IMG/M
3300031823|Ga0307478_10373518Not Available1178Open in IMG/M
3300031912|Ga0306921_12444641Not Available544Open in IMG/M
3300031941|Ga0310912_10372204Not Available1111Open in IMG/M
3300031947|Ga0310909_10930582Not Available713Open in IMG/M
3300031962|Ga0307479_11161177All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300032059|Ga0318533_10977849Not Available621Open in IMG/M
3300032160|Ga0311301_10153877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4144Open in IMG/M
3300032205|Ga0307472_101820960All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300032955|Ga0335076_10017527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7181Open in IMG/M
3300033158|Ga0335077_12043277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300033433|Ga0326726_10019670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5866Open in IMG/M
3300033475|Ga0310811_10867992All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300033807|Ga0314866_017689Not Available1016Open in IMG/M
3300034090|Ga0326723_0187913Not Available914Open in IMG/M
3300034125|Ga0370484_0173689Not Available584Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.46%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.99%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.24%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.49%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.49%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.49%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.49%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.75%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.75%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.75%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009784Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4Host-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_069612422228664022SoilAIVIGGGEGRSGLSMCSFMLQPSEEKIVAEQLSRALREHSS
JGI12635J15846_1007087733300001593Forest SoilIVIGAGEGRPGLAMNSFMLQPGEDKIVAEQLSRVLRDHAA*
Ga0062389_10380532013300004092Bog Forest SoilVIGGGEERPGLAMCSFMLQPGEDKIVAEQLSRLLREHAA*
Ga0062595_10152511613300004479SoilAILMGAGEDRPGLAMNSFMLQPGEDRIVADHLARIFREHSA*
Ga0066675_1142372113300005187SoilIVMGGGEGRPGLAMCSFMLQPGEEMMVAQQLSRILREHSA*
Ga0065712_1037929513300005290Miscanthus RhizospherePPIAVGGGEGRPGLAINSFMLQPGEERIVGDQLVKLFRDHAG*
Ga0070674_10187286013300005356Miscanthus RhizospherePAIVMGGGEGKPGMAMNSFMLQPGEDKIVADRLSKIFREHSA*
Ga0070714_10192636923300005435Agricultural SoilSIVIAAGEDRPGLAMNSFMLQPGEEQVIAGTLAKILRDHSA*
Ga0070713_10170855213300005436Corn, Switchgrass And Miscanthus RhizosphereIVIGGGEGRPGLTMCSFMLQPGEEKIVAEQLSSVLRQHKA*
Ga0070711_10004068643300005439Corn, Switchgrass And Miscanthus RhizosphereSIVIGGGEGRPGLTMCSFMLQPGEEKIVAEQLSSVLRQHKA*
Ga0066682_1045904523300005450SoilNPSIVMGGGEAGPGLAMNSFMLQPGEEQIVAEQLVSIFRAHSA*
Ga0070707_10054426213300005468Corn, Switchgrass And Miscanthus RhizosphereRNAKPPIVIGSGEGRPGLAMNSFMLQPREDKIVAQQLMKLFREHLA*
Ga0070697_10007660743300005536Corn, Switchgrass And Miscanthus RhizosphereSKPSIVMSVGEEQPGLGMNSFMLQPGEDKIVANQLARILREHSTRT*
Ga0070731_1006161433300005538Surface SoilAAATIVISGGEGRPDLTMCSFMLQPGEDRIVAEQLSRVLREHSA*
Ga0070693_10070679713300005547Corn, Switchgrass And Miscanthus RhizosphereAIVMGGGEGKPGMAMNSFMLQPGEDKIVADRLSKIFREHSA*
Ga0068854_10134137923300005578Corn RhizosphereGGEGRPGLMICSFMLQPGEEHIVADQLAKLFRDHSG*
Ga0070762_1021318123300005602SoilEEQPGLSMNSFMLQPGEDKLVAARLSQFLREHAA*
Ga0066652_10008073033300006046SoilSIVIGGGEGRPGLGMNSFMLQPGEDQIIADRLSKVLREHSA*
Ga0075029_10060147723300006052WatershedsEGRPGLSMCSFMLQPGEDKIVAERLAHILKEHSS*
Ga0070715_1001489913300006163Corn, Switchgrass And Miscanthus RhizosphereIGGGEGRPGLTMCSFMLQPGEDKIVAEQLSGILRGHSA*
Ga0070716_10185130723300006173Corn, Switchgrass And Miscanthus RhizosphereIGGGEGRPGLTMCSFMLQPGEDKIVAEQLSRVLREHSA*
Ga0066658_1042384123300006794SoilSKPSIVIGGGEGKPGLAMNSFMLQPGEEKIVAEQLVKLFKEHTA*
Ga0075434_10177786423300006871Populus RhizosphereEERPGLAMCSFMLQPGENKIVAQQLTKIFREHSTK*
Ga0099791_1063572423300007255Vadose Zone SoilIGGGEGHPGLAMNSFMLQPGEAEIIAQQLSKVLKEHAA*
Ga0066710_10297937813300009012Grasslands SoilSKPSIVIGGGEGKPGLAMNSFMLQPGEEKIVAEQLVKLFKVHSA
Ga0099829_1003185353300009038Vadose Zone SoilIIMGAGEDRPGLAMNSFMLQPGDNKVVAEQLTQIFRGHSASGK*
Ga0099828_1077889823300009089Vadose Zone SoilGEGRPGLAMNSFMLQPGEDKIVAEQLVKLFKAHSA*
Ga0066709_10417787813300009137Grasslands SoilGGGEGKPGLAMNSFMLQPGEEKIVAEQLVKLFKAHSA*
Ga0066709_10445087513300009137Grasslands SoilSKPSIVIGGGEGKPGLAMNSFMLQPGEEKIVAEQLVKLFKVHSA*
Ga0099792_1096160723300009143Vadose Zone SoilGEERPGLVMNSFMLQPGENRIVAERLTRILGEHSAS*
Ga0105237_1073816423300009545Corn RhizosphereIVLGGGENRQGMVMCSFMLQPGENKIVAEKLAGVLRQHATA*
Ga0116101_112333523300009759PeatlandPSIVMGAGEGRPGLAMNSFMLQPGEDKIVAEQLSRLLREHAA*
Ga0123357_1094300623300009784Termite GutEERPGLTMNSFMLQPGEAKIVADELSRVLREHTA*
Ga0123355_1005269113300009826Termite GutDEERPGLTMNSFMLQPGEGRIVADELSRVLREHSA*
Ga0126373_1115913723300010048Tropical Forest SoilIVIGDGEGRPGLSMCSFMLQPGDDKIVAERLSRILREHFA*
Ga0126373_1245992423300010048Tropical Forest SoilEGRPGLAMCSFMLKPGEDQIIAEQLLKVFREHSA*
Ga0134125_1102184723300010371Terrestrial SoilIGGGEERPGLAMNSFMLQPGEDQIIAEQLVKVLRSHSA*
Ga0126381_10424854123300010376Tropical Forest SoilLRHGDPAIVIGGGEGQPGLEMNSFMLEPGEDRIIAEQLRKVLGAHS*
Ga0134126_1232793923300010396Terrestrial SoilAIGGGEGRPGLAMNSFMLQPGEENIVAEQLVKLFREHAA*
Ga0134124_1210158613300010397Terrestrial SoilSIVLGGGENRPGLVMCSFMLQPGEHKIVAEKLAGVLRQHATA*
Ga0134127_1042079613300010399Terrestrial SoilPSIVMGGGEGKPGLAMNSFMLQPGEDKIVAEQLVKLFREHSA*
Ga0137389_1164393713300012096Vadose Zone SoilRSSKPSIVMGAGEGRPGLAMNSFMLQPGEDKIVAAQLSRLMREHAA*
Ga0137362_1137257123300012205Vadose Zone SoilGGEGRPGLAMSSFMLQPGEEQIIAEQLIKVFREHLS*
Ga0137376_1020749123300012208Vadose Zone SoilAAGEDRPGLAMNSFMLKPGEDEIVAVQLAQVFRQHAG*
Ga0137387_1024541923300012349Vadose Zone SoilSNPSIVMGGGEGRPGLAMNSFMLQPGEEQIVAEQLVNVFHAHSV*
Ga0137387_1067332223300012349Vadose Zone SoilGGGEGRPGLAMCSFMLQPGEDKIVAEQLARVLREHSA*
Ga0137384_1076086623300012357Vadose Zone SoilPSIVMGGGEGRPGLAMNSFMLQPGEEQIVAEQLVNVFRAHSA*
Ga0137416_1078104513300012927Vadose Zone SoilGEGRPGLAMSSFMLRPEEVRIVAEQLSRVLREHSA*
Ga0126369_1264725423300012971Tropical Forest SoilPSIVIGGGEGRQGLGMCSFMLQPGEDKIVADQLSRVLREHTA*
Ga0164304_1034216413300012986SoilSIVIGGGEGRPGLTMCSFMLQPGEEKIVAEQLSSVLRQHTA*
Ga0157369_1037607113300013105Corn RhizospherePSIIIGGGEGRPGLSMTAFMLQPGEHKIVAEQMEKLLKQHA*
Ga0157369_1203483613300013105Corn RhizospherePSIIMAAGEEKPGLSMNSFMLQAGEDKVVAEQLARILRERTA*
Ga0132257_10306575723300015373Arabidopsis RhizosphereGGEGRPGLTMCSFMLQPGEDKIVAEQLSGILRGHSA*
Ga0182032_1038880233300016357SoilPSIVIGGGEGKPGLSMNSFMLQPGEDQAVAERLAHVLRDHSA
Ga0187782_1097370123300017975Tropical PeatlandGGEGKPGLSMNSFMLQPGEDQIVAERLAYILREKSA
Ga0187816_1022849023300017995Freshwater SedimentGKPAIVISEGEDRPGLAMNSFMLQPGEDKIVAEQLSRVLREHAS
Ga0187865_109146313300018004PeatlandKPSIVMGAGEGRPGLAMNSFMLQPGEEKIVAEQLSRLLREHAA
Ga0187770_1031540813300018090Tropical PeatlandIAMGGGEGKPGLAMNSFMLQPGEDQIIADQLVRILRGQSS
Ga0193733_103080923300020022SoilPSIVMSVGEDTPGLGMNSFMLQPGEDKIVANQLVRIFREHSTRA
Ga0193716_122083623300020061SoilIVLGGGEDRPGLIMCSFMLQPGEHKLVADKLAGILSQRAG
Ga0210407_1021291123300020579SoilSPSIVIGSDESHQGLVMNSFMLQPGENKIVAEQLTRIFREHSSGK
Ga0210404_1077129523300021088SoilIVIAAGDESPGLAMNSFMLKPGEDKIVAEQLLKLFKEHAA
Ga0210408_1077357023300021178SoilVIGGGEGKPGLTMCSFMLLPGEDKIVAEQLSRVLREHSA
Ga0210393_1014755013300021401SoilRASKPSIVMGAGEGRPGLAMNSFMLQPGEDKLVAGQVSRLLREHAV
Ga0210397_1038670423300021403SoilIGSDESHPGLVMNSFMLQPGENKIVAEQLTRIFREHSSGK
Ga0210387_1036038133300021405SoilSSVISGGEERPGLNMNSFMLQPGEEKIVAEQLSRIFREHRA
Ga0210394_1011362033300021420SoilGGEGRPGLTMCSFMLQPGEDRIVAEQLSRILREHSA
Ga0210384_1021327023300021432SoilKPSVMIASGEDRPGLVMNSFMLQPGEEEIVASRLLQVFREHAA
Ga0210390_1151770513300021474SoilIGGGEGRPGLSMCSFMLQPGEDKIVAELLSRILREHSA
Ga0210398_1112305023300021477SoilGEEKPGLAMNSFMLQPGEDQIVAEHLSRILRQRSA
Ga0212123_1018516113300022557Iron-Sulfur Acid SpringGGGEGRPGLTMCSFMLQPGEDRIVAEQLSRILREHSA
Ga0224547_102654513300023255SoilPSIVLEPGEERPGLAMNSFILQPGEDKIVAEQLSRLLREHAA
Ga0224564_107284323300024271SoilIGAGEGRPGLAMNSFMLQPGEDKIVAEQLSRVLRDHAA
Ga0224564_112220013300024271SoilSIVIGIGEGRPGLAMNSFMLQPGEDKIVAEQLSRLLREHAA
Ga0207647_1063814113300025904Corn RhizosphereGGEGRPGLMICSFMLQPGEEHMVADQLTKLFREHSA
Ga0207685_1058441223300025905Corn, Switchgrass And Miscanthus RhizosphereGTGEDRPGLTMNSFMLQPGEHKIVADRLTEVLRGQSASKN
Ga0207663_1141384113300025916Corn, Switchgrass And Miscanthus RhizosphereGGEGRPGLSMCSFMLQPGEEQIIADQLTKLFREHSA
Ga0207646_1157218823300025922Corn, Switchgrass And Miscanthus RhizosphereAGEERPGLVMNSFMLQPGENRIVAERLTRILGEHSAS
Ga0207681_1024576913300025923Switchgrass RhizosphereKPAIVMGGGEGKPGMAMNSFMLQPGEDKIVADRLSKIFREHSA
Ga0207700_1126124923300025928Corn, Switchgrass And Miscanthus RhizospherePSIVIGGGEGRPGLTMCSFMLQPGEEKIVAEQLSSVLRQHKA
Ga0207664_1158525923300025929Agricultural SoilSIVIAAGEDRPGLAMNSFMLQPGEEQVIAGTLAKILRDHSA
Ga0207712_1097166913300025961Switchgrass RhizosphereAIVMGGGEGKPGMAMNSFMLQPGEDKIVADRLSKIFREHSA
Ga0207702_1054947013300026078Corn RhizospherePSIVIGGGEGRPGLTMCSFMLQPGEDKIVAEQLSRVLREHSV
Ga0207641_1142871123300026088Switchgrass RhizosphereVMGGGEGKPGLAMNSFMLQPGEDKIVAEQLVKLFREHSA
Ga0207676_1201588813300026095Switchgrass RhizosphereAGDERPNLSMCSFMLQPGEHKIVADKLVTIFREHGKSS
Ga0207676_1218924513300026095Switchgrass RhizosphereRESKPAILMGAGEDRPGLAMNSFMLQPGEDRIVADHLARIFREHSA
Ga0209839_1001607533300026294SoilSPGEEKPGLSMNSFMLQPGEDKIVADQLVQIFREHSA
Ga0209239_124923213300026310Grasslands SoilRSSKPSIVIGGGEGKPGLAMNSFMLQPGEEKIVAEQLVKLFKAHSA
Ga0209154_100784213300026317SoilVIGTGEDRRGLVVNSFMLQPGEDKIVAQQLVKLFREHSA
Ga0209804_124906923300026335SoilMGGGEGKPGLAMNSFMLQPGEEKIVAEQLVKLFKAHST
Ga0257155_102635113300026481SoilNSKPAIVIGGGEGRPGLTMCSFMLQPGEDRIVAEQLSRILREHSA
Ga0209156_1023213313300026547SoilGGEGRPGLGMNSFMLQPGEDQIIADRLSKVLREHSA
Ga0209161_1023044123300026548SoilKLLRSSRPSIVIGTGEDRRGLVVNSFMLQPGEDKIVAQQLVKLFREHSA
Ga0209648_1015502913300026551Grasslands SoilGEGEGRPGLAMNSFMLQPGEDRIVAEQLSRILREHAL
Ga0209732_101172513300027117Forest SoilGAGEGRPGLAMNSFMLQPGEDKIVAEQLSRVLRDHAA
Ga0209732_104580623300027117Forest SoilPSIVIGGGEERPGLVMNSFMLQPGEDNIVAEQLSRVLREHAA
Ga0209010_104815613300027370Forest SoilVIGGGEGRPGLVMCSFMLQPGEDKIVAEQLSRILREHSA
Ga0208989_1010368313300027738Forest SoilKPSIAIGEGEGRPGLGMNSFMLQPGEDKIVAEQLSRILREHAL
Ga0209580_1018543823300027842Surface SoilGGGEGRPGLSMCSFMLQPGEDKIVAERLAHILKEHSA
Ga0209693_1061947833300027855SoilAIVIGGGEGRPGLVMCSFMLQPGEDKIVAEQLSRILREHSA
Ga0209579_1040384923300027869Surface SoilAAATIVISGGEGRPDLTMCSFMLQPGEDRIVAEQLSRVLREHSA
Ga0209275_1003148343300027884SoilMSAGEEKPGLAMNSFMLQPGEDQIVAEQLSRILRQHSA
Ga0209526_1006910323300028047Forest SoilMEQANGPGLTMCSFMLQPGEDAIVAEQLSRILREQSA
Ga0137415_1078900313300028536Vadose Zone SoilLLRNSKPSIVMGGGEGRPGLAMSSFMLRPEEVRIVAEQLSRVLREHSA
Ga0307504_1000874713300028792SoilAKPPIVIGSGEGRPGLAMNSFMLQPGEDKIVAEQLVKLFREHSA
Ga0302227_1029848913300028795PalsaGEDRPGLAMNSFMLQPGEDKIVADQLSRLLREHAA
Ga0307308_1027046123300028884SoilDSKPSIVMSVGEDTPGLGMNSFMLQPGEDKIVANQLVRIFREHSTRA
Ga0222749_1044523313300029636SoilAEGKPGLSMNSFMLQPGENKIVADQLVRIFREHSA
Ga0265760_1002316433300031090SoilVMSAGEEKPGLAMNSFMLQPGEDQIVAEQLSRILRQHSA
Ga0318572_1088102713300031681SoilGEEKPGLTINSFMLQPGEDQIVADQLSRILREHAA
Ga0310686_11738752123300031708SoilPSIVIGGDEEQPGLLMCSFMLQPGEDEIVASTLSRILRGHLS
Ga0307476_1107067513300031715Hardwood Forest SoilMGAGEERPGLTMNSFMLQPGEDKVVAEQLSRILREHAA
Ga0306917_1040093123300031719SoilIGGGEGKPGLSMNSFMLQPGEDQAVAERLAHVLRDHSA
Ga0307469_1059032813300031720Hardwood Forest SoilMGGGEGKPGMAMNSFMLQPGEDKIVADRLSKIFREHSA
Ga0307469_1141689413300031720Hardwood Forest SoilGKPSIVMGGGEGKPGLAMNSIMLQPGEDKIVAEQLVKLFKEHSA
Ga0307477_1065772813300031753Hardwood Forest SoilGTGEGRPGLAMNSFMLQTGEDKIVAEQLSRLLREHAA
Ga0307475_1046817823300031754Hardwood Forest SoilASGEDRPGLVMNSFMLQPGEEEIVANRLLQIFREHSA
Ga0307475_1081308323300031754Hardwood Forest SoilIVIGGGEGRPGLAMNSFMLQPGEDKLVAEQLSRLLREHAV
Ga0307473_1055697023300031820Hardwood Forest SoilVKPPIAIGSGEGRPGLAMNSFMLKPGEDKIVAEQLAKMFREHSA
Ga0307478_1037351823300031823Hardwood Forest SoilAIVIGGGEGRPGLTMCSFMLQPGEDRIVAEQLSRILREHSA
Ga0306921_1244464123300031912SoilKPSIVIGDGEGQPGLLMCSFMLQPGEDKIVAEKLSQLLREHAA
Ga0310912_1037220423300031941SoilMRNSRPSIVIGGGEGKPGLSMNSFMLQPGEDQVVAERLAHVLRDHSA
Ga0310909_1093058213300031947SoilRNSRPSIVIGGGEGKPGLSMNSFMLQPGEDQAVAERLAHVLRDHSA
Ga0307479_1116117723300031962Hardwood Forest SoilAIVIGGGEGKPGLTMCSFMLQPGEDKIVAEQLSRVLREHSA
Ga0318533_1097784923300032059SoilATPPIAMSGGEEKPGLAINSFMLQPGEDQIVADQLSRILREHAA
Ga0311301_1015387733300032160Peatlands SoilVSSEEPPGVAMNSFMLQPGEDKIVAEQLSRLLREHGA
Ga0307472_10182096013300032205Hardwood Forest SoilIGGGEGRPGLTMCSFMLQAGEEKIVAEQLANVLRQHTA
Ga0335076_1001752713300032955SoilIVMGAGEGRPGLAMNSFMLQPGEDKIVAEQLSRILREHSA
Ga0335077_1204327713300033158SoilPSIVIGGGQGRPGLSLCSFMLQPGEDTIVAAQLSRILREHSA
Ga0326726_1001967023300033433Peat SoilVIGSGEERLGLAMNSFMLQPGEDKIVAEQLMKLFREHAA
Ga0310811_1086799213300033475SoilGGEGRPGLGMNSFMLQPGEEQIIADQLTKVLREHSA
Ga0314866_017689_4_1203300033807PeatlandMGGGEGRPGLSLNSFMLKPGEDRIVAEQLARVLREHSA
Ga0326723_0187913_786_9143300034090Peat SoilPPIVIGSGEERLGLAMNSFMLQPGEDKIVAEQLMKLFREHAA
Ga0370484_0173689_1_1113300034125Untreated Peat SoilGGEGRPGLTMCSFMLQPGEDKIVAEQLARILRGHSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.